PFRMAT RR
TARGET T0212
AUTHOR 4204-4258-2837
REMARK From group SAM-TO4-hand under the direction of
REMARK Kevin Karplus.
REMARK Project by George Shackelford and Kevin Karplus
REMARK The value given is an approximation of the probability
REMARK as provided by the neural network.
REMARK The number of predictions is limited to .5*sequence_length.
REMARK
METHOD The predictor is an artificial neural network
METHOD using 134 inputs.
METHOD Input includes separation and sequence length, corrected
METHOD mutual information between columns (M. Cline) and 
METHOD an e-value measure of correlation between columns (K Karplus) 
METHOD Other inputs are from alignments and
METHOD secondary predictions from SAM-t2k and SAM-t04 of 
METHOD University of California, Santa Cruz
METHOD This version uses a new error function designed to improve
METHOD the top scores per protein.
MODEL 1
MSALDNSIRVEVKTEYIEQQSSPEDEKYLFSYTITIINLGEQAAKLETRH
WIITDANGKTSEVQGAGVVGETPTIPPNTAYQYTSGTVLDTPFGIMYGTY
GMVSESGEHFNAIIKPFRLATPGLLH
93 118 0 8 0.224
33 56 0 8 0.214
2 13 0 8 0.214
66 104 0 8 0.21
33 60 0 8 0.208
22 56 0 8 0.208
11 97 0 8 0.206
52 76 0 8 0.202
13 25 0 8 0.2
2 25 0 8 0.198
61 76 0 8 0.196
88 113 0 8 0.192
13 86 0 8 0.192
33 111 0 8 0.191
24 104 0 8 0.189
17 97 0 8 0.189
19 78 0 8 0.187
79 105 0 8 0.185
42 79 0 8 0.185
9 113 0 8 0.183
11 113 0 8 0.181
61 93 0 8 0.178
39 113 0 8 0.178
2 86 0 8 0.178
90 118 0 8 0.176
74 104 0 8 0.174
52 61 0 8 0.173
64 84 0 8 0.171
76 93 0 8 0.169
57 103 0 8 0.169
52 72 0 8 0.169
41 99 0 8 0.169
27 111 0 8 0.169
13 40 0 8 0.168
11 39 0 8 0.168
76 99 0 8 0.166
20 104 0 8 0.166
88 123 0 8 0.164
13 26 0 8 0.164
9 39 0 8 0.164
47 120 0 8 0.163
43 87 0 8 0.163
31 104 0 8 0.163
25 86 0 8 0.163
23 104 0 8 0.161
4 93 0 8 0.161
61 99 0 8 0.159
39 99 0 8 0.159
33 99 0 8 0.159
22 87 0 8 0.159
2 26 0 8 0.159
27 64 0 8 0.158
16 92 0 8 0.158
72 100 0 8 0.156
44 86 0 8 0.156
24 66 0 8 0.156
60 108 0 8 0.155
30 44 0 8 0.155
93 108 0 8 0.152
27 99 0 8 0.152
43 64 0 8 0.15
41 76 0 8 0.15
15 121 0 8 0.15
END