PFRMAT RR
TARGET T0212
AUTHOR 4204-4258-2837
REMARK From group SAM-TO4-hand under the direction of
REMARK Kevin Karplus.
REMARK Project by George Shackelford and Kevin Karplus
REMARK The value given as the probability is actually the raw score
REMARK as provided by the neural network.
REMARK The number of predictions is limited to .5*sequence_length.
REMARK
METHOD The predictor is an artifical neural network
METHOD using 104 inputs.
METHOD Input includes separation and sequence length, corrected
METHOD mutual information between columns (M. Cline) and 
METHOD an e-value measure of correlation between columns (K Karplus) 
METHOD Other inputs are from alignments and
METHOD secondary predictions from SAM-t2k and SAM-t04 of 
METHOD University of California, Santa Cruz
MODEL 1
MSALDNSIRVEVKTEYIEQQSSPEDEKYLFSYTITIINLGEQAAKLETRH
WIITDANGKTSEVQGAGVVGETPTIPPNTAYQYTSGTVLDTPFGIMYGTY
GMVSESGEHFNAIIKPFRLATPGLLH
66 104 0 8 0.057
42 79 0 8 0.057
61 76 0 8 0.055
13 25 0 8 0.055
93 118 0 8 0.05
2 25 0 8 0.049
2 13 0 8 0.049
52 76 0 8 0.042
41 61 0 8 0.042
13 26 0 8 0.042
15 121 0 8 0.041
52 61 0 8 0.04
24 104 0 8 0.039
13 86 0 8 0.039
2 86 0 8 0.039
90 118 0 8 0.038
86 101 0 8 0.038
64 84 0 8 0.038
61 93 0 8 0.038
57 103 0 8 0.038
52 72 0 8 0.038
41 99 0 8 0.038
25 86 0 8 0.038
2 26 0 8 0.038
27 64 0 8 0.037
24 66 0 8 0.037
16 92 0 8 0.037
11 97 0 8 0.037
50 126 0 8 0.036
50 125 0 8 0.036
50 120 0 8 0.036
50 119 0 8 0.036
50 115 0 8 0.036
50 108 0 8 0.036
50 107 0 8 0.036
50 104 0 8 0.036
50 103 0 8 0.036
50 102 0 8 0.036
50 100 0 8 0.036
50 96 0 8 0.036
50 94 0 8 0.036
50 92 0 8 0.036
50 91 0 8 0.036
50 89 0 8 0.036
50 86 0 8 0.036
50 85 0 8 0.036
50 79 0 8 0.036
50 76 0 8 0.036
50 75 0 8 0.036
50 73 0 8 0.036
50 71 0 8 0.036
50 65 0 8 0.036
50 61 0 8 0.036
50 60 0 8 0.036
50 59 0 8 0.036
39 99 0 8 0.036
37 84 0 8 0.036
31 126 0 8 0.036
31 125 0 8 0.036
31 115 0 8 0.036
31 108 0 8 0.036
31 104 0 8 0.036
31 91 0 8 0.036
END