PFRMAT RR
TARGET T0211
AUTHOR 4204-4258-2837
REMARK From group SAM-TO4-hand under the direction of
REMARK Kevin Karplus.
REMARK Project by George Shackelford and Kevin Karplus
REMARK The value given is an approximation of the probability
REMARK as provided by the neural network.
REMARK The number of predictions is limited to .5*sequence_length.
REMARK
METHOD The predictor is an artificial neural network
METHOD using 134 inputs.
METHOD Input includes separation and sequence length, corrected
METHOD mutual information between columns (M. Cline) and 
METHOD an e-value measure of correlation between columns (K Karplus) 
METHOD Other inputs are from alignments and
METHOD secondary predictions from SAM-t2k and SAM-t04 of 
METHOD University of California, Santa Cruz
METHOD This version uses a new error function designed to improve
METHOD the top scores per protein.
MODEL 1
MRKIDLCLSSEGSEVILATSSDEKHPPENIIDGNPETFWTTTGMFPQEFI
ICFHKHVRIERLVIQSYFVQTLKIEKSTSKEPVDFEQWIEKDLVHTEGQL
QNEEIVAHDGSATYLRFIIVSAFDHFASVHSVSAEGTVVSNLSS
52 117 0 8 0.212
94 114 0 8 0.21
116 138 0 8 0.204
26 116 0 8 0.204
13 131 0 8 0.202
71 135 0 8 0.194
18 110 0 8 0.189
13 56 0 8 0.189
97 114 0 8 0.187
93 105 0 8 0.187
17 102 0 8 0.187
94 106 0 8 0.18
26 138 0 8 0.174
57 101 0 8 0.173
84 111 0 8 0.169
50 80 0 8 0.169
101 143 0 8 0.168
15 35 0 8 0.168
97 106 0 8 0.166
15 103 0 8 0.166
56 131 0 8 0.164
35 103 0 8 0.164
88 103 0 8 0.163
31 110 0 8 0.161
23 89 0 8 0.156
15 86 0 8 0.155
23 142 0 8 0.153
15 29 0 8 0.153
57 143 0 8 0.152
23 61 0 8 0.152
89 142 0 8 0.15
52 110 0 8 0.148
97 107 0 8 0.147
61 89 0 8 0.147
94 107 0 8 0.144
36 144 0 8 0.142
110 120 0 8 0.141
75 118 0 8 0.14
52 120 0 8 0.14
61 142 0 8 0.138
60 70 0 8 0.137
END