PFRMAT RR TARGET T0211 AUTHOR 4204-4258-2837 REMARK From group SAM-TO4-hand under the direction of REMARK Kevin Karplus. REMARK Project by George Shackelford and Kevin Karplus REMARK The value given as the probability is actually the raw score REMARK as provided by the neural network. REMARK The number of predictions is limited to .5*sequence_length. REMARK METHOD The predictor is an artifical neural network METHOD using 104 inputs. METHOD Input includes separation and sequence length, corrected METHOD mutual information between columns (M. Cline) and METHOD an e-value measure of correlation between columns (K Karplus) METHOD Other inputs are from alignments and METHOD secondary predictions from SAM-t2k and SAM-t04 of METHOD University of California, Santa Cruz MODEL 1 MRKIDLCLSSEGSEVILATSSDEKHPPENIIDGNPETFWTTTGMFPQEFI ICFHKHVRIERLVIQSYFVQTLKIEKSTSKEPVDFEQWIEKDLVHTEGQL QNEEIVAHDGSATYLRFIIVSAFDHFASVHSVSAEGTVVSNLSS 52 117 0 8 0.045 50 80 0 8 0.043 17 102 0 8 0.043 101 143 0 8 0.042 57 143 0 8 0.042 89 142 0 8 0.041 60 70 0 8 0.041 52 120 0 8 0.041 23 142 0 8 0.041 97 107 0 8 0.04 97 106 0 8 0.04 94 107 0 8 0.04 94 106 0 8 0.04 71 135 0 8 0.04 61 142 0 8 0.04 61 89 0 8 0.04 57 101 0 8 0.04 116 138 0 8 0.039 97 114 0 8 0.039 94 114 0 8 0.039 35 103 0 8 0.039 23 89 0 8 0.039 84 111 0 8 0.038 56 131 0 8 0.038 13 56 0 8 0.038 45 75 0 8 0.037 38 144 0 8 0.037 38 143 0 8 0.037 38 142 0 8 0.037 38 141 0 8 0.037 38 140 0 8 0.037 38 139 0 8 0.037 38 138 0 8 0.037 38 137 0 8 0.037 38 136 0 8 0.037 38 135 0 8 0.037 38 134 0 8 0.037 38 112 0 8 0.037 38 111 0 8 0.037 38 110 0 8 0.037 38 109 0 8 0.037 38 106 0 8 0.037 38 101 0 8 0.037 38 78 0 8 0.037 38 77 0 8 0.037 38 60 0 8 0.037 38 57 0 8 0.037 38 56 0 8 0.037 38 55 0 8 0.037 38 53 0 8 0.037 31 110 0 8 0.037 26 138 0 8 0.037 23 61 0 8 0.037 15 86 0 8 0.037 15 35 0 8 0.037 13 131 0 8 0.037 66 144 0 8 0.036 52 144 0 8 0.036 52 143 0 8 0.036 52 142 0 8 0.036 52 140 0 8 0.036 52 139 0 8 0.036 52 137 0 8 0.036 52 136 0 8 0.036 52 110 0 8 0.036 52 109 0 8 0.036 52 106 0 8 0.036 52 101 0 8 0.036 52 78 0 8 0.036 52 77 0 8 0.036 38 133 0 8 0.036 38 132 0 8 0.036 END