PFRMAT RR TARGET T0210 AUTHOR 4204-4258-2837 REMARK From group SAM-TO4-hand under the direction of REMARK Kevin Karplus. REMARK Project by George Shackelford and Kevin Karplus REMARK The value given is an approximation of the probability REMARK as provided by the neural network. REMARK The number of predictions is limited to .5*sequence_length REMARK or to a limited set of high scoring pairs. REMARK METHOD The predictor is an artificial neural network METHOD using 280 inputs. METHOD Input includes separation and sequence length, corrected METHOD mutual information between columns (M. Cline) and METHOD an e-value measure of correlation between columns (K Karplus) METHOD NN: NN280-240n300.net.28 METHOD Other inputs are from alignments and METHOD secondary predictions from SAM-t2k and SAM-t04 of METHOD University of California, Santa Cruz MODEL 1 MQNADDFIKFLELEQHVEGGFYRSSYRSETAFDPSRQLWSSIYFLLRTGE VSHFHRLTADEMWYFHAGQSLTIYMISPEGELTTAQLGLDLAAGERPQFL VPKGCIFGSAMNQDGFSLVGCMVSPGFTFDDFELFSQEALLAMYPQHKAV VQKLSRPEVN 107 132 0 8 0.49725 57 132 0 8 0.3859 71 120 0 8 0.3757 58 108 0 8 0.3757 57 121 0 8 0.3434 58 107 0 8 0.34085 54 123 0 8 0.34085 57 107 0 8 0.30685 54 144 0 8 0.28135 108 131 0 8 0.27965 54 108 0 8 0.2771 28 60 0 8 0.25755 73 107 0 8 0.24905 64 124 0 8 0.2465 97 110 0 8 0.2448 108 117 0 8 0.2363 54 117 0 8 0.2346 107 121 0 8 0.2261 64 122 0 8 0.21845 26 124 0 8 0.19975 34 86 0 8 0.1972 26 60 0 8 0.1972 107 117 0 8 0.1955 64 120 0 8 0.1955 66 124 0 8 0.1921 73 108 0 8 0.1802 91 107 0 8 0.1717 END