PFRMAT RR
TARGET T0210
AUTHOR 4204-4258-2837
REMARK From group SAM-TO4-hand under the direction of
REMARK Kevin Karplus.
REMARK Project by George Shackelford and Kevin Karplus
REMARK The value given is an approximate of the probability
REMARK as provided by the neural network.
REMARK The number of predictions is limited to .5*sequence_length.
REMARK
METHOD The predictor is an artifical neural network
METHOD using 134 inputs.
METHOD Input includes separation and sequence length, corrected
METHOD mutual information between columns (M. Cline) and 
METHOD an e-value measure of correlation between columns (K Karplus) 
METHOD Other inputs are from alignments and
METHOD secondary predictions from SAM-t2k and SAM-t04 of 
METHOD University of California, Santa Cruz
METHOD This version uses a new error function designed to improve
METHOD the top scores per protein.
MODEL 1
MQNADDFIKFLELEQHVEGGFYRSSYRSETAFDPSRQLWSSIYFLLRTGE
VSHFHRLTADEMWYFHAGQSLTIYMISPEGELTTAQLGLDLAAGERPQFL
VPKGCIFGSAMNQDGFSLVGCMVSPGFTFDDFELFSQEALLAMYPQHKAV
VQKLSRPEVN
64 120 0 8 0.318
71 120 0 8 0.298
54 123 0 8 0.283
73 107 0 8 0.268
64 122 0 8 0.268
29 143 0 8 0.255
57 121 0 8 0.25
107 117 0 8 0.241
73 114 0 8 0.237
75 138 0 8 0.218
73 122 0 8 0.212
58 128 0 8 0.208
107 132 0 8 0.206
51 93 0 8 0.202
54 109 0 8 0.2
29 79 0 8 0.196
54 117 0 8 0.194
66 124 0 8 0.192
54 127 0 8 0.189
53 93 0 8 0.187
89 113 0 8 0.185
37 57 0 8 0.185
108 117 0 8 0.183
64 124 0 8 0.183
38 149 0 8 0.183
4 119 0 8 0.183
59 128 0 8 0.181
107 121 0 8 0.18
115 150 0 8 0.176
99 155 0 8 0.174
38 85 0 8 0.174
7 29 0 8 0.174
97 110 0 8 0.173
78 150 0 8 0.173
58 73 0 8 0.173
64 135 0 8 0.171
58 149 0 8 0.169
54 107 0 8 0.169
90 116 0 8 0.166
60 129 0 8 0.166
51 84 0 8 0.166
51 65 0 8 0.166
26 60 0 8 0.164
114 138 0 8 0.163
57 107 0 8 0.163
54 108 0 8 0.161
5 41 0 8 0.161
76 131 0 8 0.159
12 75 0 8 0.159
112 150 0 8 0.158
108 131 0 8 0.158
80 131 0 8 0.158
57 132 0 8 0.158
34 82 0 8 0.158
26 124 0 8 0.158
91 107 0 8 0.156
28 60 0 8 0.156
2 59 0 8 0.156
77 130 0 8 0.155
10 86 0 8 0.155
33 138 0 8 0.153
115 147 0 8 0.152
85 143 0 8 0.152
50 130 0 8 0.152
35 66 0 8 0.152
34 74 0 8 0.152
48 116 0 8 0.15
12 33 0 8 0.15
84 153 0 8 0.148
73 108 0 8 0.148
54 144 0 8 0.148
28 57 0 8 0.148
83 139 0 8 0.147
60 146 0 8 0.147
33 110 0 8 0.147
138 150 0 8 0.145
59 89 0 8 0.145
34 86 0 8 0.145
104 139 0 8 0.144
58 107 0 8 0.144
END