PFRMAT RR TARGET T0210 AUTHOR 4204-4258-2837 REMARK From group SAM-TO4-hand under the direction of REMARK Kevin Karplus. REMARK Project by George Shackelford and Kevin Karplus REMARK The value given as the probability is actually the raw score REMARK as provided by the neural network. REMARK The number of predictions is limited to .5*sequence_length. REMARK METHOD The predictor is an artifical neural network METHOD using 104 inputs. METHOD Input includes separation and sequence length, corrected METHOD mutual information between columns (M. Cline) and METHOD an e-value measure of correlation between columns (K Karplus) METHOD Other inputs are from alignments and METHOD secondary predictions from SAM-t2k and SAM-t04 of METHOD University of California, Santa Cruz MODEL 1 MQNADDFIKFLELEQHVEGGFYRSSYRSETAFDPSRQLWSSIYFLLRTGE VSHFHRLTADEMWYFHAGQSLTIYMISPEGELTTAQLGLDLAAGERPQFL VPKGCIFGSAMNQDGFSLVGCMVSPGFTFDDFELFSQEALLAMYPQHKAV VQKLSRPEVN 54 109 0 8 0.069 54 123 0 8 0.062 73 107 0 8 0.061 64 120 0 8 0.054 107 117 0 8 0.053 71 120 0 8 0.049 57 121 0 8 0.045 12 75 0 8 0.044 34 137 0 8 0.043 33 138 0 8 0.043 38 149 0 8 0.042 12 138 0 8 0.042 6 139 0 8 0.041 58 149 0 8 0.04 58 128 0 8 0.04 59 128 0 8 0.039 38 85 0 8 0.039 12 33 0 8 0.039 120 133 0 8 0.038 115 150 0 8 0.038 69 85 0 8 0.038 64 135 0 8 0.038 50 141 0 8 0.038 34 58 0 8 0.038 14 38 0 8 0.038 112 150 0 8 0.037 107 132 0 8 0.037 85 143 0 8 0.037 80 131 0 8 0.037 60 146 0 8 0.037 53 93 0 8 0.037 51 93 0 8 0.037 51 84 0 8 0.037 51 65 0 8 0.037 37 57 0 8 0.037 34 74 0 8 0.037 32 138 0 8 0.037 10 86 0 8 0.037 115 147 0 8 0.036 113 128 0 8 0.036 77 148 0 8 0.036 75 138 0 8 0.036 74 137 0 8 0.036 73 122 0 8 0.036 62 160 0 8 0.036 62 136 0 8 0.036 62 112 0 8 0.036 62 81 0 8 0.036 54 160 0 8 0.036 54 136 0 8 0.036 54 112 0 8 0.036 54 81 0 8 0.036 53 114 0 8 0.036 41 160 0 8 0.036 33 110 0 8 0.036 149 160 0 8 0.035 139 160 0 8 0.035 138 150 0 8 0.035 126 160 0 8 0.035 126 136 0 8 0.035 125 160 0 8 0.035 125 136 0 8 0.035 124 160 0 8 0.035 124 136 0 8 0.035 122 160 0 8 0.035 122 136 0 8 0.035 121 160 0 8 0.035 121 136 0 8 0.035 120 160 0 8 0.035 120 136 0 8 0.035 119 160 0 8 0.035 119 159 0 8 0.035 119 158 0 8 0.035 119 157 0 8 0.035 119 156 0 8 0.035 119 136 0 8 0.035 119 135 0 8 0.035 118 160 0 8 0.035 118 159 0 8 0.035 118 158 0 8 0.035 END