PFRMAT RR TARGET T0209 AUTHOR 4204-4258-2837 REMARK From group SAM-TO4-hand under the direction of REMARK Kevin Karplus. REMARK Project by George Shackelford and Kevin Karplus REMARK The value given is an approximation of the probability REMARK as provided by the neural network. REMARK The number of predictions is limited to .5*sequence_length REMARK or to a limited set of high scoring pairs. REMARK METHOD The predictor is an artificial neural network METHOD using 280 inputs. METHOD Input includes separation and sequence length, corrected METHOD mutual information between columns (M. Cline) and METHOD an e-value measure of correlation between columns (K Karplus) METHOD NN: NN280-240n300.net.28 METHOD Other inputs are from alignments and METHOD secondary predictions from SAM-t2k and SAM-t04 of METHOD University of California, Santa Cruz MODEL 1 MNDLTLSPIAIIHTPYKEKFSVPRQPNLVEDGVGIVELLPPYNSPEAVRG LEQFSHLWLIFQFDQIQQGKWQPTVRPPRLGGNQRVGVFASRATHRPNPL GLSKVELRQVECINGNIFLHLGAVDLVDGTPIFDIKPYIAYADSEPNAQS SFAQEKLPVKLTVEFTEQAKSAVKKREEKRPHLSRFIRQVLEQDPRPAYQ QGKPSDRIYGMSLYEFNVKWRIKAGTVNCVEVIEIEKDK 58 95 0 8 0.46665 80 140 0 8 0.4641 47 73 0 8 0.37825 12 121 0 8 0.3757 10 93 0 8 0.36805 90 135 0 8 0.3655 59 102 0 8 0.3434 58 139 0 8 0.3145 60 90 0 8 0.26605 58 138 0 8 0.2618 63 127 0 8 0.25075 60 119 0 8 0.24905 22 34 0 8 0.238 6 35 0 8 0.2363 107 165 0 8 0.23205 58 140 0 8 0.2278 73 126 0 8 0.2244 47 142 0 8 0.2244 88 136 0 8 0.22015 51 110 0 8 0.22015 49 71 0 8 0.2142 47 58 0 8 0.2091 24 95 0 8 0.20655 4 88 0 8 0.20655 58 80 0 8 0.20485 34 51 0 8 0.19975 51 75 0 8 0.1972 28 80 0 8 0.1972 58 73 0 8 0.1955 73 117 0 8 0.1938 22 61 0 8 0.1921 11 120 0 8 0.1887 42 110 0 8 0.1819 22 137 0 8 0.1768 35 161 0 8 0.1751 35 163 0 8 0.17 END