PFRMAT RR TARGET T0209 AUTHOR 4204-4258-2837 REMARK From group SAM-TO4-hand under the direction of REMARK Kevin Karplus. REMARK Project by George Shackelford and Kevin Karplus REMARK The value given is an approximate of the probability REMARK as provided by the neural network. REMARK The number of predictions is limited to .5*sequence_length. REMARK METHOD The predictor is an artifical neural network METHOD using 134 inputs. METHOD Input includes separation and sequence length, corrected METHOD mutual information between columns (M. Cline) and METHOD an e-value measure of correlation between columns (K Karplus) METHOD Other inputs are from alignments and METHOD secondary predictions from SAM-t2k and SAM-t04 of METHOD University of California, Santa Cruz METHOD This version uses a new error function designed to improve METHOD the top scores per protein. MODEL 1 MNDLTLSPIAIIHTPYKEKFSVPRQPNLVEDGVGIVELLPPYNSPEAVRG LEQFSHLWLIFQFDQIQQGKWQPTVRPPRLGGNQRVGVFASRATHRPNPL GLSKVELRQVECINGNIFLHLGAVDLVDGTPIFDIKPYIAYADSEPNAQS SFAQEKLPVKLTVEFTEQAKSAVKKREEKRPHLSRFIRQVLEQDPRPAYQ QGKPSDRIYGMSLYEFNVKWRIKAGTVNCVEVIEIEKDK 88 136 0 8 0.3 58 95 0 8 0.298 80 140 0 8 0.295 90 135 0 8 0.293 10 93 0 8 0.288 91 133 0 8 0.285 59 133 0 8 0.285 90 122 0 8 0.278 60 119 0 8 0.276 58 138 0 8 0.276 47 73 0 8 0.276 60 122 0 8 0.273 88 135 0 8 0.271 58 82 0 8 0.268 59 99 0 8 0.266 59 102 0 8 0.261 12 121 0 8 0.261 58 139 0 8 0.259 10 94 0 8 0.259 58 135 0 8 0.255 11 120 0 8 0.255 60 90 0 8 0.248 93 133 0 8 0.243 88 120 0 8 0.235 57 98 0 8 0.232 8 133 0 8 0.23 57 134 0 8 0.228 47 108 0 8 0.226 63 127 0 8 0.224 62 133 0 8 0.224 59 108 0 8 0.224 60 102 0 8 0.218 120 136 0 8 0.216 58 73 0 8 0.216 51 110 0 8 0.216 103 127 0 8 0.21 94 133 0 8 0.21 61 95 0 8 0.21 58 80 0 8 0.21 11 98 0 8 0.21 80 95 0 8 0.204 120 142 0 8 0.2 10 91 0 8 0.2 98 116 0 8 0.198 34 51 0 8 0.198 38 77 0 8 0.196 67 76 0 8 0.194 49 76 0 8 0.194 44 76 0 8 0.194 28 80 0 8 0.194 76 126 0 8 0.192 56 76 0 8 0.192 57 110 0 8 0.191 35 123 0 8 0.191 24 95 0 8 0.191 100 152 0 8 0.189 63 110 0 8 0.189 59 82 0 8 0.189 54 76 0 8 0.189 47 58 0 8 0.189 23 102 0 8 0.189 6 17 0 8 0.189 132 152 0 8 0.187 37 90 0 8 0.187 66 122 0 8 0.185 50 76 0 8 0.185 49 81 0 8 0.185 133 167 0 8 0.183 58 141 0 8 0.183 55 76 0 8 0.183 49 128 0 8 0.183 6 35 0 8 0.183 88 157 0 8 0.181 62 127 0 8 0.181 54 110 0 8 0.181 42 76 0 8 0.181 27 58 0 8 0.181 12 30 0 8 0.181 77 102 0 8 0.18 58 81 0 8 0.18 54 115 0 8 0.18 42 124 0 8 0.18 41 73 0 8 0.18 13 105 0 8 0.18 12 69 0 8 0.18 68 122 0 8 0.178 58 68 0 8 0.178 42 110 0 8 0.178 7 68 0 8 0.178 109 133 0 8 0.176 94 117 0 8 0.176 73 126 0 8 0.176 57 106 0 8 0.176 56 116 0 8 0.176 35 67 0 8 0.176 22 137 0 8 0.176 7 71 0 8 0.176 79 115 0 8 0.174 62 115 0 8 0.174 48 94 0 8 0.174 38 62 0 8 0.174 21 76 0 8 0.174 126 146 0 8 0.173 122 141 0 8 0.173 110 119 0 8 0.173 102 141 0 8 0.173 77 99 0 8 0.173 76 115 0 8 0.173 73 117 0 8 0.173 58 71 0 8 0.173 55 128 0 8 0.173 54 107 0 8 0.173 13 117 0 8 0.173 11 74 0 8 0.173 7 122 0 8 0.173 103 151 0 8 0.171 95 142 0 8 0.171 90 109 0 8 0.171 58 104 0 8 0.171 END