PFRMAT RR TARGET T0209 AUTHOR 4204-4258-2837 REMARK From group SAM-TO4-hand under the direction of REMARK Kevin Karplus. REMARK Project by George Shackelford and Kevin Karplus REMARK The value given as the probability is actually the raw score REMARK as provided by the neural network. REMARK The number of predictions is limited to .5*sequence_length. REMARK METHOD The predictor is an artifical neural network METHOD using 104 inputs. METHOD Input includes separation and sequence length, corrected METHOD mutual information between columns (M. Cline) and METHOD an e-value measure of correlation between columns (K Karplus) METHOD Other inputs are from alignments and METHOD secondary predictions from SAM-t2k and SAM-t04 of METHOD University of California, Santa Cruz MODEL 1 MNDLTLSPIAIIHTPYKEKFSVPRQPNLVEDGVGIVELLPPYNSPEAVRG LEQFSHLWLIFQFDQIQQGKWQPTVRPPRLGGNQRVGVFASRATHRPNPL GLSKVELRQVECINGNIFLHLGAVDLVDGTPIFDIKPYIAYADSEPNAQS SFAQEKLPVKLTVEFTEQAKSAVKKREEKRPHLSRFIRQVLEQDPRPAYQ QGKPSDRIYGMSLYEFNVKWRIKAGTVNCVEVIEIEKDK 47 73 0 8 0.081 58 82 0 8 0.07 28 80 0 8 0.054 80 140 0 8 0.053 58 80 0 8 0.053 50 76 0 8 0.052 58 81 0 8 0.05 58 139 0 8 0.049 68 163 0 8 0.048 80 95 0 8 0.045 47 58 0 8 0.045 22 34 0 8 0.044 58 138 0 8 0.043 49 81 0 8 0.043 58 73 0 8 0.042 18 31 0 8 0.042 155 169 0 8 0.04 59 108 0 8 0.04 56 145 0 8 0.04 47 141 0 8 0.04 6 17 0 8 0.04 2 27 0 8 0.04 62 149 0 8 0.039 58 141 0 8 0.039 34 51 0 8 0.039 30 144 0 8 0.039 73 117 0 8 0.038 67 76 0 8 0.038 51 110 0 8 0.038 49 140 0 8 0.038 49 108 0 8 0.038 47 108 0 8 0.038 47 71 0 8 0.038 27 167 0 8 0.038 22 39 0 8 0.038 17 158 0 8 0.038 13 105 0 8 0.038 12 30 0 8 0.038 11 120 0 8 0.038 10 94 0 8 0.038 133 167 0 8 0.037 103 151 0 8 0.037 100 152 0 8 0.037 98 116 0 8 0.037 88 136 0 8 0.037 82 108 0 8 0.037 74 161 0 8 0.037 70 108 0 8 0.037 66 167 0 8 0.037 58 95 0 8 0.037 56 80 0 8 0.037 49 142 0 8 0.037 47 106 0 8 0.037 33 42 0 8 0.037 28 39 0 8 0.037 27 73 0 8 0.037 27 58 0 8 0.037 26 80 0 8 0.037 21 153 0 8 0.037 21 150 0 8 0.037 11 74 0 8 0.037 8 133 0 8 0.037 7 71 0 8 0.037 7 46 0 8 0.037 4 155 0 8 0.037 1 17 0 8 0.037 151 160 0 8 0.036 146 166 0 8 0.036 146 162 0 8 0.036 95 239 0 8 0.036 95 238 0 8 0.036 95 236 0 8 0.036 95 235 0 8 0.036 95 234 0 8 0.036 95 226 0 8 0.036 95 223 0 8 0.036 95 215 0 8 0.036 95 213 0 8 0.036 95 207 0 8 0.036 95 204 0 8 0.036 95 203 0 8 0.036 95 196 0 8 0.036 95 158 0 8 0.036 95 149 0 8 0.036 95 145 0 8 0.036 95 144 0 8 0.036 95 142 0 8 0.036 95 139 0 8 0.036 95 116 0 8 0.036 95 112 0 8 0.036 88 239 0 8 0.036 88 236 0 8 0.036 88 235 0 8 0.036 88 234 0 8 0.036 88 226 0 8 0.036 88 215 0 8 0.036 88 204 0 8 0.036 88 203 0 8 0.036 88 158 0 8 0.036 88 145 0 8 0.036 88 139 0 8 0.036 88 135 0 8 0.036 88 116 0 8 0.036 88 112 0 8 0.036 67 151 0 8 0.036 63 127 0 8 0.036 61 155 0 8 0.036 59 82 0 8 0.036 49 128 0 8 0.036 47 62 0 8 0.036 41 117 0 8 0.036 38 77 0 8 0.036 37 90 0 8 0.036 35 67 0 8 0.036 30 109 0 8 0.036 28 82 0 8 0.036 27 84 0 8 0.036 16 160 0 8 0.036 10 93 0 8 0.036 END