PFRMAT RR TARGET T0208 AUTHOR 4204-4258-2837 REMARK From group SAM-TO4-hand under the direction of REMARK Kevin Karplus. REMARK Project by George Shackelford and Kevin Karplus REMARK The value given as the probability is actually the raw score REMARK as provided by the neural network. REMARK The number of predictions is limited to .5*sequence_length. REMARK METHOD The predictor is an artifical neural network METHOD using 104 inputs. METHOD Input includes separation and sequence length, corrected METHOD mutual information between columns (M. Cline) and METHOD an e-value measure of correlation between columns (K Karplus) METHOD Other inputs are from alignments and METHOD secondary predictions from SAM-t2k and SAM-t04 of METHOD University of California, Santa Cruz MODEL 1 MKWGFRWYGAAGDAIPLKHIRQIPGITGVVGTLLNKLPGDVWTVAEIQAL KQSVEQEGLALLGIESVAIHDAIKAGTDQRDHYIDNYRQTLRNLGKCGIS LVCYSFKPIFGWAKTDLAYENEDGSLSLLFDQAVVENMQPEDMYQLIHSQ SKGFRLPGWEEERLQQFQELKAMYAGVTEEDLVENLRYFLERVIPVCEEE NIKMGIHPDDPPWEIFGLPRITKNLADLKRILSLVDSPANGITFCTGSLG ADPTNDLPTMIREIGHRINFVHFRNVKYLGEHRFEETAHPSVAGSLDMAE LMQALVDVGYEGVIRPDHGRAIWDEKAMPGYGLYDRAMGLTYIQGLYEAT KAKQNRK 277 289 0 8 0.077 108 289 0 8 0.065 66 248 0 8 0.059 325 335 0 8 0.058 277 288 0 8 0.056 243 318 0 8 0.056 66 108 0 8 0.056 312 342 0 8 0.055 39 108 0 8 0.054 245 317 0 8 0.053 274 289 0 8 0.052 273 292 0 8 0.052 110 295 0 8 0.052 108 248 0 8 0.052 274 319 0 8 0.051 26 129 0 8 0.051 320 338 0 8 0.05 191 272 0 8 0.05 102 243 0 8 0.05 312 324 0 8 0.049 220 315 0 8 0.049 189 318 0 8 0.049 140 312 0 8 0.049 132 161 0 8 0.049 129 223 0 8 0.049 75 306 0 8 0.049 23 312 0 8 0.049 270 315 0 8 0.048 243 320 0 8 0.048 220 318 0 8 0.048 110 159 0 8 0.048 38 295 0 8 0.048 306 324 0 8 0.047 255 318 0 8 0.047 232 318 0 8 0.047 201 236 0 8 0.047 189 220 0 8 0.047 110 337 0 8 0.047 63 111 0 8 0.047 23 342 0 8 0.047 223 248 0 8 0.046 143 228 0 8 0.046 110 323 0 8 0.046 110 320 0 8 0.046 324 342 0 8 0.045 314 335 0 8 0.045 243 264 0 8 0.045 243 258 0 8 0.045 223 338 0 8 0.045 220 274 0 8 0.045 120 150 0 8 0.045 321 338 0 8 0.044 320 334 0 8 0.044 274 288 0 8 0.044 93 245 0 8 0.044 90 221 0 8 0.044 320 342 0 8 0.043 277 318 0 8 0.043 270 289 0 8 0.043 243 277 0 8 0.043 200 235 0 8 0.043 170 220 0 8 0.043 121 307 0 8 0.043 274 317 0 8 0.042 245 308 0 8 0.042 245 274 0 8 0.042 227 285 0 8 0.042 207 247 0 8 0.042 189 317 0 8 0.042 189 245 0 8 0.042 188 317 0 8 0.042 96 105 0 8 0.042 277 319 0 8 0.041 243 288 0 8 0.041 232 319 0 8 0.041 232 290 0 8 0.041 209 274 0 8 0.041 209 243 0 8 0.041 207 276 0 8 0.041 189 274 0 8 0.041 132 181 0 8 0.041 247 284 0 8 0.04 245 315 0 8 0.04 240 317 0 8 0.04 209 277 0 8 0.04 208 243 0 8 0.04 204 222 0 8 0.04 190 247 0 8 0.04 174 255 0 8 0.04 166 251 0 8 0.04 155 233 0 8 0.04 141 173 0 8 0.04 101 254 0 8 0.04 298 317 0 8 0.039 247 315 0 8 0.039 243 319 0 8 0.039 241 262 0 8 0.039 228 247 0 8 0.039 220 247 0 8 0.039 200 264 0 8 0.039 189 240 0 8 0.039 170 315 0 8 0.039 156 223 0 8 0.039 154 228 0 8 0.039 153 245 0 8 0.039 139 288 0 8 0.039 91 232 0 8 0.039 283 293 0 8 0.038 254 318 0 8 0.038 252 320 0 8 0.038 248 318 0 8 0.038 232 289 0 8 0.038 230 251 0 8 0.038 209 319 0 8 0.038 207 318 0 8 0.038 189 243 0 8 0.038 146 193 0 8 0.038 135 285 0 8 0.038 103 270 0 8 0.038 103 258 0 8 0.038 282 295 0 8 0.037 274 318 0 8 0.037 271 357 0 8 0.037 258 319 0 8 0.037 243 293 0 8 0.037 233 319 0 8 0.037 227 252 0 8 0.037 222 243 0 8 0.037 220 235 0 8 0.037 209 220 0 8 0.037 207 240 0 8 0.037 207 228 0 8 0.037 190 227 0 8 0.037 189 255 0 8 0.037 160 316 0 8 0.037 146 184 0 8 0.037 135 299 0 8 0.037 135 159 0 8 0.037 133 172 0 8 0.037 125 279 0 8 0.037 105 258 0 8 0.037 105 253 0 8 0.037 91 234 0 8 0.037 41 357 0 8 0.037 41 356 0 8 0.037 41 289 0 8 0.037 41 268 0 8 0.037 41 252 0 8 0.037 41 224 0 8 0.037 41 178 0 8 0.037 41 177 0 8 0.037 41 160 0 8 0.037 41 139 0 8 0.037 41 125 0 8 0.037 41 121 0 8 0.037 41 99 0 8 0.037 41 77 0 8 0.037 41 59 0 8 0.037 271 356 0 8 0.036 271 355 0 8 0.036 271 354 0 8 0.036 271 327 0 8 0.036 271 326 0 8 0.036 271 325 0 8 0.036 271 324 0 8 0.036 271 322 0 8 0.036 271 320 0 8 0.036 271 319 0 8 0.036 271 312 0 8 0.036 271 311 0 8 0.036 271 310 0 8 0.036 271 295 0 8 0.036 271 294 0 8 0.036 271 292 0 8 0.036 271 291 0 8 0.036 271 290 0 8 0.036 271 289 0 8 0.036 271 288 0 8 0.036 END