CASP6 Target T0207
-
1. Protein Name
- XcR50
-
2. Organism Name
- X. campestris
-
3. Number of amino acids (approx)
- 78
-
4. Accession number
-
5. Sequence Database
-
6. Amino acid sequence
-
MALTLYQRDDCHLCDQAVEALAQARAGAFFSVFIDDDAALESAYGLRVPVLRDPMGRELD
WPFDAPRLRAWLDAAPHA
-
7. Additional information
-
8. X-ray structure
- yes
-
9. Current state of the experimental work
- completed
-
10. Interpretable map?
- yes
-
11. Estimated date of chain tracing completion
- finished
-
12. Estimated date of public release of structure
- 7/1/2004
Related Files
Template Sequence file
Template PDB file