PFRMAT RR
TARGET T0207
AUTHOR 4204-4258-2837
TARGET T0207
REMARK Group SAM-TO4-hand under the direction of
REMARK Kevin Karplus.
REMARK Project by George Shackelford and Kevin Karplus
METHOD The predictor is an artifical neural network
METHOD using 104 inputs.
METHOD Input includes separation and sequence length, corrected
METHOD mutual information between columns (M. Cline) and 
METHOD an e-value measure of correlation between columns (K Karplus) 
METHOD Other inputs are from alignments and
METHOD secondary predictions from SAM-t2k and SAM-t04 of 
METHOD University of California, Santa Cruz
MODEL 1
MALTLYQRDDCHLCDQAVEALAQARAGAFFSVFIDDDAALESAYGLRVPV
LRDPMGRELD WPFDAPRLRAWLDAAPHA 
3 51 0 8 0.975
5 51 0 8 0.965
6 31 0 8 0.961
3 31 0 8 0.956
6 29 0 8 0.955
5 31 0 8 0.951
5 50 0 8 0.94
2 29 0 8 0.927
6 50 0 8 0.913
7 31 0 8 0.904
2 31 0 8 0.892
32 50 0 8 0.873
31 50 0 8 0.845
5 17 0 8 0.77
4 21 0 8 0.752
5 48 0 8 0.75
7 50 0 8 0.729
6 52 0 8 0.729
2 52 0 8 0.697
4 48 0 8 0.695
28 50 0 8 0.692
17 51 0 8 0.69
7 53 0 8 0.653
5 52 0 8 0.625
4 46 0 8 0.625
52 61 0 8 0.622
50 63 0 8 0.619
8 29 0 8 0.619
32 52 0 8 0.616
48 63 0 8 0.596
4 53 0 8 0.57
17 50 0 8 0.564
50 61 0 8 0.558
6 26 0 8 0.558
35 47 0 8 0.552
4 63 0 8 0.552
34 48 0 8 0.546
6 46 0 8 0.543
5 46 0 8 0.54
5 26 0 8 0.537