CASP6 Target T0206
-
1. Protein Name
- BclA
-
2. Organism Name
- Bacilus anthracis
-
3. Number of amino acids (approx)
- 220
-
4. Accession number
-
5. Sequence Database
-
6. Amino acid sequence
MAFDPNLVGPTLPPIPPFTLPTGPTGPTGPTGPTGPTGPTGPTGDTGTTGPTGPTGPTGP
TGPTGATGLTGPTGPTGPSGLGLPAGLYAFNSGGISLDLGINDPVPFNTVGSQFGTAISQ
LDADTFVISETGFYKITVIANTATASVLGGLTIQVNGVPVPGTGSSLISLGAPIVIQAIT
QITTTPSLVEVIVTGLGLSLALGTSASIIIEKVAHHHHHH
-
7. Additional information
Comment: The first 80 residues are collagen-like.
The protein forms a trimer in the crystals and in solution.
The function is unknown.
-
8. X-ray structure
- yes
-
9. Current state of the experimental work
- Solved. The crystals diffract to high resolution and the the refinement is proceeding very well.
-
10. Interpretable map?
- yes
-
11. Estimated date of chain tracing completion
- Done
-
12. Estimated date of public release of structure
- 26 Aug
Related Files
Template Sequence file
Template PDB file