PFRMAT RR
TARGET T0206
AUTHOR 4204-4258-2837
REMARK From group SAM-TO4-hand under the direction of
REMARK Kevin Karplus.
REMARK Project by George Shackelford and Kevin Karplus
REMARK The value given is an approximation of the probability
REMARK as provided by the neural network.
REMARK The predictions are limited to a score >= .18 which
REMARK is an approximation of the probability.
REMARK
METHOD The predictor is an artificial neural network
METHOD using 280 inputs.
METHOD Input includes separation and sequence length, corrected
METHOD mutual information between columns (M. Cline) and 
METHOD an e-value measure of correlation between columns (K Karplus) 
METHOD NN: NN280-240n300.net.28
METHOD Other inputs are from alignments and
METHOD secondary predictions from SAM-t2k and SAM-t04 of 
METHOD University of California, Santa Cruz
MODEL 1
MAFDPNLVGPTLPPIPPFTLPTGPTGPTGPTGPTGPTGPTGPTGDTGTTG
PTGPTGPTGPTGPTGATGLTGPTGPTGPSGLGLPAGLYAFNSGGISLDLG
INDPVPFNTVGSQFGTAISQLDADTFVISETGFYKITVIANTATASVLGG
LTIQVNGVPVPGTGSSLISLGAPIVIQAITQITTTPSLVEVIVTGLGLSL
ALGTSASIIIEKVAHHHHHH
40 79 0 8 0.5882
34 49 0 8 0.56355
22 40 0 8 0.56185
25 34 0 8 0.54315
46 64 0 8 0.53805
25 61 0 8 0.5338
25 43 0 8 0.52615
46 79 0 8 0.51425
97 108 0 8 0.48705
11 46 0 8 0.47685
28 46 0 8 0.46155
25 58 0 8 0.4539
11 43 0 8 0.4488
114 126 0 8 0.44625
25 46 0 8 0.4437
55 73 0 8 0.44115
25 55 0 8 0.43945
31 55 0 8 0.4369
40 67 0 8 0.42925
34 46 0 8 0.4182
46 61 0 8 0.41055
31 49 0 8 0.40885
105 120 0 8 0.39865
6 15 0 8 0.39355
114 123 0 8 0.3808
28 43 0 8 0.3808
34 70 0 8 0.37315
40 58 0 8 0.3553
34 64 0 8 0.3502
105 114 0 8 0.34765
114 138 0 8 0.34595
115 134 0 8 0.33065
5 21 0 8 0.31875
108 129 0 8 0.3145
126 138 0 8 0.2907
16 79 0 8 0.28135
43 79 0 8 0.27455
11 34 0 8 0.27455
108 123 0 8 0.2703
105 119 0 8 0.26605
64 76 0 8 0.25755
97 120 0 8 0.255
97 129 0 8 0.2533
46 67 0 8 0.2533
127 148 0 8 0.2448
115 156 0 8 0.24225
22 61 0 8 0.24225
114 129 0 8 0.24055
105 117 0 8 0.2363
103 129 0 8 0.2346
121 167 0 8 0.23035
58 76 0 8 0.23035
126 135 0 8 0.2278
49 61 0 8 0.2278
105 129 0 8 0.2261
34 76 0 8 0.22185
61 79 0 8 0.21845
115 138 0 8 0.21675
127 153 0 8 0.2142
97 128 0 8 0.2142
91 103 0 8 0.2142
31 67 0 8 0.2142
8 61 0 8 0.2142
139 149 0 8 0.2125
111 120 0 8 0.2125
91 108 0 8 0.2125
52 61 0 8 0.2125
34 82 0 8 0.2108
11 61 0 8 0.20485
128 145 0 8 0.20315
108 135 0 8 0.20315
86 97 0 8 0.20315
58 67 0 8 0.20315
11 25 0 8 0.20315
108 119 0 8 0.20145
97 126 0 8 0.20145
105 126 0 8 0.19975
23 41 0 8 0.1972
155 188 0 8 0.1955
103 123 0 8 0.1904
97 148 0 8 0.1904
120 135 0 8 0.1887
115 129 0 8 0.1887
105 123 0 8 0.1887
97 117 0 8 0.1887
86 138 0 8 0.1887
25 76 0 8 0.1887
34 61 0 8 0.1853
29 47 0 8 0.1853
103 114 0 8 0.1836
174 188 0 8 0.1802
109 134 0 8 0.1802
97 114 0 8 0.1802
END