CASP6 Target T0205
-
1. Protein Name
- At2g34160
-
2. Organism Name
- Arabidopsis
-
3. Number of amino acids (approx)
- 130
-
4. Accession number
-
5. Sequence Database
-
6. Amino acid sequence
SEEITDGVNNMNLATDSQKKNRIQVSNTKKPLFFYVNLAKRYMQQYNDVELSALGMAIAT
VVTVTEILKNNGFAVEKKIMTSIVDIKDDARGRPVQKAKIEITLVKSEKFDELMAAANEE
KEDAETQVQN
-
7. Additional information
GO category Molecular Function: N/A
GO category Biological process: N/A
GO category Cellular components: N/A
Binding: N/A
Binding site: N/A
Residue role: N/A
PT modifications: N/A
Comment: N/A
-
8. X-ray structure
- yes
-
9. Current state of the experimental work
- completed
-
10. Interpretable map?
- no
-
11. Estimated date of chain tracing completion
- Finished
-
12. Estimated date of public release of structure
- July 6
Related Files
Template Sequence file
Template PDB file