PFRMAT RR
TARGET T0205
AUTHOR 4204-4258-2837
REMARK From group SAM-TO4-hand under the direction of
REMARK Kevin Karplus.
REMARK Project by George Shackelford and Kevin Karplus
REMARK The value given as the probability is actually the raw score
REMARK as provided by the neural network.
REMARK The number of predictions is limited to .5*sequence_length.
REMARK
METHOD The predictor is an artifical neural network
METHOD using 104 inputs.
METHOD Input includes separation and sequence length, corrected
METHOD mutual information between columns (M. Cline) and 
METHOD an e-value measure of correlation between columns (K Karplus) 
METHOD Other inputs are from alignments and
METHOD secondary predictions from SAM-t2k and SAM-t04 of 
METHOD University of California, Santa Cruz
MODEL 1
SEEITDGVNNMNLATDSQKKNRIQVSNTKKPLFFYVNLAKRYMQQYNDVE
LSALGMAIATVVTVTEILKNNGFAVEKKIMTSIVDIKDDARGRPVQKAKI
EITLVKSEKFDELMAAANEEKEDAETQVQN
40 72 0 8 0.06
54 72 0 8 0.047
34 47 0 8 0.047
32 43 0 8 0.047
54 99 0 8 0.046
41 77 0 8 0.046
78 99 0 8 0.045
77 105 0 8 0.045
77 99 0 8 0.045
76 92 0 8 0.045
54 105 0 8 0.045
54 78 0 8 0.045
53 70 0 8 0.045
45 61 0 8 0.045
43 96 0 8 0.045
41 105 0 8 0.045
41 81 0 8 0.045
41 78 0 8 0.045
41 72 0 8 0.045
40 99 0 8 0.045
40 81 0 8 0.045
40 78 0 8 0.045
40 54 0 8 0.045
37 61 0 8 0.045
34 97 0 8 0.045
33 105 0 8 0.045
33 99 0 8 0.045
27 38 0 8 0.045
24 37 0 8 0.045
17 60 0 8 0.045
81 105 0 8 0.044
75 95 0 8 0.044
71 96 0 8 0.044
64 85 0 8 0.044
52 98 0 8 0.044
37 96 0 8 0.044
33 81 0 8 0.044
33 78 0 8 0.044
32 96 0 8 0.044
32 45 0 8 0.044
26 64 0 8 0.044
24 71 0 8 0.044
22 95 0 8 0.044
22 75 0 8 0.044
19 85 0 8 0.044
19 64 0 8 0.044
31 92 0 8 0.043
31 76 0 8 0.043
26 50 0 8 0.043
END