PFRMAT RR TARGET T0204 AUTHOR 4204-4258-2837 REMARK From group SAM-TO4-hand under the direction of REMARK Kevin Karplus. REMARK Project by George Shackelford and Kevin Karplus REMARK The value given as the probability is actually the raw score REMARK as provided by the neural network. REMARK The number of predictions is limited to .5*sequence_length. REMARK METHOD The predictor is an artifical neural network METHOD using 104 inputs. METHOD Input includes separation and sequence length, corrected METHOD mutual information between columns (M. Cline) and METHOD an e-value measure of correlation between columns (K Karplus) METHOD Other inputs are from alignments and METHOD secondary predictions from SAM-t2k and SAM-t04 of METHOD University of California, Santa Cruz MODEL 1 STSPSHASDRGGGDGDSVENQSPELRKDPVTNRWVIFSPARAKRPTDFKS KSPQNPNPKPSSCPFCIGREQECAPELFRVPDHDPNWKLRVIENLYPALS RNLETQSTQPETGTSRTIVGFGFHDVVIESPVHSIQLSDIDPVGIGDILI AYKKRINQIAQHDSINYIQVFKNQGASAGASMSHSHSQMMALPVVPPTVS SRLDGTKDYFEETGKCCLCEAKSKHFVIDESSHFVSVAPFAATYPFEIWI IPKDHSSHFHHLDDVKAVDLGGLLKLMLQKIAKQLNDPPYNYMIHTSPLK VTESQLPYTHWFLQIVPQLSGVGGFEIGTGCYINPVFPEDVAKVMREVSL T 239 249 0 8 0.395 249 314 0 8 0.375 216 255 0 8 0.372 247 289 0 8 0.37 239 295 0 8 0.37 242 308 0 8 0.364 242 289 0 8 0.356 239 289 0 8 0.334 247 295 0 8 0.326 239 316 0 8 0.326 230 253 0 8 0.326 219 255 0 8 0.326 244 291 0 8 0.321 239 278 0 8 0.318 239 306 0 8 0.316 239 308 0 8 0.31 247 308 0 8 0.295 221 239 0 8 0.295 249 306 0 8 0.293 242 316 0 8 0.285 244 293 0 8 0.283 244 295 0 8 0.276 221 308 0 8 0.276 234 247 0 8 0.273 246 291 0 8 0.271 242 295 0 8 0.271 240 289 0 8 0.271 218 242 0 8 0.271 281 291 0 8 0.268 246 281 0 8 0.264 242 292 0 8 0.261 244 316 0 8 0.255 246 319 0 8 0.252 240 308 0 8 0.252 226 239 0 8 0.252 243 306 0 8 0.25 238 291 0 8 0.25 221 244 0 8 0.248 219 310 0 8 0.248 218 251 0 8 0.248 239 294 0 8 0.243 246 309 0 8 0.241 242 314 0 8 0.241 239 319 0 8 0.241 234 244 0 8 0.239 246 308 0 8 0.237 246 292 0 8 0.237 238 295 0 8 0.237 246 316 0 8 0.235 246 295 0 8 0.235 239 314 0 8 0.235 291 316 0 8 0.232 238 280 0 8 0.232 246 289 0 8 0.23 246 280 0 8 0.23 221 240 0 8 0.23 218 247 0 8 0.228 244 289 0 8 0.226 240 306 0 8 0.226 218 244 0 8 0.226 246 322 0 8 0.224 218 239 0 8 0.224 241 291 0 8 0.22 247 316 0 8 0.218 242 280 0 8 0.218 294 308 0 8 0.216 242 319 0 8 0.216 242 294 0 8 0.216 289 306 0 8 0.208 247 292 0 8 0.208 241 295 0 8 0.206 221 247 0 8 0.204 238 284 0 8 0.202 242 315 0 8 0.196 242 288 0 8 0.196 239 307 0 8 0.196 244 306 0 8 0.194 244 319 0 8 0.192 306 316 0 8 0.191 294 313 0 8 0.191 243 293 0 8 0.191 241 306 0 8 0.189 238 289 0 8 0.187 292 315 0 8 0.185 289 319 0 8 0.185 247 304 0 8 0.185 239 288 0 8 0.185 242 278 0 8 0.183 249 308 0 8 0.181 239 281 0 8 0.181 227 240 0 8 0.181 240 295 0 8 0.18 288 316 0 8 0.178 246 287 0 8 0.178 235 253 0 8 0.178 251 295 0 8 0.176 246 271 0 8 0.176 237 306 0 8 0.176 220 239 0 8 0.176 291 318 0 8 0.174 239 292 0 8 0.174 220 244 0 8 0.174 217 244 0 8 0.174 218 240 0 8 0.173 216 291 0 8 0.173 247 314 0 8 0.171 247 288 0 8 0.171 238 316 0 8 0.171 295 322 0 8 0.169 240 249 0 8 0.169 236 248 0 8 0.169 239 271 0 8 0.168 234 273 0 8 0.168 295 314 0 8 0.166 287 319 0 8 0.166 242 321 0 8 0.166 240 251 0 8 0.166 239 251 0 8 0.166 226 240 0 8 0.166 244 321 0 8 0.164 243 291 0 8 0.164 238 247 0 8 0.164 239 273 0 8 0.163 227 239 0 8 0.163 295 319 0 8 0.161 278 289 0 8 0.159 242 251 0 8 0.159 241 316 0 8 0.159 247 306 0 8 0.158 244 308 0 8 0.158 218 308 0 8 0.158 287 314 0 8 0.156 271 291 0 8 0.156 269 291 0 8 0.156 239 309 0 8 0.156 221 306 0 8 0.156 290 328 0 8 0.153 220 247 0 8 0.153 220 240 0 8 0.153 244 269 0 8 0.152 242 281 0 8 0.152 241 289 0 8 0.152 231 244 0 8 0.152 216 310 0 8 0.152 291 329 0 8 0.15 249 289 0 8 0.15 238 292 0 8 0.15 246 317 0 8 0.148 218 238 0 8 0.148 215 239 0 8 0.148 295 321 0 8 0.147 292 316 0 8 0.147 281 316 0 8 0.147 244 281 0 8 0.147 221 231 0 8 0.147 241 322 0 8 0.145 238 269 0 8 0.145 281 315 0 8 0.144 247 280 0 8 0.144 244 292 0 8 0.144 226 289 0 8 0.144 222 237 0 8 0.144 217 239 0 8 0.144 294 311 0 8 0.142 249 307 0 8 0.142 242 271 0 8 0.142 241 319 0 8 0.142 239 322 0 8 0.142 292 321 0 8 0.141 224 239 0 8 0.141 218 316 0 8 0.141 247 278 0 8 0.14 246 329 0 8 0.14 238 281 0 8 0.14 248 277 0 8 0.138 END