PFRMAT RR
TARGET T0202
AUTHOR 4204-4258-2837
REMARK From group SAM-TO4-hand under the direction of
REMARK Kevin Karplus.
REMARK Project by George Shackelford and Kevin Karplus
REMARK The value given is an approximation of the probability
REMARK as provided by the neural network.
REMARK The number of predictions is limited to .5*sequence_length.
REMARK
METHOD The predictor is an artificial neural network
METHOD using 134 inputs.
METHOD Input includes separation and sequence length, corrected
METHOD mutual information between columns (M. Cline) and 
METHOD an e-value measure of correlation between columns (K Karplus) 
METHOD Other inputs are from alignments and
METHOD secondary predictions from SAM-t2k and SAM-t04 of 
METHOD University of California, Santa Cruz
METHOD This version uses a new error function designed to improve
METHOD the top scores per protein.
MODEL 1
MRAAVVYKTDGHVKRIEEALKRLEVEVELFNQPSEELENFDFIVSVGGDG
TILRILQKLKRCPPIFGINTGRVGLLTHASPENFEVELKKAVEKFEVERF
PRVSCSAMPDVLALNEIAVLSRKPAKMIDVALRVDGVEVDRIRCDGFIVA
TQIGSTGYAFSAGGPVVEPYLECFILIPIAPFRFGWKPYVVSMERKIEVI
AEKAIVVADGQKSVDFDGEITIEKSEFPAVFFKNEKRFRNLFGKVRSIG
165 175 0 8 0.534
145 158 0 8 0.489
76 165 0 8 0.454
160 245 0 8 0.445
160 184 0 8 0.439
118 158 0 8 0.436
160 178 0 8 0.427
144 160 0 8 0.427
160 187 0 8 0.424
52 151 0 8 0.424
160 185 0 8 0.407
165 190 0 8 0.404
75 158 0 8 0.404
53 158 0 8 0.401
142 160 0 8 0.398
76 160 0 8 0.398
178 187 0 8 0.395
159 177 0 8 0.392
148 158 0 8 0.392
118 148 0 8 0.389
165 187 0 8 0.386
165 178 0 8 0.384
144 165 0 8 0.381
68 115 0 8 0.381
144 190 0 8 0.372
121 158 0 8 0.372
175 187 0 8 0.37
115 148 0 8 0.367
52 160 0 8 0.358
142 185 0 8 0.353
187 245 0 8 0.347
77 182 0 8 0.347
75 159 0 8 0.347
52 245 0 8 0.347
144 158 0 8 0.345
78 159 0 8 0.345
52 165 0 8 0.345
53 160 0 8 0.342
160 182 0 8 0.339
142 182 0 8 0.339
75 173 0 8 0.339
68 192 0 8 0.334
53 150 0 8 0.331
175 184 0 8 0.329
153 169 0 8 0.326
77 169 0 8 0.326
74 147 0 8 0.326
73 160 0 8 0.326
64 178 0 8 0.326
182 241 0 8 0.323
76 178 0 8 0.323
100 160 0 8 0.321
76 185 0 8 0.321
168 185 0 8 0.318
156 166 0 8 0.318
77 189 0 8 0.318
66 165 0 8 0.318
64 76 0 8 0.318
115 144 0 8 0.316
54 150 0 8 0.316
52 115 0 8 0.316
145 180 0 8 0.313
144 185 0 8 0.313
127 186 0 8 0.313
140 178 0 8 0.31
53 144 0 8 0.31
140 186 0 8 0.308
76 176 0 8 0.308
75 190 0 8 0.308
52 178 0 8 0.308
52 67 0 8 0.308
160 175 0 8 0.305
100 184 0 8 0.305
77 184 0 8 0.305
175 185 0 8 0.303
148 176 0 8 0.303
52 103 0 8 0.303
45 68 0 8 0.303
76 187 0 8 0.3
100 238 0 8 0.298
44 76 0 8 0.298
116 148 0 8 0.295
78 126 0 8 0.295
68 197 0 8 0.295
42 160 0 8 0.295
158 190 0 8 0.293
100 185 0 8 0.293
85 186 0 8 0.293
76 175 0 8 0.293
73 158 0 8 0.293
68 77 0 8 0.293
65 165 0 8 0.293
160 238 0 8 0.29
148 190 0 8 0.29
148 180 0 8 0.29
142 186 0 8 0.29
73 144 0 8 0.29
63 186 0 8 0.29
166 237 0 8 0.288
165 185 0 8 0.288
43 186 0 8 0.288
182 238 0 8 0.285
165 233 0 8 0.285
142 187 0 8 0.285
71 158 0 8 0.285
68 114 0 8 0.285
132 144 0 8 0.283
118 182 0 8 0.283
68 168 0 8 0.283
68 157 0 8 0.283
66 186 0 8 0.283
56 186 0 8 0.283
175 186 0 8 0.28
165 186 0 8 0.28
165 184 0 8 0.28
160 233 0 8 0.28
144 189 0 8 0.28
178 244 0 8 0.278
115 160 0 8 0.278
75 207 0 8 0.278
71 152 0 8 0.278
68 186 0 8 0.278
56 185 0 8 0.278
53 163 0 8 0.278
END