PFRMAT RR
TARGET T0201
AUTHOR 4204-4258-2837
REMARK From group SAM-TO4-hand under the direction of
REMARK Kevin Karplus.
REMARK Project by George Shackelford and Kevin Karplus
REMARK The value given is an approximation of the probability
REMARK as provided by the neural network.
REMARK The number of predictions is limited to .5*sequence_length
REMARK or to a limited set of high scoring pairs.
REMARK
METHOD The predictor is an artificial neural network
METHOD using 280 inputs.
METHOD Input includes separation and sequence length, corrected
METHOD mutual information between columns (M. Cline) and 
METHOD an e-value measure of correlation between columns (K Karplus) 
METHOD NN: NN280-240n300.net.28
METHOD Other inputs are from alignments and
METHOD secondary predictions from SAM-t2k and SAM-t04 of 
METHOD University of California, Santa Cruz
MODEL 1
MIKVTVTNSFFEVTGHAPDKTLCASVSLLTQHVANFLKAEKKAKIKKESG
YLKVKFEELENCEVKVLAAMVRSLKELEQKFPSQIRVEVIDNGS
29 73 0 8 0.6035
32 73 0 8 0.51425
11 45 0 8 0.4063
45 87 0 8 0.34765
32 87 0 8 0.31195
22 66 0 8 0.2839
52 87 0 8 0.24905
45 59 0 8 0.24905
6 87 0 8 0.2465
56 66 0 8 0.2448
32 52 0 8 0.2448
36 87 0 8 0.2346
29 66 0 8 0.2346
11 33 0 8 0.2346
21 66 0 8 0.23035
25 87 0 8 0.2261
34 67 0 8 0.2244
11 81 0 8 0.2091
13 36 0 8 0.20655
6 45 0 8 0.20655
4 89 0 8 0.20655
40 56 0 8 0.19975
17 30 0 8 0.19975
21 30 0 8 0.1972
37 71 0 8 0.1904
30 43 0 8 0.1904
32 54 0 8 0.1887
25 77 0 8 0.1887
33 67 0 8 0.1836
28 77 0 8 0.1836
21 34 0 8 0.1819
49 90 0 8 0.1802
43 62 0 8 0.1717
10 52 0 8 0.1717
43 63 0 8 0.17
END