PFRMAT RR
TARGET T0201
AUTHOR 4204-4258-2837
REMARK From group SAM-TO4-hand under the direction of
REMARK Kevin Karplus.
REMARK Project by George Shackelford and Kevin Karplus
REMARK The value given is an approximation of the probability
REMARK as provided by the neural network.
REMARK The number of predictions is limited to .5*sequence_length.
REMARK
METHOD The predictor is an artificial neural network
METHOD using 134 inputs.
METHOD Input includes separation and sequence length, corrected
METHOD mutual information between columns (M. Cline) and 
METHOD an e-value measure of correlation between columns (K Karplus) 
METHOD Other inputs are from alignments and
METHOD secondary predictions from SAM-t2k and SAM-t04 of 
METHOD University of California, Santa Cruz
METHOD This version uses a new error function designed to improve
METHOD the top scores per protein.
MODEL 1
MIKVTVTNSFFEVTGHAPDKTLCASVSLLTQHVANFLKAEKKAKIKKESG
YLKVKFEELENCEVKVLAAMVRSLKELEQKFPSQIRVEVIDNGS
29 73 0 8 0.37
32 73 0 8 0.305
29 66 0 8 0.259
22 66 0 8 0.252
28 77 0 8 0.25
33 67 0 8 0.248
24 67 0 8 0.243
21 30 0 8 0.241
36 73 0 8 0.237
32 52 0 8 0.237
24 35 0 8 0.237
10 52 0 8 0.23
11 33 0 8 0.228
34 67 0 8 0.226
17 30 0 8 0.226
25 77 0 8 0.222
29 71 0 8 0.218
34 89 0 8 0.212
32 87 0 8 0.212
21 34 0 8 0.212
33 71 0 8 0.21
21 32 0 8 0.208
21 66 0 8 0.204
70 86 0 8 0.202
34 73 0 8 0.202
22 63 0 8 0.202
53 70 0 8 0.2
32 54 0 8 0.2
30 62 0 8 0.2
25 87 0 8 0.2
54 86 0 8 0.198
36 84 0 8 0.196
29 89 0 8 0.196
6 30 0 8 0.196
72 89 0 8 0.194
72 83 0 8 0.194
25 63 0 8 0.194
74 86 0 8 0.192
29 50 0 8 0.192
19 33 0 8 0.191
14 25 0 8 0.191
13 36 0 8 0.191
65 83 0 8 0.189
43 63 0 8 0.189
37 72 0 8 0.189
33 53 0 8 0.189
18 30 0 8 0.189
END