PFRMAT RR TARGET T0200 AUTHOR 4204-4258-2837 REMARK From group SAM-TO4-hand under the direction of REMARK Kevin Karplus. REMARK Project by George Shackelford and Kevin Karplus REMARK The value given is an approximation of the probability REMARK as provided by the neural network. REMARK The number of predictions is limited to .5*sequence_length. REMARK METHOD The predictor is an artificial neural network METHOD using 134 inputs. METHOD Input includes separation and sequence length, corrected METHOD mutual information between columns (M. Cline) and METHOD an e-value measure of correlation between columns (K Karplus) METHOD Other inputs are from alignments and METHOD secondary predictions from SAM-t2k and SAM-t04 of METHOD University of California, Santa Cruz METHOD This version uses a new error function designed to improve METHOD the top scores per protein. MODEL 1 MRVLFIGDVFGQPGRRVLQNHLPTIRPQFDFVIVNMENSAGGFGMHRDAA RGALEAGAGCLTLGNHAWHHKDIYPMLSEDTYPIVRPLNYADPGTPGVGW RTFDVNGEKLTVVNLLGRVFMEAVDNPFRTMDALLERDDLGTVFVDFHAE ATSEKEAMGWHLAGRVAAVIGTHTHVPTADTRILKGGTAYQTDAGFTGPH DSIIGSAIEGPLQRFLTERPHRYGVAEGRAELNGVALHFEGGKATAAERY RFIED 37 89 0 8 0.561 37 67 0 8 0.546 64 89 0 8 0.543 67 172 0 8 0.531 38 67 0 8 0.531 37 172 0 8 0.525 38 64 0 8 0.517 64 172 0 8 0.511 38 172 0 8 0.498 38 89 0 8 0.495 37 64 0 8 0.495 68 89 0 8 0.483 36 89 0 8 0.481 36 64 0 8 0.481 37 174 0 8 0.478 10 38 0 8 0.478 89 174 0 8 0.475 64 174 0 8 0.472 64 84 0 8 0.469 67 89 0 8 0.466 54 89 0 8 0.463 7 37 0 8 0.463 54 82 0 8 0.46 5 37 0 8 0.457 149 192 0 8 0.451 146 172 0 8 0.451 37 84 0 8 0.451 37 68 0 8 0.451 11 64 0 8 0.451 64 198 0 8 0.445 174 197 0 8 0.442 67 174 0 8 0.442 38 174 0 8 0.439 37 192 0 8 0.439 10 37 0 8 0.439 151 174 0 8 0.436 89 192 0 8 0.436 89 115 0 8 0.436 10 89 0 8 0.436 89 113 0 8 0.433 114 172 0 8 0.43 89 172 0 8 0.43 64 86 0 8 0.43 37 76 0 8 0.427 32 64 0 8 0.427 64 149 0 8 0.424 64 146 0 8 0.424 37 200 0 8 0.424 37 199 0 8 0.424 10 64 0 8 0.424 174 193 0 8 0.421 38 146 0 8 0.421 37 46 0 8 0.421 7 89 0 8 0.421 37 194 0 8 0.418 37 149 0 8 0.418 89 198 0 8 0.415 84 192 0 8 0.415 76 149 0 8 0.415 174 196 0 8 0.412 89 146 0 8 0.412 76 192 0 8 0.412 37 146 0 8 0.412 37 88 0 8 0.412 36 172 0 8 0.412 35 64 0 8 0.412 89 149 0 8 0.409 67 88 0 8 0.409 37 193 0 8 0.409 149 193 0 8 0.407 35 174 0 8 0.407 89 200 0 8 0.404 6 58 0 8 0.404 37 176 0 8 0.401 34 64 0 8 0.401 10 88 0 8 0.401 89 199 0 8 0.398 86 127 0 8 0.398 35 53 0 8 0.398 7 194 0 8 0.398 84 172 0 8 0.395 72 89 0 8 0.395 7 64 0 8 0.395 5 61 0 8 0.395 86 172 0 8 0.392 37 54 0 8 0.392 31 176 0 8 0.392 155 196 0 8 0.389 89 196 0 8 0.389 89 193 0 8 0.389 76 174 0 8 0.389 76 89 0 8 0.389 54 67 0 8 0.389 37 151 0 8 0.389 19 89 0 8 0.389 7 171 0 8 0.389 149 196 0 8 0.386 38 88 0 8 0.386 37 82 0 8 0.386 11 89 0 8 0.386 7 174 0 8 0.386 7 147 0 8 0.386 5 35 0 8 0.386 174 199 0 8 0.384 151 192 0 8 0.384 68 172 0 8 0.384 54 68 0 8 0.384 149 174 0 8 0.381 67 84 0 8 0.381 49 172 0 8 0.381 38 86 0 8 0.381 149 172 0 8 0.378 89 194 0 8 0.378 64 202 0 8 0.378 64 200 0 8 0.378 62 174 0 8 0.378 34 61 0 8 0.378 7 199 0 8 0.378 178 193 0 8 0.375 113 151 0 8 0.375 76 151 0 8 0.375 67 200 0 8 0.375 37 178 0 8 0.375 26 89 0 8 0.375 7 149 0 8 0.375 113 174 0 8 0.372 89 178 0 8 0.372 END