PFRMAT RR TARGET T0198 AUTHOR 4204-4258-2837 REMARK From group SAM-TO4-hand under the direction of REMARK Kevin Karplus. REMARK Project by George Shackelford and Kevin Karplus REMARK The value given is an approximation of the probability REMARK as provided by the neural network. REMARK The number of predictions is limited to .5*sequence_length. REMARK METHOD The predictor is an artificial neural network METHOD using 134 inputs. METHOD Input includes separation and sequence length, corrected METHOD mutual information between columns (M. Cline) and METHOD an e-value measure of correlation between columns (K Karplus) METHOD Other inputs are from alignments and METHOD secondary predictions from SAM-t2k and SAM-t04 of METHOD University of California, Santa Cruz METHOD This version uses a new error function designed to improve METHOD the top scores per protein. MODEL 1 MNRLLNEKVEEFKKGVLKAGWFIEKMFRNSISSLVERNESLAREVIADEE VVDQMEVEIQEKAMEVLGLFSPIGKPLLTVTAGIRVAELIENIADKCHDI AKNVLELMEEPPLKPLEDIPAMANQTSEMLKFALRMFADVNVEKSFEVCR MDSKVDDLYEKVREELLLYMMESPKYVKRALLLLEIAGNIEIIADYATNI VEVSVYMVQGEAYKCYHDELLLFKKSGGVLFESSD 152 191 0 8 0.605 156 191 0 8 0.531 63 185 0 8 0.531 20 134 0 8 0.525 63 152 0 8 0.517 82 191 0 8 0.495 152 195 0 8 0.489 68 152 0 8 0.472 71 89 0 8 0.46 129 152 0 8 0.457 77 152 0 8 0.457 72 152 0 8 0.457 63 77 0 8 0.457 152 198 0 8 0.454 73 185 0 8 0.454 129 194 0 8 0.448 180 202 0 8 0.442 63 72 0 8 0.442 156 195 0 8 0.439 74 152 0 8 0.439 63 191 0 8 0.439 63 73 0 8 0.439 77 92 0 8 0.436 95 202 0 8 0.433 77 206 0 8 0.433 60 152 0 8 0.433 191 206 0 8 0.43 12 63 0 8 0.427 152 181 0 8 0.424 145 201 0 8 0.424 63 203 0 8 0.421 56 85 0 8 0.421 49 91 0 8 0.421 49 95 0 8 0.418 60 72 0 8 0.409 72 188 0 8 0.407 53 95 0 8 0.407 152 188 0 8 0.404 76 152 0 8 0.404 12 72 0 8 0.404 8 166 0 8 0.404 129 191 0 8 0.398 101 202 0 8 0.398 71 159 0 8 0.398 89 199 0 8 0.395 85 152 0 8 0.395 5 166 0 8 0.395 152 206 0 8 0.392 166 183 0 8 0.389 78 206 0 8 0.389 166 190 0 8 0.386 19 94 0 8 0.381 72 185 0 8 0.378 2 185 0 8 0.378 63 74 0 8 0.375 60 76 0 8 0.372 68 85 0 8 0.37 67 78 0 8 0.37 53 91 0 8 0.37 72 92 0 8 0.367 68 191 0 8 0.367 76 182 0 8 0.361 66 191 0 8 0.361 122 194 0 8 0.356 67 77 0 8 0.356 12 77 0 8 0.356 78 152 0 8 0.353 101 194 0 8 0.35 123 155 0 8 0.347 33 97 0 8 0.347 5 195 0 8 0.347 85 129 0 8 0.345 62 72 0 8 0.345 73 152 0 8 0.342 72 82 0 8 0.337 15 185 0 8 0.337 77 191 0 8 0.334 60 73 0 8 0.334 70 152 0 8 0.331 12 92 0 8 0.331 96 196 0 8 0.329 77 156 0 8 0.329 12 166 0 8 0.329 2 70 0 8 0.329 77 102 0 8 0.326 66 190 0 8 0.326 15 180 0 8 0.326 1 82 0 8 0.326 74 92 0 8 0.323 60 85 0 8 0.323 60 77 0 8 0.323 5 68 0 8 0.323 92 189 0 8 0.321 69 78 0 8 0.321 130 197 0 8 0.318 89 189 0 8 0.318 74 188 0 8 0.318 23 78 0 8 0.318 133 158 0 8 0.316 82 206 0 8 0.316 74 129 0 8 0.316 62 77 0 8 0.313 30 97 0 8 0.313 8 70 0 8 0.313 99 198 0 8 0.31 96 189 0 8 0.31 69 188 0 8 0.31 129 206 0 8 0.308 82 152 0 8 0.308 77 203 0 8 0.308 19 55 0 8 0.308 92 152 0 8 0.305 72 170 0 8 0.305 72 166 0 8 0.305 68 129 0 8 0.305 77 188 0 8 0.303 63 188 0 8 0.303 END