CASP6 Target T0197
- 1. Protein Name
- Pfu-838710
- 2. Organism Name
- Pyrococcus furiosus DSM 3638
- 3. Number of amino acids (approx)
- 179
- 4. Accession number
- 18977235
- 5. Sequence Database
- Genbank
- 6. Amino acid sequence
-
AHHHHHHGSEVEIKFKIKLEDFLHTLNTFNPEFVRYEEQEDVYFEVPRPKLLRIRGVHNL
KKYYLTFKEILDENNEEFYEVEFEIGDFEKAVEVFKRLGFKIQATIKKKRWVYKLNGVTL
EVNRVEGIGDFVDIEVISDSPEEAKEKIWEVAKMLGLKEEDVEPRLYLELINELSGRSS
- 7. Additional information
-
GO category Molecular Function: NA
GO category Biological process: NA
GO category Cellular components: NA
Binding: NA
Binding site: NA
Residue role: NA
PT modifications: NA
Comment: NA
- 8. X-ray structure
- yes
- 9. Current state of the experimental work
- Refinement
- 10. Interpretable map?
- yes
- 11. Estimated date of chain tracing completion
- July 4, 2004
- 12. Estimated date of public release of structure
- July 4, 2004
Related Files
Template Sequence file
Template PDB file