PFRMAT RR
TARGET T0197
AUTHOR 4204-4258-2837
REMARK From group SAM-TO4-hand under the direction of
REMARK Kevin Karplus.
REMARK Project by George Shackelford and Kevin Karplus
REMARK The value given as the probability is actually the raw score
REMARK as provided by the neural network.
REMARK The number of predictions is limited to .5*sequence_length.
REMARK
METHOD The predictor is an artifical neural network
METHOD using 104 inputs.
METHOD Input includes separation and sequence length, corrected
METHOD mutual information between columns (M. Cline) and 
METHOD an e-value measure of correlation between columns (K Karplus) 
METHOD Other inputs are from alignments and
METHOD secondary predictions from SAM-t2k and SAM-t04 of 
METHOD University of California, Santa Cruz
MODEL 1
AHHHHHHGSEVEIKFKIKLEDFLHTLNTFNPEFVRYEEQEDVYFEVPRPK
LLRIRGVHNLKKYYLTFKEILDENNEEFYEVEFEIGDFEKAVEVFKRLGF
KIQATIKKKRWVYKLNGVTLEVNRVEGIGDFVDIEVISDSPEEAKEKIWE
VAKMLGLKEEDVEPRLYLELINELSGRSS
120 132 0 8 0.882
15 65 0 8 0.872
121 138 0 8 0.865
120 136 0 8 0.862
66 80 0 8 0.856
106 120 0 8 0.85
80 119 0 8 0.836
111 120 0 8 0.831
121 136 0 8 0.817
64 121 0 8 0.8
120 131 0 8 0.798
43 53 0 8 0.776
10 66 0 8 0.776
106 121 0 8 0.774
106 122 0 8 0.77
68 80 0 8 0.763
112 121 0 8 0.752
108 121 0 8 0.752
108 119 0 8 0.743
15 53 0 8 0.736
78 119 0 8 0.734
122 131 0 8 0.732
108 120 0 8 0.732
15 67 0 8 0.732
78 118 0 8 0.724
13 44 0 8 0.72
104 113 0 8 0.717
53 66 0 8 0.717
108 118 0 8 0.715
13 67 0 8 0.7
68 82 0 8 0.687
10 53 0 8 0.687
13 51 0 8 0.684
106 118 0 8 0.677
121 131 0 8 0.674
69 78 0 8 0.674
11 67 0 8 0.674
69 119 0 8 0.666
57 78 0 8 0.666
119 135 0 8 0.663
78 121 0 8 0.658
51 67 0 8 0.653
68 119 0 8 0.65
57 69 0 8 0.65
67 78 0 8 0.647
106 136 0 8 0.644
78 112 0 8 0.642
67 125 0 8 0.642
108 123 0 8 0.639
107 120 0 8 0.633
106 123 0 8 0.633
10 43 0 8 0.633
106 119 0 8 0.63
104 118 0 8 0.622
81 100 0 8 0.616
113 123 0 8 0.614
79 113 0 8 0.608
108 122 0 8 0.602
107 123 0 8 0.602
113 136 0 8 0.591
106 124 0 8 0.573
80 100 0 8 0.573
13 42 0 8 0.573
113 124 0 8 0.57
79 111 0 8 0.552
78 111 0 8 0.552
51 69 0 8 0.552
63 120 0 8 0.546
71 112 0 8 0.543
67 106 0 8 0.54
134 148 0 8 0.534
108 124 0 8 0.534
83 111 0 8 0.531
39 65 0 8 0.525
123 132 0 8 0.519
121 162 0 8 0.517
106 131 0 8 0.517
104 123 0 8 0.514
79 108 0 8 0.514
53 78 0 8 0.508
107 122 0 8 0.498
13 39 0 8 0.498
132 148 0 8 0.495
106 132 0 8 0.495
106 125 0 8 0.495
51 78 0 8 0.495
118 136 0 8 0.489
102 118 0 8 0.489
13 57 0 8 0.489
END