PFRMAT RR
TARGET T0196
AUTHOR 4204-4258-2837
REMARK From group SAM-TO4-hand under the direction of
REMARK Kevin Karplus.
REMARK Project by George Shackelford and Kevin Karplus
REMARK The value given as the probability is actually the raw score
REMARK as provided by the neural network.
REMARK The number of predictions is limited to .5*sequence_length.
REMARK
METHOD The predictor is an artifical neural network
METHOD using 104 inputs.
METHOD Input includes separation and sequence length, corrected
METHOD mutual information between columns (M. Cline) and 
METHOD an e-value measure of correlation between columns (K Karplus) 
METHOD Other inputs are from alignments and
METHOD secondary predictions from SAM-t2k and SAM-t04 of 
METHOD University of California, Santa Cruz
MODEL 1
AHHHHHHGSGLFDFLKRKEVKEEEKIEILSKKPAGKVVVEEVVNIMGKDV
IIGTVESGMIGVGFKVKGPSGIGGIVRIERNREKVEFAIAGDRIGISIEG
KIGKVKKGDVLEIYQT
76 97 0 8 0.98
74 97 0 8 0.953
77 97 0 8 0.951
97 109 0 8 0.95
52 77 0 8 0.944
54 74 0 8 0.935
67 97 0 8 0.934
41 54 0 8 0.926
52 97 0 8 0.914
79 97 0 8 0.912
40 97 0 8 0.912
40 50 0 8 0.901
40 76 0 8 0.898
79 95 0 8 0.894
76 95 0 8 0.894
50 77 0 8 0.888
50 97 0 8 0.882
56 92 0 8 0.869
40 54 0 8 0.869
79 93 0 8 0.867
54 79 0 8 0.862
74 95 0 8 0.86
56 79 0 8 0.859
40 74 0 8 0.859
40 51 0 8 0.856
40 77 0 8 0.853
50 73 0 8 0.852
50 79 0 8 0.844
98 111 0 8 0.829
76 99 0 8 0.824
41 56 0 8 0.822
40 56 0 8 0.82
50 95 0 8 0.815
97 107 0 8 0.813
51 97 0 8 0.813
41 76 0 8 0.809
56 97 0 8 0.806
41 79 0 8 0.806
80 97 0 8 0.804
45 79 0 8 0.804
74 99 0 8 0.802
54 93 0 8 0.798
45 73 0 8 0.794
36 74 0 8 0.792
40 67 0 8 0.79
57 74 0 8 0.788
43 76 0 8 0.786
40 79 0 8 0.786
76 93 0 8 0.784
40 73 0 8 0.782
40 52 0 8 0.782
79 99 0 8 0.78
41 73 0 8 0.778
77 99 0 8 0.776
45 97 0 8 0.772
45 56 0 8 0.763
73 97 0 8 0.761
54 95 0 8 0.761
END