CASP5 Target T0192
-
1. Protein Name
- Spermidime/Spermine Acetyltransferase (SSAT)
-
2. Organism Name
- Homo sapiens
-
3. Number of amino acids (approx)
- 171
-
4. Accession number
- P21673
-
5. Sequence Database
- Swiss-prot
-
6. Amino acid sequence
-
MAKFVIRPATAADCSDILRLIKELAKYEYMEEQVILTEKDLLEDGFGEHP
FYHCLVAEVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDY
RGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLSS
EEGWRLFKIDKEYLLKMATEE
-
7. Additional Information
-
Single domain.
No cofactor in crystals.
-
8. X-ray structure
- yes
-
9. Current state of the experimental work
-
Structure is solved, model is completed, in the final stage of refinement.
-
10. Interpretable map?
- yes
-
11. Estimated date of chain tracing completion
- July 1, 2002
-
12. Estimated date of public release of structure
- CASP Evaluation
-
13. Name
- unavailable until after public release of structure
Related Files
Template Sequence file
Template PDB file