# command:# Seed set to 1032114547 # command:# Prefix for input files set to # command:# reading script from file define-score.script # Prefix for input files set to /projects/kestrel/users/karplus/burial/undertaker/atoms-inputs/ # reading monomeric-50pc.atoms # After reading monomeric-50pc.atoms have 448 chains in training database # 111547 residues have no bad marker # 670 residues lack atoms needed to compute omega # 322 residues have cis peptide # number of each bad type: # NON_STANDARD_RESIDUE 6 # HAS_OXT 325 # TOO_MANY_ATOMS 1 # TOO_FEW_ATOMS 523 # HAS_UNKNOWN_ATOMS 2 # HAS_DUPLICATE_ATOMS 0 # CHAIN_BREAK_BEFORE 208 # NON_PLANAR_PEPTIDE 28 # Note: may sum to more than number of residues, # because one residue may have multiple problems # Reading rotamer library from monomeric-50pc.rot # Prefix for input files set to /projects/kestrel/users/karplus/burial/undertaker/spots/ # ReadAtomType pdb-name.types Read AtomType pdb-name with 37 types. # ReadClashTable pdb-atom-name.clash # Read ClashTable pdb-atom-name Reading spots from monomeric-50pc-dry-5.spot. Read prototypes from /projects/kestrel/users/karplus/burial/undertaker/spots/../normalize_prototypes/prototypes # reading histogram from smoothed-monomeric-50pc-dry-5.hist # created burial cost function dry5 with radius 5 Reading spots from monomeric-50pc-wet-6.5.spot. Read prototypes from /projects/kestrel/users/karplus/burial/undertaker/spots/../normalize_prototypes/prototypes # reading histogram from smoothed-monomeric-50pc-wet-6.5.hist # created burial cost function wet6.5 with radius 6.5 Reading spots from monomeric-50pc-dry-6.5.spot. Read prototypes from /projects/kestrel/users/karplus/burial/undertaker/spots/../normalize_prototypes/prototypes # reading histogram from smoothed-monomeric-50pc-dry-6.5.hist # created burial cost function dry6.5 with radius 6.5 Reading spots from monomeric-50pc-generic-6.5.spot. Read prototypes from /projects/kestrel/users/karplus/burial/undertaker/spots/../normalize_prototypes/prototypes # reading histogram from smoothed-monomeric-50pc-generic-6.5.hist # created burial cost function gen6.5 with radius 6.5 Reading spots from monomeric-50pc-dry-8.spot. Read prototypes from /projects/kestrel/users/karplus/burial/undertaker/spots/../normalize_prototypes/prototypes # reading histogram from smoothed-monomeric-50pc-dry-8.hist # created burial cost function dry8 with radius 8 Reading spots from monomeric-50pc-dry-10.spot. Read prototypes from /projects/kestrel/users/karplus/burial/undertaker/spots/../normalize_prototypes/prototypes # reading histogram from smoothed-monomeric-50pc-dry-10.hist # created burial cost function dry10 with radius 10 Reading spots from monomeric-50pc-dry-12.spot. Read prototypes from /projects/kestrel/users/karplus/burial/undertaker/spots/../normalize_prototypes/prototypes # reading histogram from smoothed-monomeric-50pc-dry-12.hist # created burial cost function dry12 with radius 12 # reading histogram from monomeric-smoothed-alpha.hist # created alpha cost function alpha with offset 0 and 360 bins # reading histogram from monomeric-smoothed-alpha-1.hist # created alpha cost function alpha_prev with offset -1 and 360 bins CPU_time= 10980 msec, elapsed time= 11849.3 msec) # Prefix for input files set to # Reading target chain from PDB file T0191.blank.pdb Read PDB file T0191.blank.pdb as target. Have 160 residues and 1221 atoms. # No conformations to remove in PopConform # Prefix for input files set to /projects/compbio/lib/alphabet/ # Read 3 alphabets from alpha.alphabet # Prefix for input files set to # reading predictions from T0191.t2k.alpha.rdb # created predicted alpha cost function pred_alpha2 with 360 bins # SetCost created cost = # ( 0.2 * gen6.5(6.5) + 1 * wet6.5(6.5, /log(length)) + 3 * dry5(5) + 11 * dry6.5(6.5) + 4 * dry8(8) + 1 * dry12(12) + 0.5 * phobic_fit + 0.2 * sidechain + 1.5 * clashes + -0.2 * sidechain_clashes + 0.5 * backbone_clashes + 10 * break + 1 * pred_alpha2 + 0.1 * constraints + 1 * contact_order ) # command:CPU_time= 15670 msec, elapsed time= 16538.4 msec) # command:# Making generic fragment library # fragment library contains # type length num_fragments num_indexes_used # n-terminus 1 407 20 (100%) # n-terminus 2 408 196 (49%) # middle 1 109496 20 (100%) # middle 2 108592 400 (100%) # middle 3 107719 7822 (97.775%) # middle 4 106865 64233 (40.1456%) # c-terminus 1 408 20 (100%) # c-terminus 2 406 227 (56.75%) # ss-bonds 409 # command:CPU_time= 20660 msec, elapsed time= 21532.6 msec) # command:# Prefix for output files set to decoys/ # command:# created conformation for T0191 from sequence in target chain replacing old conformation. # command:# naming current conformation T0191.rand # command:CPU_time= 20660 msec, elapsed time= 21536.2 msec) # command:# Prefix for input files set to # command:Warning: Couldn't open file Template.atoms or Template.atoms.gz for input Error: Trying Template.atoms Error: Couldn't open file Template.atoms or Template.atoms.gz for input # command:# reading script from file T0191.t2k.undertaker-align.script # Reading fragments from alignment file # T0191 read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1gpjA/T0191-1gpjA-2track-protein-STR-global-adpstyle1.pw.a2m.gz # 1gpjA read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1gpjA/T0191-1gpjA-2track-protein-STR-global-adpstyle1.pw.a2m.gz # adding 1gpjA to template set 1gpjA:Skipped atom 122, because occupancy 0.5 <= existing 0.500001 Skipped atom 123, because occupancy 0.5 <= existing 0.500001 Skipped atom 124, because occupancy 0.5 <= existing 0.500001 Skipped atom 125, because occupancy 0.5 <= existing 0.500001 Skipped atom 126, because occupancy 0.5 <= existing 0.500001 Skipped atom 127, because occupancy 0.5 <= existing 0.500001 Skipped atom 128, because occupancy 0.5 <= existing 0.500001 Skipped atom 630, because occupancy 0.5 <= existing 0.500001 Skipped atom 631, because occupancy 0.5 <= existing 0.500001 Skipped atom 632, because occupancy 0.5 <= existing 0.500001 Skipped atom 633, because occupancy 0.5 <= existing 0.500001 Skipped atom 634, because occupancy 0.5 <= existing 0.500001 Skipped atom 635, because occupancy 0.5 <= existing 0.500001 Skipped atom 636, because occupancy 0.5 <= existing 0.500001 Skipped atom 637, because occupancy 0.5 <= existing 0.500001 Skipped atom 638, because occupancy 0.5 <= existing 0.500001 Skipped atom 853, because occupancy 0.5 <= existing 0.500001 Skipped atom 854, because occupancy 0.5 <= existing 0.500001 Skipped atom 855, because occupancy 0.5 <= existing 0.500001 Skipped atom 856, because occupancy 0.5 <= existing 0.500001 Skipped atom 857, because occupancy 0.5 <= existing 0.500001 Skipped atom 858, because occupancy 0.5 <= existing 0.500001 Skipped atom 859, because occupancy 0.5 <= existing 0.500001 Skipped atom 860, because occupancy 0.5 <= existing 0.500001 Skipped atom 861, because occupancy 0.5 <= existing 0.500001 Skipped atom 994, because occupancy 0.5 <= existing 0.500001 Skipped atom 995, because occupancy 0.5 <= existing 0.500001 Skipped atom 996, because occupancy 0.5 <= existing 0.500001 Skipped atom 997, because occupancy 0.5 <= existing 0.500001 Skipped atom 998, because occupancy 0.5 <= existing 0.500001 Skipped atom 999, because occupancy 0.5 <= existing 0.500001 Skipped atom 1000, because occupancy 0.5 <= existing 0.500001 Skipped atom 1001, because occupancy 0.5 <= existing 0.500001 Skipped atom 1002, because occupancy 0.5 <= existing 0.500001 Skipped atom 1072, because occupancy 0.3 <= existing 0.700001 Skipped atom 1073, because occupancy 0.3 <= existing 0.700001 Skipped atom 1074, because occupancy 0.3 <= existing 0.700001 Skipped atom 1075, because occupancy 0.3 <= existing 0.700001 Skipped atom 1076, because occupancy 0.3 <= existing 0.700001 Skipped atom 1077, because occupancy 0.3 <= existing 0.700001 Skipped atom 1078, because occupancy 0.3 <= existing 0.700001 Skipped atom 1079, because occupancy 0.3 <= existing 0.700001 Skipped atom 1495, because occupancy 0.5 <= existing 0.500001 Skipped atom 1496, because occupancy 0.5 <= existing 0.500001 Skipped atom 1497, because occupancy 0.5 <= existing 0.500001 Skipped atom 1498, because occupancy 0.5 <= existing 0.500001 Skipped atom 1499, because occupancy 0.5 <= existing 0.500001 Skipped atom 1500, because occupancy 0.5 <= existing 0.500001 Skipped atom 1501, because occupancy 0.5 <= existing 0.500001 Skipped atom 1502, because occupancy 0.5 <= existing 0.500001 Skipped atom 1503, because occupancy 0.5 <= existing 0.500001 Skipped atom 1504, because occupancy 0.5 <= existing 0.500001 Skipped atom 1505, because occupancy 0.5 <= existing 0.500001 Skipped atom 1770, because occupancy 0.2 <= existing 0.800001 Skipped atom 1771, because occupancy 0.2 <= existing 0.800001 Skipped atom 1772, because occupancy 0.2 <= existing 0.800001 Skipped atom 1773, because occupancy 0.2 <= existing 0.800001 Skipped atom 1774, because occupancy 0.2 <= existing 0.800001 Skipped atom 1775, because occupancy 0.2 <= existing 0.800001 Skipped atom 1776, because occupancy 0.2 <= existing 0.800001 Skipped atom 1777, because occupancy 0.2 <= existing 0.800001 Skipped atom 2007, because occupancy 0.5 <= existing 0.500001 Skipped atom 2008, because occupancy 0.5 <= existing 0.500001 Skipped atom 2009, because occupancy 0.5 <= existing 0.500001 Skipped atom 2010, because occupancy 0.5 <= existing 0.500001 Skipped atom 2011, because occupancy 0.5 <= existing 0.500001 Skipped atom 2012, because occupancy 0.5 <= existing 0.500001 Skipped atom 2013, because occupancy 0.5 <= existing 0.500001 Skipped atom 2014, because occupancy 0.5 <= existing 0.500001 Skipped atom 2015, because occupancy 0.5 <= existing 0.500001 Skipped atom 2046, because occupancy 0.5 <= existing 0.500001 Skipped atom 2047, because occupancy 0.5 <= existing 0.500001 Skipped atom 2048, because occupancy 0.5 <= existing 0.500001 Skipped atom 2049, because occupancy 0.5 <= existing 0.500001 Skipped atom 2050, because occupancy 0.5 <= existing 0.500001 Skipped atom 2051, because occupancy 0.5 <= existing 0.500001 Skipped atom 2052, because occupancy 0.5 <= existing 0.500001 Skipped atom 2053, because occupancy 0.5 <= existing 0.500001 Skipped atom 2054, because occupancy 0.5 <= existing 0.500001 Skipped atom 2055, because occupancy 0.5 <= existing 0.500001 Skipped atom 2056, because occupancy 0.5 <= existing 0.500001 Skipped atom 2238, because occupancy 0.5 <= existing 0.500001 Skipped atom 2239, because occupancy 0.5 <= existing 0.500001 Skipped atom 2240, because occupancy 0.5 <= existing 0.500001 Skipped atom 2241, because occupancy 0.5 <= existing 0.500001 Skipped atom 2242, because occupancy 0.5 <= existing 0.500001 Skipped atom 2243, because occupancy 0.5 <= existing 0.500001 Skipped atom 2244, because occupancy 0.5 <= existing 0.500001 Skipped atom 2245, because occupancy 0.5 <= existing 0.500001 Skipped atom 2246, because occupancy 0.5 <= existing 0.500001 Skipped atom 2593, because occupancy 0.3 <= existing 0.700001 Skipped atom 2594, because occupancy 0.3 <= existing 0.700001 Skipped atom 2595, because occupancy 0.3 <= existing 0.700001 Skipped atom 2596, because occupancy 0.3 <= existing 0.700001 Skipped atom 2597, because occupancy 0.3 <= existing 0.700001 Skipped atom 2598, because occupancy 0.3 <= existing 0.700001 Skipped atom 2599, because occupancy 0.3 <= existing 0.700001 Skipped atom 2600, because occupancy 0.3 <= existing 0.700001 Skipped atom 2601, because occupancy 0.3 <= existing 0.700001 Skipped atom 2685, because occupancy 0.5 <= existing 0.500001 Skipped atom 2686, because occupancy 0.5 <= existing 0.500001 Skipped atom 2687, because occupancy 0.5 <= existing 0.500001 Skipped atom 2688, because occupancy 0.5 <= existing 0.500001 Skipped atom 2689, because occupancy 0.5 <= existing 0.500001 Skipped atom 2690, because occupancy 0.5 <= existing 0.500001 Skipped atom 2691, because occupancy 0.5 <= existing 0.500001 Skipped atom 2692, because occupancy 0.5 <= existing 0.500001 Skipped atom 2693, because occupancy 0.5 <= existing 0.500001 Skipped atom 2694, because occupancy 0.5 <= existing 0.500001 Skipped atom 2695, because occupancy 0.5 <= existing 0.500001 Skipped atom 2778, because occupancy 0.5 <= existing 0.500001 Skipped atom 2779, because occupancy 0.5 <= existing 0.500001 Skipped atom 2780, because occupancy 0.5 <= existing 0.500001 Skipped atom 2781, because occupancy 0.5 <= existing 0.500001 Skipped atom 2782, because occupancy 0.5 <= existing 0.500001 Skipped atom 2783, because occupancy 0.5 <= existing 0.500001 Skipped atom 2784, because occupancy 0.5 <= existing 0.500001 Skipped atom 2785, because occupancy 0.5 <= existing 0.500001 Skipped atom 2786, because occupancy 0.5 <= existing 0.500001 Skipped atom 2832, because occupancy 0.5 <= existing 0.500001 Skipped atom 2833, because occupancy 0.5 <= existing 0.500001 Skipped atom 2834, because occupancy 0.5 <= existing 0.500001 Skipped atom 2835, because occupancy 0.5 <= existing 0.500001 Skipped atom 2836, because occupancy 0.5 <= existing 0.500001 Skipped atom 2837, because occupancy 0.5 <= existing 0.500001 Skipped atom 2838, because occupancy 0.5 <= existing 0.500001 Skipped atom 2839, because occupancy 0.5 <= existing 0.500001 Skipped atom 2840, because occupancy 0.5 <= existing 0.500001 Skipped atom 3015, because occupancy 0.5 <= existing 0.500001 Skipped atom 3016, because occupancy 0.5 <= existing 0.500001 Skipped atom 3017, because occupancy 0.5 <= existing 0.500001 Skipped atom 3018, because occupancy 0.5 <= existing 0.500001 Skipped atom 3019, because occupancy 0.5 <= existing 0.500001 Skipped atom 3020, because occupancy 0.5 <= existing 0.500001 Skipped atom 3021, because occupancy 0.5 <= existing 0.500001 Skipped atom 3022, because occupancy 0.5 <= existing 0.500001 Skipped atom 3023, because occupancy 0.5 <= existing 0.500001 Skipped atom 3125, because occupancy 0.5 <= existing 0.500001 Skipped atom 3126, because occupancy 0.5 <= existing 0.500001 Skipped atom 3127, because occupancy 0.5 <= existing 0.500001 Skipped atom 3128, because occupancy 0.5 <= existing 0.500001 Skipped atom 3129, because occupancy 0.5 <= existing 0.500001 Skipped atom 3130, because occupancy 0.5 <= existing 0.500001 Skipped atom 3131, because occupancy 0.5 <= existing 0.500001 Skipped atom 3132, because occupancy 0.5 <= existing 0.500001 Skipped atom 3207, because occupancy 0.5 <= existing 0.500001 Skipped atom 3208, because occupancy 0.5 <= existing 0.500001 Skipped atom 3209, because occupancy 0.5 <= existing 0.500001 Skipped atom 3210, because occupancy 0.5 <= existing 0.500001 Skipped atom 3211, because occupancy 0.5 <= existing 0.500001 Skipped atom 3212, because occupancy 0.5 <= existing 0.500001 # found chain 1gpjA in template set T0191 1 :I 1gpjA 1 :M Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 2 residues T0191 2 :GYNTDGIGARMALEEEIGRVKDKNIVIYGAGGAARAVAFELAK 1gpjA 146 :GAVSIGSAAVELAERELGSLHDKTVLVVGAGEMGKTVAKSLVD Fragment has 76 clashes (null) has 76 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 45 residues other bump:2.32562 Ang L14.CD1 and L42.CD2 other bump:2.26175 Ang R11.NH1 and E41.C other bump:2.70446 Ang R11.CD and E41.O other bump:2.20049 Ang R11.NH1 and E41.O other bump:1.16878 Ang A37.O and E41.OE1 other bump:2.12325 Ang A37.C and E41.OE1 other bump:2.71002 Ang V38.CA and E41.OE1 other bump:3.06491 Ang G7.CA and E41.CD other bump:2.03305 Ang A37.O and E41.CD other bump:2.97567 Ang A37.C and E41.CD other bump:3.08232 Ang G7.CA and E41.CG other bump:3.24563 Ang G7.C and E41.CG other bump:2.83406 Ang R11.CZ and E41.CB other bump:1.98869 Ang R11.NH1 and E41.CB other bump:1.91041 Ang R11.NH1 and E41.CA other bump:2.71694 Ang Y3.CB and M12.SD other bump:1.83398 Ang I8.CD1 and R11.NH2 other bump:2.88577 Ang Y3.CG and G9.CA other bump:2.27855 Ang Y3.CD2 and G9.CA other bump:2.62641 Ang Y3.CE2 and G9.CA other bump:2.49919 Ang Y3.CD1 and G9.N other bump:2.16413 Ang Y3.CG and G9.N other bump:1.652 Ang Y3.CD2 and G9.N other bump:1.55884 Ang Y3.CE2 and G9.N other bump:2.44228 Ang Y3.CE1 and G9.N other bump:2.00811 Ang Y3.CZ and G9.N other bump:1.75321 Ang Y3.CD1 and I8.C other bump:2.1123 Ang Y3.CG and I8.C other bump:2.42046 Ang Y3.CD2 and I8.C other bump:2.44556 Ang Y3.CE2 and I8.C other bump:3.29349 Ang Y3.CB and I8.C other bump:1.78431 Ang Y3.CE1 and I8.C other bump:2.14011 Ang Y3.CZ and I8.C other bump:2.31189 Ang Y3.CD1 and I8.O other bump:2.61852 Ang Y3.CG and I8.O other bump:3.14929 Ang Y3.CA and I8.CG2 other bump:1.35201 Ang Y3.CD1 and I8.CG2 other bump:2.30031 Ang Y3.CG and I8.CG2 other bump:2.78818 Ang Y3.CB and I8.CG2 other bump:2.34648 Ang Y3.CE1 and I8.CG2 other bump:2.74217 Ang Y3.CD1 and I8.CG1 other bump:2.23779 Ang Y3.CE1 and I8.CG1 other bump:1.23883 Ang Y3.CD1 and I8.CB other bump:2.40368 Ang Y3.CG and I8.CB other bump:3.10444 Ang Y3.CD2 and I8.CB other bump:3.069 Ang Y3.CE2 and I8.CB other bump:1.12483 Ang Y3.CE1 and I8.CB other bump:2.26274 Ang Y3.CZ and I8.CB other bump:1.62932 Ang Y3.CD1 and I8.CA other bump:2.71932 Ang Y3.CG and I8.CA other bump:3.12305 Ang Y3.CD2 and I8.CA other bump:2.75622 Ang Y3.CE2 and I8.CA other bump:2.512 Ang Y3.OH and I8.CA other bump:0.665591 Ang Y3.CE1 and I8.CA other bump:1.68541 Ang Y3.CZ and I8.CA other bump:2.83655 Ang Y3.CD1 and I8.N other bump:2.57477 Ang Y3.CE2 and I8.N other bump:1.15168 Ang Y3.OH and I8.N other bump:1.48594 Ang Y3.CE1 and I8.N other bump:1.20467 Ang Y3.CZ and I8.N other bump:3.2778 Ang Y3.CE2 and G7.C other bump:1.5461 Ang Y3.OH and G7.C other bump:2.68496 Ang Y3.CE1 and G7.C other bump:2.19595 Ang Y3.CZ and G7.C other bump:1.81848 Ang Y3.OH and G7.CA other bump:3.05225 Ang Y3.CZ and G7.CA other bump:1.8189 Ang Y3.OH and G7.N other bump:2.96188 Ang Y3.CZ and G7.N other bump:3.11491 Ang Y3.CE2 and D6.C other bump:2.54751 Ang Y3.OH and D6.C other bump:3.21493 Ang Y3.CZ and D6.C other bump:2.49392 Ang Y3.CE2 and T5.C other bump:3.13648 Ang Y3.CZ and T5.C other bump:2.21115 Ang Y3.CD2 and T5.O other bump:1.32678 Ang Y3.CE2 and T5.O other bump:2.27616 Ang Y3.CZ and T5.O T0191 45 :DN 1gpjA 190 :GV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues T0191 47 :NIIIANRTVEKAEALAKEIA 1gpjA 193 :AVLVANRTYERAVELARDLG Fragment has 19 clashes (null) has 19 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 22 residues other bump:3.28619 Ang I3.CG1 and G22.CA neighbor-bump: 2.2506 Ang I20.O and A21.CB neighbor-bump: 2.53375 Ang I20.C and A21.CB other bump:1.44539 Ang I3.CD1 and I20.CG2 other bump:2.89365 Ang I3.CG1 and I20.CG2 other bump:2.80691 Ang I3.CD1 and I20.CB other bump:2.49571 Ang I5.CD1 and A17.CB other bump:2.9766 Ang I5.CG1 and A17.CB other bump:2.28293 Ang I5.CD1 and A17.CA other bump:1.97413 Ang I5.CD1 and A17.N other bump:2.87382 Ang I5.CD1 and L16.C other bump:2.00721 Ang V10.CG1 and E14.OE2 other bump:2.40763 Ang E11.CA and E14.OE1 other bump:1.64561 Ang V10.O and E14.OE1 other bump:2.29284 Ang V10.C and E14.OE1 other bump:2.41272 Ang V10.O and E14.CD other bump:2.99826 Ang V10.CG1 and E14.CD other bump:3.1113 Ang V10.C and E14.CD other bump:2.66759 Ang I5.CD1 and A13.O T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLR 1gpjA 213 :GEAVRFDELVDHLARSDVVVSATAAPHPVIHVDDVREALRKRD Fragment has 44 clashes (null) has 44 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 45 residues other bump:2.86372 Ang D15.CG and L43.CD2 other bump:2.2607 Ang D15.OD2 and L43.CD2 other bump:2.76557 Ang D15.C and L43.CD1 other bump:1.73614 Ang D15.O and L43.CD1 other bump:2.79188 Ang D15.OD1 and L43.CD1 other bump:2.34312 Ang D15.CG and L43.CG other bump:2.41345 Ang D15.OD2 and L43.CG other bump:2.13139 Ang D15.OD1 and L43.CG other bump:1.94768 Ang D15.OD1 and K39.O other bump:0.500343 Ang L14.O and K39.NZ other bump:2.52873 Ang L14.CA and K39.NZ other bump:1.14865 Ang L14.C and K39.NZ other bump:2.20145 Ang D15.CA and K39.NZ other bump:2.34434 Ang D15.C and K39.NZ other bump:1.87788 Ang D15.N and K39.NZ other bump:2.89342 Ang D13.C and K39.CE other bump:2.22774 Ang L14.N and K39.CE other bump:1.51092 Ang L14.O and K39.CE other bump:1.18933 Ang L14.CA and K39.CE other bump:2.11486 Ang L14.CB and K39.CE other bump:0.373084 Ang L14.C and K39.CE other bump:2.63342 Ang D15.CA and K39.CE other bump:1.44807 Ang D15.N and K39.CE other bump:3.02821 Ang L14.CG and K39.CD other bump:2.51902 Ang L14.O and K39.CD other bump:1.94455 Ang L14.CA and K39.CD other bump:1.51814 Ang L14.CB and K39.CD other bump:1.75693 Ang L14.C and K39.CD other bump:3.0843 Ang D15.CA and K39.CD other bump:2.10043 Ang D15.N and K39.CD other bump:2.9058 Ang L14.CB and K39.CG other bump:2.58549 Ang L14.C and K39.CG other bump:2.49827 Ang D15.CA and K39.CG other bump:2.11939 Ang D15.N and K39.CG other bump:3.04697 Ang D15.CB and K39.CG other bump:1.67603 Ang I32.O and P36.CD other bump:2.89863 Ang I32.C and P36.CD other bump:3.08794 Ang D33.C and P36.CD other bump:2.47197 Ang I32.O and P36.CG self-bump: 1.39825 Ang D33.CA and D33.CB other bump:2.45711 Ang D13.O and V17.CG2 other bump:2.68119 Ang V5.CG2 and D13.OD2 other bump:2.80762 Ang G9.C and D13.OD1 other bump:2.0717 Ang G9.O and D13.OD1 T0191 117 :EDMVVMDLIYNPLETVLLKEAKKVNAKTINGLGMLIYQGAVAFK 1gpjA 258 :SPILIIDIANPRDVEEGVENIEDVEVRTIDDLRVIARENLERRR Fragment has 22 clashes (null) has 22 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 45 residues other bump:2.83524 Ang M7.SD and L33.CD1 other bump:2.96977 Ang K20.CG and A27.CB neighbor-bump: 2.17254 Ang V17.O and L18.CB neighbor-bump: 2.59256 Ang V17.C and L18.CB other bump:1.52281 Ang V6.CG2 and E15.OE2 other bump:2.68992 Ang V6.CB and E15.OE2 other bump:2.32514 Ang V6.CG2 and E15.CD other bump:2.77381 Ang I10.CG1 and L14.CD2 other bump:1.65862 Ang I10.CD1 and L14.CD2 other bump:2.57874 Ang I10.CG2 and L14.CD1 other bump:2.87153 Ang I10.CB and L14.CG other bump:2.00364 Ang I10.CG1 and L14.CG other bump:2.74877 Ang I10.CG2 and L14.CG other bump:1.505 Ang I10.CD1 and L14.CG other bump:2.79244 Ang I10.CG1 and L14.CB other bump:2.19287 Ang I10.CD1 and L14.CB other bump:3.09048 Ang I10.CG1 and L14.CA other bump:2.23387 Ang I10.CD1 and L14.CA other bump:2.55671 Ang I10.CG1 and L14.N other bump:2.30715 Ang I10.CD1 and L14.N other bump:2.96953 Ang I10.CD1 and P13.C other bump:2.76002 Ang M7.CE and L9.CD1 Number of specific fragments= 6 total=6 Number of alignments=1 # Reading fragments from alignment file # T0191 read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1gpjA/T0191-1gpjA-2track-protein-STR-global-adpstyle5.pw.a2m.gz # 1gpjA read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1gpjA/T0191-1gpjA-2track-protein-STR-global-adpstyle5.pw.a2m.gz # found chain 1gpjA in template set T0191 1 :I 1gpjA 1 :M Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 2 residues T0191 2 :GYNTDGIGARMALEEEIGRVKDKNIVIYGAGGAARAVAFELAK 1gpjA 146 :GAVSIGSAAVELAERELGSLHDKTVLVVGAGEMGKTVAKSLVD Fragment has 76 clashes (null) has 76 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 45 residues other bump:2.32562 Ang L14.CD1 and L42.CD2 other bump:2.26175 Ang R11.NH1 and E41.C other bump:2.70446 Ang R11.CD and E41.O other bump:2.20049 Ang R11.NH1 and E41.O other bump:1.16878 Ang A37.O and E41.OE1 other bump:2.12325 Ang A37.C and E41.OE1 other bump:2.71002 Ang V38.CA and E41.OE1 other bump:3.06491 Ang G7.CA and E41.CD other bump:2.03305 Ang A37.O and E41.CD other bump:2.97567 Ang A37.C and E41.CD other bump:3.08232 Ang G7.CA and E41.CG other bump:3.24563 Ang G7.C and E41.CG other bump:2.83406 Ang R11.CZ and E41.CB other bump:1.98869 Ang R11.NH1 and E41.CB other bump:1.91041 Ang R11.NH1 and E41.CA other bump:2.71694 Ang Y3.CB and M12.SD other bump:1.83398 Ang I8.CD1 and R11.NH2 other bump:2.88577 Ang Y3.CG and G9.CA other bump:2.27855 Ang Y3.CD2 and G9.CA other bump:2.62641 Ang Y3.CE2 and G9.CA other bump:2.49919 Ang Y3.CD1 and G9.N other bump:2.16413 Ang Y3.CG and G9.N other bump:1.652 Ang Y3.CD2 and G9.N other bump:1.55884 Ang Y3.CE2 and G9.N other bump:2.44228 Ang Y3.CE1 and G9.N other bump:2.00811 Ang Y3.CZ and G9.N other bump:1.75321 Ang Y3.CD1 and I8.C other bump:2.1123 Ang Y3.CG and I8.C other bump:2.42046 Ang Y3.CD2 and I8.C other bump:2.44556 Ang Y3.CE2 and I8.C other bump:3.29349 Ang Y3.CB and I8.C other bump:1.78431 Ang Y3.CE1 and I8.C other bump:2.14011 Ang Y3.CZ and I8.C other bump:2.31189 Ang Y3.CD1 and I8.O other bump:2.61852 Ang Y3.CG and I8.O other bump:3.14929 Ang Y3.CA and I8.CG2 other bump:1.35201 Ang Y3.CD1 and I8.CG2 other bump:2.30031 Ang Y3.CG and I8.CG2 other bump:2.78818 Ang Y3.CB and I8.CG2 other bump:2.34648 Ang Y3.CE1 and I8.CG2 other bump:2.74217 Ang Y3.CD1 and I8.CG1 other bump:2.23779 Ang Y3.CE1 and I8.CG1 other bump:1.23883 Ang Y3.CD1 and I8.CB other bump:2.40368 Ang Y3.CG and I8.CB other bump:3.10444 Ang Y3.CD2 and I8.CB other bump:3.069 Ang Y3.CE2 and I8.CB other bump:1.12483 Ang Y3.CE1 and I8.CB other bump:2.26274 Ang Y3.CZ and I8.CB other bump:1.62932 Ang Y3.CD1 and I8.CA other bump:2.71932 Ang Y3.CG and I8.CA other bump:3.12305 Ang Y3.CD2 and I8.CA other bump:2.75622 Ang Y3.CE2 and I8.CA other bump:2.512 Ang Y3.OH and I8.CA other bump:0.665591 Ang Y3.CE1 and I8.CA other bump:1.68541 Ang Y3.CZ and I8.CA other bump:2.83655 Ang Y3.CD1 and I8.N other bump:2.57477 Ang Y3.CE2 and I8.N other bump:1.15168 Ang Y3.OH and I8.N other bump:1.48594 Ang Y3.CE1 and I8.N other bump:1.20467 Ang Y3.CZ and I8.N other bump:3.2778 Ang Y3.CE2 and G7.C other bump:1.5461 Ang Y3.OH and G7.C other bump:2.68496 Ang Y3.CE1 and G7.C other bump:2.19595 Ang Y3.CZ and G7.C other bump:1.81848 Ang Y3.OH and G7.CA other bump:3.05225 Ang Y3.CZ and G7.CA other bump:1.8189 Ang Y3.OH and G7.N other bump:2.96188 Ang Y3.CZ and G7.N other bump:3.11491 Ang Y3.CE2 and D6.C other bump:2.54751 Ang Y3.OH and D6.C other bump:3.21493 Ang Y3.CZ and D6.C other bump:2.49392 Ang Y3.CE2 and T5.C other bump:3.13648 Ang Y3.CZ and T5.C other bump:2.21115 Ang Y3.CD2 and T5.O other bump:1.32678 Ang Y3.CE2 and T5.O other bump:2.27616 Ang Y3.CZ and T5.O T0191 45 :DN 1gpjA 190 :GV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues T0191 47 :NIIIANRTVEKAEALAKEIA 1gpjA 193 :AVLVANRTYERAVELARDLG Fragment has 19 clashes (null) has 19 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 22 residues other bump:3.28619 Ang I3.CG1 and G22.CA neighbor-bump: 2.2506 Ang I20.O and A21.CB neighbor-bump: 2.53375 Ang I20.C and A21.CB other bump:1.44539 Ang I3.CD1 and I20.CG2 other bump:2.89365 Ang I3.CG1 and I20.CG2 other bump:2.80691 Ang I3.CD1 and I20.CB other bump:2.49571 Ang I5.CD1 and A17.CB other bump:2.9766 Ang I5.CG1 and A17.CB other bump:2.28293 Ang I5.CD1 and A17.CA other bump:1.97413 Ang I5.CD1 and A17.N other bump:2.87382 Ang I5.CD1 and L16.C other bump:2.00721 Ang V10.CG1 and E14.OE2 other bump:2.40763 Ang E11.CA and E14.OE1 other bump:1.64561 Ang V10.O and E14.OE1 other bump:2.29284 Ang V10.C and E14.OE1 other bump:2.41272 Ang V10.O and E14.CD other bump:2.99826 Ang V10.CG1 and E14.CD other bump:3.1113 Ang V10.C and E14.CD other bump:2.66759 Ang I5.CD1 and A13.O T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLR 1gpjA 213 :GEAVRFDELVDHLARSDVVVSATAAPHPVIHVDDVREALRKRD Fragment has 44 clashes (null) has 44 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 45 residues other bump:2.86372 Ang D15.CG and L43.CD2 other bump:2.2607 Ang D15.OD2 and L43.CD2 other bump:2.76557 Ang D15.C and L43.CD1 other bump:1.73614 Ang D15.O and L43.CD1 other bump:2.79188 Ang D15.OD1 and L43.CD1 other bump:2.34312 Ang D15.CG and L43.CG other bump:2.41345 Ang D15.OD2 and L43.CG other bump:2.13139 Ang D15.OD1 and L43.CG other bump:1.94768 Ang D15.OD1 and K39.O other bump:0.500343 Ang L14.O and K39.NZ other bump:2.52873 Ang L14.CA and K39.NZ other bump:1.14865 Ang L14.C and K39.NZ other bump:2.20145 Ang D15.CA and K39.NZ other bump:2.34434 Ang D15.C and K39.NZ other bump:1.87788 Ang D15.N and K39.NZ other bump:2.89342 Ang D13.C and K39.CE other bump:2.22774 Ang L14.N and K39.CE other bump:1.51092 Ang L14.O and K39.CE other bump:1.18933 Ang L14.CA and K39.CE other bump:2.11486 Ang L14.CB and K39.CE other bump:0.373084 Ang L14.C and K39.CE other bump:2.63342 Ang D15.CA and K39.CE other bump:1.44807 Ang D15.N and K39.CE other bump:3.02821 Ang L14.CG and K39.CD other bump:2.51902 Ang L14.O and K39.CD other bump:1.94455 Ang L14.CA and K39.CD other bump:1.51814 Ang L14.CB and K39.CD other bump:1.75693 Ang L14.C and K39.CD other bump:3.0843 Ang D15.CA and K39.CD other bump:2.10043 Ang D15.N and K39.CD other bump:2.9058 Ang L14.CB and K39.CG other bump:2.58549 Ang L14.C and K39.CG other bump:2.49827 Ang D15.CA and K39.CG other bump:2.11939 Ang D15.N and K39.CG other bump:3.04697 Ang D15.CB and K39.CG other bump:1.67603 Ang I32.O and P36.CD other bump:2.89863 Ang I32.C and P36.CD other bump:3.08794 Ang D33.C and P36.CD other bump:2.47197 Ang I32.O and P36.CG self-bump: 1.39825 Ang D33.CA and D33.CB other bump:2.45711 Ang D13.O and V17.CG2 other bump:2.68119 Ang V5.CG2 and D13.OD2 other bump:2.80762 Ang G9.C and D13.OD1 other bump:2.0717 Ang G9.O and D13.OD1 T0191 117 :EDMVVMDLIYNPLETVLLKEAKKVNAKTINGLGMLIYQGAVAFK 1gpjA 258 :SPILIIDIANPRDVEEGVENIEDVEVRTIDDLRVIARENLERRR Fragment has 22 clashes (null) has 22 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 45 residues other bump:2.83524 Ang M7.SD and L33.CD1 other bump:2.96977 Ang K20.CG and A27.CB neighbor-bump: 2.17254 Ang V17.O and L18.CB neighbor-bump: 2.59256 Ang V17.C and L18.CB other bump:1.52281 Ang V6.CG2 and E15.OE2 other bump:2.68992 Ang V6.CB and E15.OE2 other bump:2.32514 Ang V6.CG2 and E15.CD other bump:2.77381 Ang I10.CG1 and L14.CD2 other bump:1.65862 Ang I10.CD1 and L14.CD2 other bump:2.57874 Ang I10.CG2 and L14.CD1 other bump:2.87153 Ang I10.CB and L14.CG other bump:2.00364 Ang I10.CG1 and L14.CG other bump:2.74877 Ang I10.CG2 and L14.CG other bump:1.505 Ang I10.CD1 and L14.CG other bump:2.79244 Ang I10.CG1 and L14.CB other bump:2.19287 Ang I10.CD1 and L14.CB other bump:3.09048 Ang I10.CG1 and L14.CA other bump:2.23387 Ang I10.CD1 and L14.CA other bump:2.55671 Ang I10.CG1 and L14.N other bump:2.30715 Ang I10.CD1 and L14.N other bump:2.96953 Ang I10.CD1 and P13.C other bump:2.76002 Ang M7.CE and L9.CD1 Number of specific fragments= 6 total=12 Number of alignments=2 # Reading fragments from alignment file # T0191 read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1gpjA/T0191-1gpjA-2track-protein-STR-local-adpstyle5.pw.a2m.gz # 1gpjA read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1gpjA/T0191-1gpjA-2track-protein-STR-local-adpstyle5.pw.a2m.gz # found chain 1gpjA in template set T0191 1 :IGYNTDGIGARMALEEEIGRVKDKNIVIYGAGGAARAVAFELAK 1gpjA 145 :EGAVSIGSAAVELAERELGSLHDKTVLVVGAGEMGKTVAKSLVD Fragment has 76 clashes (null) has 76 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 45 residues other bump:2.32562 Ang L14.CD1 and L42.CD2 other bump:2.26175 Ang R11.NH1 and E41.C other bump:2.70446 Ang R11.CD and E41.O other bump:2.20049 Ang R11.NH1 and E41.O other bump:1.16878 Ang A37.O and E41.OE1 other bump:2.12325 Ang A37.C and E41.OE1 other bump:2.71002 Ang V38.CA and E41.OE1 other bump:3.06491 Ang G7.CA and E41.CD other bump:2.03305 Ang A37.O and E41.CD other bump:2.97567 Ang A37.C and E41.CD other bump:3.08232 Ang G7.CA and E41.CG other bump:3.24563 Ang G7.C and E41.CG other bump:2.83406 Ang R11.CZ and E41.CB other bump:1.98869 Ang R11.NH1 and E41.CB other bump:1.91041 Ang R11.NH1 and E41.CA other bump:2.71694 Ang Y3.CB and M12.SD other bump:1.83398 Ang I8.CD1 and R11.NH2 other bump:2.88577 Ang Y3.CG and G9.CA other bump:2.27855 Ang Y3.CD2 and G9.CA other bump:2.62641 Ang Y3.CE2 and G9.CA other bump:2.16413 Ang Y3.CG and G9.N other bump:1.652 Ang Y3.CD2 and G9.N other bump:2.49919 Ang Y3.CD1 and G9.N other bump:2.44228 Ang Y3.CE1 and G9.N other bump:1.55884 Ang Y3.CE2 and G9.N other bump:2.00811 Ang Y3.CZ and G9.N other bump:2.1123 Ang Y3.CG and I8.C other bump:2.42046 Ang Y3.CD2 and I8.C other bump:3.29349 Ang Y3.CB and I8.C other bump:1.75321 Ang Y3.CD1 and I8.C other bump:1.78431 Ang Y3.CE1 and I8.C other bump:2.44556 Ang Y3.CE2 and I8.C other bump:2.14011 Ang Y3.CZ and I8.C other bump:2.61852 Ang Y3.CG and I8.O other bump:2.31189 Ang Y3.CD1 and I8.O other bump:3.14929 Ang Y3.CA and I8.CG2 other bump:2.30031 Ang Y3.CG and I8.CG2 other bump:2.78818 Ang Y3.CB and I8.CG2 other bump:1.35201 Ang Y3.CD1 and I8.CG2 other bump:2.34648 Ang Y3.CE1 and I8.CG2 other bump:2.74217 Ang Y3.CD1 and I8.CG1 other bump:2.23779 Ang Y3.CE1 and I8.CG1 other bump:2.40368 Ang Y3.CG and I8.CB other bump:3.10444 Ang Y3.CD2 and I8.CB other bump:1.23883 Ang Y3.CD1 and I8.CB other bump:1.12483 Ang Y3.CE1 and I8.CB other bump:3.069 Ang Y3.CE2 and I8.CB other bump:2.26274 Ang Y3.CZ and I8.CB other bump:2.71932 Ang Y3.CG and I8.CA other bump:3.12305 Ang Y3.CD2 and I8.CA other bump:2.512 Ang Y3.OH and I8.CA other bump:1.62932 Ang Y3.CD1 and I8.CA other bump:0.665591 Ang Y3.CE1 and I8.CA other bump:2.75622 Ang Y3.CE2 and I8.CA other bump:1.68541 Ang Y3.CZ and I8.CA other bump:1.15168 Ang Y3.OH and I8.N other bump:2.83655 Ang Y3.CD1 and I8.N other bump:1.48594 Ang Y3.CE1 and I8.N other bump:2.57477 Ang Y3.CE2 and I8.N other bump:1.20467 Ang Y3.CZ and I8.N other bump:1.5461 Ang Y3.OH and G7.C other bump:2.68496 Ang Y3.CE1 and G7.C other bump:3.2778 Ang Y3.CE2 and G7.C other bump:2.19595 Ang Y3.CZ and G7.C other bump:1.81848 Ang Y3.OH and G7.CA other bump:3.05225 Ang Y3.CZ and G7.CA other bump:1.8189 Ang Y3.OH and G7.N other bump:2.96188 Ang Y3.CZ and G7.N other bump:2.54751 Ang Y3.OH and D6.C other bump:3.11491 Ang Y3.CE2 and D6.C other bump:3.21493 Ang Y3.CZ and D6.C other bump:2.49392 Ang Y3.CE2 and T5.C other bump:3.13648 Ang Y3.CZ and T5.C other bump:2.21115 Ang Y3.CD2 and T5.O other bump:1.32678 Ang Y3.CE2 and T5.O other bump:2.27616 Ang Y3.CZ and T5.O T0191 45 :DN 1gpjA 190 :GV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues T0191 47 :NIIIANRTVEKAEALAKEIA 1gpjA 193 :AVLVANRTYERAVELARDLG Fragment has 19 clashes (null) has 19 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 22 residues other bump:3.28619 Ang I3.CG1 and G22.CA neighbor-bump: 2.2506 Ang I20.O and A21.CB neighbor-bump: 2.53375 Ang I20.C and A21.CB other bump:1.44539 Ang I3.CD1 and I20.CG2 other bump:2.89365 Ang I3.CG1 and I20.CG2 other bump:2.80691 Ang I3.CD1 and I20.CB other bump:2.49571 Ang I5.CD1 and A17.CB other bump:2.9766 Ang I5.CG1 and A17.CB other bump:2.28293 Ang I5.CD1 and A17.CA other bump:1.97413 Ang I5.CD1 and A17.N other bump:2.87382 Ang I5.CD1 and L16.C other bump:2.00721 Ang V10.CG1 and E14.OE2 other bump:2.40763 Ang E11.CA and E14.OE1 other bump:1.64561 Ang V10.O and E14.OE1 other bump:2.29284 Ang V10.C and E14.OE1 other bump:2.41272 Ang V10.O and E14.CD other bump:2.99826 Ang V10.CG1 and E14.CD other bump:3.1113 Ang V10.C and E14.CD other bump:2.66759 Ang I5.CD1 and A13.O T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLR 1gpjA 213 :GEAVRFDELVDHLARSDVVVSATAAPHPVIHVDDVREALRKRD Fragment has 44 clashes (null) has 44 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 45 residues other bump:2.86372 Ang D15.CG and L43.CD2 other bump:2.2607 Ang D15.OD2 and L43.CD2 other bump:2.76557 Ang D15.C and L43.CD1 other bump:1.73614 Ang D15.O and L43.CD1 other bump:2.79188 Ang D15.OD1 and L43.CD1 other bump:2.34312 Ang D15.CG and L43.CG other bump:2.41345 Ang D15.OD2 and L43.CG other bump:2.13139 Ang D15.OD1 and L43.CG other bump:1.94768 Ang D15.OD1 and K39.O other bump:0.500343 Ang L14.O and K39.NZ other bump:2.52873 Ang L14.CA and K39.NZ other bump:1.14865 Ang L14.C and K39.NZ other bump:2.20145 Ang D15.CA and K39.NZ other bump:2.34434 Ang D15.C and K39.NZ other bump:1.87788 Ang D15.N and K39.NZ other bump:2.89342 Ang D13.C and K39.CE other bump:2.22774 Ang L14.N and K39.CE other bump:1.51092 Ang L14.O and K39.CE other bump:1.18933 Ang L14.CA and K39.CE other bump:2.11486 Ang L14.CB and K39.CE other bump:0.373084 Ang L14.C and K39.CE other bump:2.63342 Ang D15.CA and K39.CE other bump:1.44807 Ang D15.N and K39.CE other bump:3.02821 Ang L14.CG and K39.CD other bump:2.51902 Ang L14.O and K39.CD other bump:1.94455 Ang L14.CA and K39.CD other bump:1.51814 Ang L14.CB and K39.CD other bump:1.75693 Ang L14.C and K39.CD other bump:3.0843 Ang D15.CA and K39.CD other bump:2.10043 Ang D15.N and K39.CD other bump:2.9058 Ang L14.CB and K39.CG other bump:2.58549 Ang L14.C and K39.CG other bump:2.49827 Ang D15.CA and K39.CG other bump:2.11939 Ang D15.N and K39.CG other bump:3.04697 Ang D15.CB and K39.CG other bump:1.67603 Ang I32.O and P36.CD other bump:2.89863 Ang I32.C and P36.CD other bump:3.08794 Ang D33.C and P36.CD other bump:2.47197 Ang I32.O and P36.CG self-bump: 1.39825 Ang D33.CA and D33.CB other bump:2.45711 Ang D13.O and V17.CG2 other bump:2.68119 Ang V5.CG2 and D13.OD2 other bump:2.80762 Ang G9.C and D13.OD1 other bump:2.0717 Ang G9.O and D13.OD1 T0191 117 :EDMVVMDLIYNPLETVLLKEAKKVNAKTINGLGMLIYQGAVAF 1gpjA 258 :SPILIIDIANPRDVEEGVENIEDVEVRTIDDLRVIARENLERR Fragment has 22 clashes (null) has 22 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 45 residues other bump:2.83524 Ang M7.SD and L33.CD1 other bump:2.96977 Ang K20.CG and A27.CB neighbor-bump: 2.17254 Ang V17.O and L18.CB neighbor-bump: 2.59256 Ang V17.C and L18.CB other bump:1.52281 Ang V6.CG2 and E15.OE2 other bump:2.68992 Ang V6.CB and E15.OE2 other bump:2.32514 Ang V6.CG2 and E15.CD other bump:2.77381 Ang I10.CG1 and L14.CD2 other bump:1.65862 Ang I10.CD1 and L14.CD2 other bump:2.57874 Ang I10.CG2 and L14.CD1 other bump:2.87153 Ang I10.CB and L14.CG other bump:2.00364 Ang I10.CG1 and L14.CG other bump:2.74877 Ang I10.CG2 and L14.CG other bump:1.505 Ang I10.CD1 and L14.CG other bump:2.79244 Ang I10.CG1 and L14.CB other bump:2.19287 Ang I10.CD1 and L14.CB other bump:3.09048 Ang I10.CG1 and L14.CA other bump:2.23387 Ang I10.CD1 and L14.CA other bump:2.55671 Ang I10.CG1 and L14.N other bump:2.30715 Ang I10.CD1 and L14.N other bump:2.96953 Ang I10.CD1 and P13.C other bump:2.76002 Ang M7.CE and L9.CD1 Number of specific fragments= 5 total=17 Number of alignments=3 # Reading fragments from alignment file # T0191 read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1gpjA/T0191-1gpjA-2track-protein-STR-local-adpstyle1.pw.a2m.gz # 1gpjA read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1gpjA/T0191-1gpjA-2track-protein-STR-local-adpstyle1.pw.a2m.gz # found chain 1gpjA in template set T0191 1 :IGYNTDGIGARMALEEEIGRVKDKNIVIYGAGGAARAVAFELAK 1gpjA 145 :EGAVSIGSAAVELAERELGSLHDKTVLVVGAGEMGKTVAKSLVD Fragment has 76 clashes (null) has 76 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 45 residues other bump:2.32562 Ang L14.CD1 and L42.CD2 other bump:2.26175 Ang R11.NH1 and E41.C other bump:2.70446 Ang R11.CD and E41.O other bump:2.20049 Ang R11.NH1 and E41.O other bump:1.16878 Ang A37.O and E41.OE1 other bump:2.12325 Ang A37.C and E41.OE1 other bump:2.71002 Ang V38.CA and E41.OE1 other bump:3.06491 Ang G7.CA and E41.CD other bump:2.03305 Ang A37.O and E41.CD other bump:2.97567 Ang A37.C and E41.CD other bump:3.08232 Ang G7.CA and E41.CG other bump:3.24563 Ang G7.C and E41.CG other bump:2.83406 Ang R11.CZ and E41.CB other bump:1.98869 Ang R11.NH1 and E41.CB other bump:1.91041 Ang R11.NH1 and E41.CA other bump:2.71694 Ang Y3.CB and M12.SD other bump:1.83398 Ang I8.CD1 and R11.NH2 other bump:2.88577 Ang Y3.CG and G9.CA other bump:2.27855 Ang Y3.CD2 and G9.CA other bump:2.62641 Ang Y3.CE2 and G9.CA other bump:2.16413 Ang Y3.CG and G9.N other bump:1.652 Ang Y3.CD2 and G9.N other bump:2.49919 Ang Y3.CD1 and G9.N other bump:2.44228 Ang Y3.CE1 and G9.N other bump:1.55884 Ang Y3.CE2 and G9.N other bump:2.00811 Ang Y3.CZ and G9.N other bump:2.1123 Ang Y3.CG and I8.C other bump:2.42046 Ang Y3.CD2 and I8.C other bump:3.29349 Ang Y3.CB and I8.C other bump:1.75321 Ang Y3.CD1 and I8.C other bump:1.78431 Ang Y3.CE1 and I8.C other bump:2.44556 Ang Y3.CE2 and I8.C other bump:2.14011 Ang Y3.CZ and I8.C other bump:2.61852 Ang Y3.CG and I8.O other bump:2.31189 Ang Y3.CD1 and I8.O other bump:3.14929 Ang Y3.CA and I8.CG2 other bump:2.30031 Ang Y3.CG and I8.CG2 other bump:2.78818 Ang Y3.CB and I8.CG2 other bump:1.35201 Ang Y3.CD1 and I8.CG2 other bump:2.34648 Ang Y3.CE1 and I8.CG2 other bump:2.74217 Ang Y3.CD1 and I8.CG1 other bump:2.23779 Ang Y3.CE1 and I8.CG1 other bump:2.40368 Ang Y3.CG and I8.CB other bump:3.10444 Ang Y3.CD2 and I8.CB other bump:1.23883 Ang Y3.CD1 and I8.CB other bump:1.12483 Ang Y3.CE1 and I8.CB other bump:3.069 Ang Y3.CE2 and I8.CB other bump:2.26274 Ang Y3.CZ and I8.CB other bump:2.71932 Ang Y3.CG and I8.CA other bump:3.12305 Ang Y3.CD2 and I8.CA other bump:2.512 Ang Y3.OH and I8.CA other bump:1.62932 Ang Y3.CD1 and I8.CA other bump:0.665591 Ang Y3.CE1 and I8.CA other bump:2.75622 Ang Y3.CE2 and I8.CA other bump:1.68541 Ang Y3.CZ and I8.CA other bump:1.15168 Ang Y3.OH and I8.N other bump:2.83655 Ang Y3.CD1 and I8.N other bump:1.48594 Ang Y3.CE1 and I8.N other bump:2.57477 Ang Y3.CE2 and I8.N other bump:1.20467 Ang Y3.CZ and I8.N other bump:1.5461 Ang Y3.OH and G7.C other bump:2.68496 Ang Y3.CE1 and G7.C other bump:3.2778 Ang Y3.CE2 and G7.C other bump:2.19595 Ang Y3.CZ and G7.C other bump:1.81848 Ang Y3.OH and G7.CA other bump:3.05225 Ang Y3.CZ and G7.CA other bump:1.8189 Ang Y3.OH and G7.N other bump:2.96188 Ang Y3.CZ and G7.N other bump:2.54751 Ang Y3.OH and D6.C other bump:3.11491 Ang Y3.CE2 and D6.C other bump:3.21493 Ang Y3.CZ and D6.C other bump:2.49392 Ang Y3.CE2 and T5.C other bump:3.13648 Ang Y3.CZ and T5.C other bump:2.21115 Ang Y3.CD2 and T5.O other bump:1.32678 Ang Y3.CE2 and T5.O other bump:2.27616 Ang Y3.CZ and T5.O T0191 45 :DN 1gpjA 190 :GV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues T0191 47 :NIIIANRTVEKAEALAKEIA 1gpjA 193 :AVLVANRTYERAVELARDLG Fragment has 19 clashes (null) has 19 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 22 residues other bump:3.28619 Ang I3.CG1 and G22.CA neighbor-bump: 2.2506 Ang I20.O and A21.CB neighbor-bump: 2.53375 Ang I20.C and A21.CB other bump:1.44539 Ang I3.CD1 and I20.CG2 other bump:2.89365 Ang I3.CG1 and I20.CG2 other bump:2.80691 Ang I3.CD1 and I20.CB other bump:2.49571 Ang I5.CD1 and A17.CB other bump:2.9766 Ang I5.CG1 and A17.CB other bump:2.28293 Ang I5.CD1 and A17.CA other bump:1.97413 Ang I5.CD1 and A17.N other bump:2.87382 Ang I5.CD1 and L16.C other bump:2.00721 Ang V10.CG1 and E14.OE2 other bump:2.40763 Ang E11.CA and E14.OE1 other bump:1.64561 Ang V10.O and E14.OE1 other bump:2.29284 Ang V10.C and E14.OE1 other bump:2.41272 Ang V10.O and E14.CD other bump:2.99826 Ang V10.CG1 and E14.CD other bump:3.1113 Ang V10.C and E14.CD other bump:2.66759 Ang I5.CD1 and A13.O T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLR 1gpjA 213 :GEAVRFDELVDHLARSDVVVSATAAPHPVIHVDDVREALRKRD Fragment has 44 clashes (null) has 44 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 45 residues other bump:2.86372 Ang D15.CG and L43.CD2 other bump:2.2607 Ang D15.OD2 and L43.CD2 other bump:2.76557 Ang D15.C and L43.CD1 other bump:1.73614 Ang D15.O and L43.CD1 other bump:2.79188 Ang D15.OD1 and L43.CD1 other bump:2.34312 Ang D15.CG and L43.CG other bump:2.41345 Ang D15.OD2 and L43.CG other bump:2.13139 Ang D15.OD1 and L43.CG other bump:1.94768 Ang D15.OD1 and K39.O other bump:0.500343 Ang L14.O and K39.NZ other bump:2.52873 Ang L14.CA and K39.NZ other bump:1.14865 Ang L14.C and K39.NZ other bump:2.20145 Ang D15.CA and K39.NZ other bump:2.34434 Ang D15.C and K39.NZ other bump:1.87788 Ang D15.N and K39.NZ other bump:2.89342 Ang D13.C and K39.CE other bump:2.22774 Ang L14.N and K39.CE other bump:1.51092 Ang L14.O and K39.CE other bump:1.18933 Ang L14.CA and K39.CE other bump:2.11486 Ang L14.CB and K39.CE other bump:0.373084 Ang L14.C and K39.CE other bump:2.63342 Ang D15.CA and K39.CE other bump:1.44807 Ang D15.N and K39.CE other bump:3.02821 Ang L14.CG and K39.CD other bump:2.51902 Ang L14.O and K39.CD other bump:1.94455 Ang L14.CA and K39.CD other bump:1.51814 Ang L14.CB and K39.CD other bump:1.75693 Ang L14.C and K39.CD other bump:3.0843 Ang D15.CA and K39.CD other bump:2.10043 Ang D15.N and K39.CD other bump:2.9058 Ang L14.CB and K39.CG other bump:2.58549 Ang L14.C and K39.CG other bump:2.49827 Ang D15.CA and K39.CG other bump:2.11939 Ang D15.N and K39.CG other bump:3.04697 Ang D15.CB and K39.CG other bump:1.67603 Ang I32.O and P36.CD other bump:2.89863 Ang I32.C and P36.CD other bump:3.08794 Ang D33.C and P36.CD other bump:2.47197 Ang I32.O and P36.CG self-bump: 1.39825 Ang D33.CA and D33.CB other bump:2.45711 Ang D13.O and V17.CG2 other bump:2.68119 Ang V5.CG2 and D13.OD2 other bump:2.80762 Ang G9.C and D13.OD1 other bump:2.0717 Ang G9.O and D13.OD1 T0191 117 :EDMVVMDLIYNPLETVLLKEAKKVNAKTINGLGMLIYQGAVAF 1gpjA 258 :SPILIIDIANPRDVEEGVENIEDVEVRTIDDLRVIARENLERR Fragment has 22 clashes (null) has 22 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 45 residues other bump:2.83524 Ang M7.SD and L33.CD1 other bump:2.96977 Ang K20.CG and A27.CB neighbor-bump: 2.17254 Ang V17.O and L18.CB neighbor-bump: 2.59256 Ang V17.C and L18.CB other bump:1.52281 Ang V6.CG2 and E15.OE2 other bump:2.68992 Ang V6.CB and E15.OE2 other bump:2.32514 Ang V6.CG2 and E15.CD other bump:2.77381 Ang I10.CG1 and L14.CD2 other bump:1.65862 Ang I10.CD1 and L14.CD2 other bump:2.57874 Ang I10.CG2 and L14.CD1 other bump:2.87153 Ang I10.CB and L14.CG other bump:2.00364 Ang I10.CG1 and L14.CG other bump:2.74877 Ang I10.CG2 and L14.CG other bump:1.505 Ang I10.CD1 and L14.CG other bump:2.79244 Ang I10.CG1 and L14.CB other bump:2.19287 Ang I10.CD1 and L14.CB other bump:3.09048 Ang I10.CG1 and L14.CA other bump:2.23387 Ang I10.CD1 and L14.CA other bump:2.55671 Ang I10.CG1 and L14.N other bump:2.30715 Ang I10.CD1 and L14.N other bump:2.96953 Ang I10.CD1 and P13.C other bump:2.76002 Ang M7.CE and L9.CD1 Number of specific fragments= 5 total=22 Number of alignments=4 # Reading fragments from alignment file # T0191 read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1ff9A/T0191-1ff9A-2track-protein-STR-global-adpstyle5.pw.a2m.gz # 1ff9A read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1ff9A/T0191-1ff9A-2track-protein-STR-global-adpstyle5.pw.a2m.gz # adding 1ff9A to template set 1ff9A:# found chain 1ff9A in template set T0191 23 :DKNIVIYGAGGAARAVAFELAK 1ff9A 3 :TKSVLMLGSGFVTRPTLDVLTD Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 24 residues other bump:2.47698 Ang I5.CD1 and L21.CD1 other bump:2.82716 Ang R15.CG and F19.CZ other bump:2.38157 Ang R15.NE and F19.CZ other bump:2.87952 Ang R15.CG and F19.CE2 other bump:2.99735 Ang R15.CD and F19.CE2 other bump:2.27429 Ang R15.NE and F19.CE2 other bump:3.12943 Ang R15.CZ and F19.CE2 other bump:2.44894 Ang V6.CG1 and Y8.OH other bump:2.57918 Ang V6.CG1 and Y8.CZ other bump:2.81169 Ang V6.CG1 and Y8.CE1 T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKK 1ff9A 26 :GIKVTVACRTLESAKKLSAGVQHSTPIS Fragment has 33 clashes (null) has 33 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 30 residues other bump:3.08149 Ang T11.C and K29.CD other bump:2.61092 Ang R10.O and K29.CD other bump:2.96438 Ang T11.CA and K29.CD other bump:2.72308 Ang V12.N and K29.CD other bump:2.85131 Ang V12.N and K29.CG other bump:2.1743 Ang V12.CG2 and K29.CG other bump:2.31532 Ang I7.CG1 and N27.OD1 other bump:2.59361 Ang I7.CD1 and N27.OD1 other bump:2.4925 Ang A19.CB and N27.OD1 other bump:2.5622 Ang A19.CB and N27.ND2 other bump:2.84903 Ang A19.CB and N27.CG other bump:2.50901 Ang A15.O and N27.CG other bump:2.93406 Ang A15.C and N27.CG other bump:2.70886 Ang I7.CB and K25.NZ other bump:1.44641 Ang I7.CG1 and K25.NZ other bump:1.84148 Ang I7.CD1 and K25.NZ other bump:2.44083 Ang A19.CB and K25.NZ other bump:2.59486 Ang I7.CG1 and K25.CE other bump:1.96902 Ang I7.CD1 and K25.CE other bump:2.3557 Ang A19.CA and K25.CE other bump:1.50683 Ang A19.CB and K25.CE other bump:2.579 Ang A19.CA and K25.CD other bump:1.92171 Ang A19.CB and K25.CD other bump:2.50739 Ang E16.O and K20.CG other bump:2.94247 Ang I7.CD1 and A19.CB other bump:2.39144 Ang N9.ND2 and K14.NZ other bump:2.20145 Ang N9.ND2 and K14.CE other bump:1.44098 Ang N9.ND2 and K14.CD other bump:2.27746 Ang N9.CG and K14.CD other bump:2.57192 Ang N9.OD1 and K14.CD other bump:2.17406 Ang N9.ND2 and K14.CG other bump:2.75282 Ang N9.CG and K14.CG other bump:2.80008 Ang N9.CG and K14.CB T0191 74 :GEEVKFSGLDVDLDGVDIIINAT 1ff9A 54 :LDVNDDAALDAEVAKHDLVISLI Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 25 residues other bump:2.58717 Ang V17.CG1 and I19.O neighbor-bump: 2.44145 Ang D18.O and I19.CG2 other bump:2.8004 Ang V17.CG1 and I19.N other bump:2.75038 Ang E4.OE1 and L10.CD1 T0191 101 :YP 1ff9A 81 :HA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues T0191 108 :PIVKAEKLREDMVVMDLIYNPLETVLLKEAKKVNAKTINGL 1ff9A 83 :TVIKSAIRQKKHVVTTSYVSPAMMELDQAAKDAGITVMNEI Fragment has 34 clashes (null) has 34 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 43 residues other bump:3.03577 Ang M16.SD and N40.OD1 other bump:2.11026 Ang Y20.CD1 and N40.ND2 other bump:0.90171 Ang Y20.CE1 and N40.ND2 other bump:3.1025 Ang Y20.CE2 and N40.ND2 other bump:1.83973 Ang Y20.CZ and N40.ND2 other bump:2.3193 Ang Y20.OH and N40.ND2 other bump:2.66217 Ang Y20.CD1 and N40.CG other bump:1.70604 Ang Y20.CE1 and N40.CG other bump:2.6386 Ang Y20.OH and N40.CG other bump:3.03911 Ang Y20.CD1 and N40.CB other bump:2.28734 Ang Y20.CE1 and N40.CB other bump:2.93095 Ang Y20.CE2 and N40.CB other bump:2.21507 Ang Y20.CZ and N40.CB other bump:2.55247 Ang Y20.OH and N40.CB other bump:2.91574 Ang Y20.CZ and N40.CA other bump:2.51191 Ang Y20.OH and N40.CA other bump:2.70621 Ang Y20.CZ and N40.N other bump:1.65958 Ang Y20.OH and N40.N other bump:2.63681 Ang Y20.OH and I39.C other bump:2.6489 Ang K8.NZ and L27.CD2 other bump:2.87968 Ang K8.NZ and L27.CD1 other bump:2.30564 Ang K8.NZ and L27.CG other bump:2.76483 Ang K8.CE and L27.CB other bump:1.42576 Ang K8.NZ and L27.CB other bump:2.4554 Ang K8.NZ and L27.CA other bump:2.54715 Ang P22.O and V26.CG2 other bump:2.88229 Ang M16.CE and L18.CD1 other bump:2.76847 Ang E7.CG and V14.CG2 other bump:2.39354 Ang I3.O and E7.OE2 other bump:0.955899 Ang I3.O and E7.OE1 other bump:1.85571 Ang I3.C and E7.OE1 other bump:2.57732 Ang V4.CA and E7.OE1 other bump:1.86853 Ang I3.O and E7.CD other bump:2.75978 Ang I3.C and E7.CD T0191 149 :G 1ff9A 130 :D Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 3 residues T0191 150 :MLIYQGAV 1ff9A 132 :LYAIKTIE Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 10 residues Number of specific fragments= 7 total=29 Number of alignments=5 # Reading fragments from alignment file # T0191 read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1ff9A/T0191-1ff9A-2track-protein-STR-global-adpstyle1.pw.a2m.gz # 1ff9A read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1ff9A/T0191-1ff9A-2track-protein-STR-global-adpstyle1.pw.a2m.gz # found chain 1ff9A in template set T0191 23 :DKNIVIYGAGGAARAVAFELAK 1ff9A 3 :TKSVLMLGSGFVTRPTLDVLTD Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 24 residues other bump:2.47698 Ang I5.CD1 and L21.CD1 other bump:2.82716 Ang R15.CG and F19.CZ other bump:2.38157 Ang R15.NE and F19.CZ other bump:2.87952 Ang R15.CG and F19.CE2 other bump:2.99735 Ang R15.CD and F19.CE2 other bump:2.27429 Ang R15.NE and F19.CE2 other bump:3.12943 Ang R15.CZ and F19.CE2 other bump:2.44894 Ang V6.CG1 and Y8.OH other bump:2.57918 Ang V6.CG1 and Y8.CZ other bump:2.81169 Ang V6.CG1 and Y8.CE1 T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKK 1ff9A 26 :GIKVTVACRTLESAKKLSAGVQHSTPIS Fragment has 33 clashes (null) has 33 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 30 residues other bump:3.08149 Ang T11.C and K29.CD other bump:2.61092 Ang R10.O and K29.CD other bump:2.96438 Ang T11.CA and K29.CD other bump:2.72308 Ang V12.N and K29.CD other bump:2.85131 Ang V12.N and K29.CG other bump:2.1743 Ang V12.CG2 and K29.CG other bump:2.31532 Ang I7.CG1 and N27.OD1 other bump:2.59361 Ang I7.CD1 and N27.OD1 other bump:2.4925 Ang A19.CB and N27.OD1 other bump:2.5622 Ang A19.CB and N27.ND2 other bump:2.84903 Ang A19.CB and N27.CG other bump:2.50901 Ang A15.O and N27.CG other bump:2.93406 Ang A15.C and N27.CG other bump:2.70886 Ang I7.CB and K25.NZ other bump:1.44641 Ang I7.CG1 and K25.NZ other bump:1.84148 Ang I7.CD1 and K25.NZ other bump:2.44083 Ang A19.CB and K25.NZ other bump:2.59486 Ang I7.CG1 and K25.CE other bump:1.96902 Ang I7.CD1 and K25.CE other bump:2.3557 Ang A19.CA and K25.CE other bump:1.50683 Ang A19.CB and K25.CE other bump:2.579 Ang A19.CA and K25.CD other bump:1.92171 Ang A19.CB and K25.CD other bump:2.50739 Ang E16.O and K20.CG other bump:2.94247 Ang I7.CD1 and A19.CB other bump:2.39144 Ang N9.ND2 and K14.NZ other bump:2.20145 Ang N9.ND2 and K14.CE other bump:1.44098 Ang N9.ND2 and K14.CD other bump:2.27746 Ang N9.CG and K14.CD other bump:2.57192 Ang N9.OD1 and K14.CD other bump:2.17406 Ang N9.ND2 and K14.CG other bump:2.75282 Ang N9.CG and K14.CG other bump:2.80008 Ang N9.CG and K14.CB T0191 74 :GEEVKFSGLDVDLDGVDIIINAT 1ff9A 54 :LDVNDDAALDAEVAKHDLVISLI Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 25 residues other bump:2.58717 Ang V17.CG1 and I19.O neighbor-bump: 2.44145 Ang D18.O and I19.CG2 other bump:2.8004 Ang V17.CG1 and I19.N other bump:2.75038 Ang E4.OE1 and L10.CD1 T0191 101 :YP 1ff9A 81 :HA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues T0191 108 :PIVKAEKLREDMVVMDLIYNPLETVLLKEAKKVNAKTINGL 1ff9A 83 :TVIKSAIRQKKHVVTTSYVSPAMMELDQAAKDAGITVMNEI Fragment has 34 clashes (null) has 34 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 43 residues other bump:3.03577 Ang M16.SD and N40.OD1 other bump:2.11026 Ang Y20.CD1 and N40.ND2 other bump:0.90171 Ang Y20.CE1 and N40.ND2 other bump:3.1025 Ang Y20.CE2 and N40.ND2 other bump:1.83973 Ang Y20.CZ and N40.ND2 other bump:2.3193 Ang Y20.OH and N40.ND2 other bump:2.66217 Ang Y20.CD1 and N40.CG other bump:1.70604 Ang Y20.CE1 and N40.CG other bump:2.6386 Ang Y20.OH and N40.CG other bump:3.03911 Ang Y20.CD1 and N40.CB other bump:2.28734 Ang Y20.CE1 and N40.CB other bump:2.93095 Ang Y20.CE2 and N40.CB other bump:2.21507 Ang Y20.CZ and N40.CB other bump:2.55247 Ang Y20.OH and N40.CB other bump:2.91574 Ang Y20.CZ and N40.CA other bump:2.51191 Ang Y20.OH and N40.CA other bump:2.70621 Ang Y20.CZ and N40.N other bump:1.65958 Ang Y20.OH and N40.N other bump:2.63681 Ang Y20.OH and I39.C other bump:2.6489 Ang K8.NZ and L27.CD2 other bump:2.87968 Ang K8.NZ and L27.CD1 other bump:2.30564 Ang K8.NZ and L27.CG other bump:2.76483 Ang K8.CE and L27.CB other bump:1.42576 Ang K8.NZ and L27.CB other bump:2.4554 Ang K8.NZ and L27.CA other bump:2.54715 Ang P22.O and V26.CG2 other bump:2.88229 Ang M16.CE and L18.CD1 other bump:2.76847 Ang E7.CG and V14.CG2 other bump:2.39354 Ang I3.O and E7.OE2 other bump:0.955899 Ang I3.O and E7.OE1 other bump:1.85571 Ang I3.C and E7.OE1 other bump:2.57732 Ang V4.CA and E7.OE1 other bump:1.86853 Ang I3.O and E7.CD other bump:2.75978 Ang I3.C and E7.CD T0191 149 :GMLIYQGAVAF 1ff9A 131 :HLYAIKTIEEV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 13 residues Number of specific fragments= 6 total=35 Number of alignments=6 # Reading fragments from alignment file # T0191 read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1gegA/T0191-1gegA-2track-protein-STR-global-adpstyle1.pw.a2m.gz # 1gegA read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1gegA/T0191-1gegA-2track-protein-STR-global-adpstyle1.pw.a2m.gz # adding 1gegA to template set 1gegA:# found chain 1gegA in template set T0191 24 :KNIVIYGAG 1gegA 3 :KVALVTGAG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues T0191 33 :GAARAVAFELAK 1gegA 13 :GIGKAIALRLVK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGLDVD 1gegA 26 :GFAVAIADYNDATAKAVASEINQAGGHAVAVKVDVSDRDQV Fragment has 32 clashes (null) has 32 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 43 residues other bump:2.61574 Ang V34.CG2 and V41.CG1 other bump:2.09426 Ang V12.CG1 and E33.OE2 other bump:2.9359 Ang V12.CG1 and E33.CD other bump:1.10458 Ang L18.O and K29.NZ other bump:2.92713 Ang I22.CG1 and K29.NZ other bump:2.43746 Ang A19.N and K29.NZ other bump:2.30579 Ang A19.CA and K29.NZ other bump:2.13947 Ang A19.C and K29.NZ other bump:1.97321 Ang L18.C and K29.NZ other bump:2.51833 Ang I22.CB and K29.CE other bump:2.97804 Ang I22.CG1 and K29.CE other bump:2.01908 Ang A19.CA and K29.CE other bump:1.64907 Ang A19.O and K29.CE other bump:1.91244 Ang A19.C and K29.CE other bump:3.07408 Ang L18.C and K29.CE other bump:3.23272 Ang I22.CG1 and K29.CD other bump:2.81068 Ang I22.CD1 and K29.CD other bump:2.93745 Ang A19.N and K29.CD other bump:2.03154 Ang A19.CA and K29.CD other bump:2.84717 Ang A19.C and K29.CD other bump:2.89385 Ang A19.CB and K29.CD other bump:2.80244 Ang A19.CA and K29.CG other bump:2.92437 Ang A19.CB and K29.CG other bump:2.87953 Ang N4.CG and K28.CD other bump:2.56843 Ang N4.ND2 and K28.CD other bump:2.69794 Ang N4.OD1 and K28.CB other bump:2.78354 Ang I22.CG2 and N27.ND2 other bump:2.83123 Ang I22.CG2 and N27.CG other bump:2.55965 Ang I22.CG2 and N27.CB other bump:2.12886 Ang N9.CG and T11.OG1 other bump:1.26249 Ang N9.OD1 and T11.OG1 other bump:2.40651 Ang N9.OD1 and T11.CB T0191 86 :LDGVDIIINATPIGMYPNIDVEPI 1gegA 77 :LGGFDVIVNNAGVAPSTPIESITP Fragment has 11 clashes (null) has 11 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 26 residues neighbor-bump: 1.99253 Ang Y17.C and P18.CD neighbor-bump: 2.49673 Ang Y17.C and P18.CG other bump:2.01595 Ang A11.O and P13.CD other bump:2.66032 Ang A11.C and P13.CD neighbor-bump: 2.00296 Ang T12.CA and P13.CD neighbor-bump: 1.32553 Ang T12.C and P13.CD neighbor-bump: 2.15168 Ang T12.O and P13.CD other bump:2.23158 Ang A11.O and P13.CG other bump:3.13336 Ang A11.C and P13.CG neighbor-bump: 2.20272 Ang T12.C and P13.CG neighbor-bump: 2.2263 Ang T12.O and P13.CG T0191 135 :KEAKKVNAKTINGLGMLIYQGAVAFK 1gegA 101 :EIVDKVYNINVKGVIWGIQAAVEAFK Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 27 residues other bump:2.94875 Ang N8.OD1 and I12.CD1 Number of specific fragments= 5 total=40 Number of alignments=7 # Reading fragments from alignment file # T0191 read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1gegA/T0191-1gegA-2track-protein-STR-global-adpstyle5.pw.a2m.gz # 1gegA read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1gegA/T0191-1gegA-2track-protein-STR-global-adpstyle5.pw.a2m.gz # found chain 1gegA in template set T0191 24 :KNIVIYGAG 1gegA 3 :KVALVTGAG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues T0191 33 :GAARAVAFELAK 1gegA 13 :GIGKAIALRLVK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGLDVD 1gegA 26 :GFAVAIADYNDATAKAVASEINQAGGHAVAVKVDVSDRDQV Fragment has 32 clashes (null) has 32 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 43 residues other bump:2.61574 Ang V34.CG2 and V41.CG1 other bump:2.09426 Ang V12.CG1 and E33.OE2 other bump:2.9359 Ang V12.CG1 and E33.CD other bump:1.10458 Ang L18.O and K29.NZ other bump:2.92713 Ang I22.CG1 and K29.NZ other bump:2.43746 Ang A19.N and K29.NZ other bump:2.30579 Ang A19.CA and K29.NZ other bump:2.13947 Ang A19.C and K29.NZ other bump:1.97321 Ang L18.C and K29.NZ other bump:2.51833 Ang I22.CB and K29.CE other bump:2.97804 Ang I22.CG1 and K29.CE other bump:2.01908 Ang A19.CA and K29.CE other bump:1.64907 Ang A19.O and K29.CE other bump:1.91244 Ang A19.C and K29.CE other bump:3.07408 Ang L18.C and K29.CE other bump:3.23272 Ang I22.CG1 and K29.CD other bump:2.81068 Ang I22.CD1 and K29.CD other bump:2.93745 Ang A19.N and K29.CD other bump:2.03154 Ang A19.CA and K29.CD other bump:2.84717 Ang A19.C and K29.CD other bump:2.89385 Ang A19.CB and K29.CD other bump:2.80244 Ang A19.CA and K29.CG other bump:2.92437 Ang A19.CB and K29.CG other bump:2.87953 Ang N4.CG and K28.CD other bump:2.56843 Ang N4.ND2 and K28.CD other bump:2.69794 Ang N4.OD1 and K28.CB other bump:2.78354 Ang I22.CG2 and N27.ND2 other bump:2.83123 Ang I22.CG2 and N27.CG other bump:2.55965 Ang I22.CG2 and N27.CB other bump:2.12886 Ang N9.CG and T11.OG1 other bump:1.26249 Ang N9.OD1 and T11.OG1 other bump:2.40651 Ang N9.OD1 and T11.CB T0191 86 :LDGVDIIINATPIGMYPNIDVE 1gegA 77 :LGGFDVIVNNAGVAPSTPIESI Fragment has 20 clashes (null) has 20 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 24 residues other bump:2.33994 Ang I20.N and E23.OE2 other bump:2.07083 Ang I20.CA and E23.OE2 other bump:2.55179 Ang N19.C and E23.OE2 other bump:2.43917 Ang I20.CA and E23.OE1 other bump:1.37608 Ang I20.O and E23.OE1 other bump:2.08893 Ang I20.C and E23.OE1 other bump:2.56081 Ang I20.CA and E23.CD other bump:2.50878 Ang I20.O and E23.CD other bump:2.82414 Ang I20.C and E23.CD neighbor-bump: 1.99253 Ang Y17.C and P18.CD neighbor-bump: 2.49673 Ang Y17.C and P18.CG other bump:2.01595 Ang A11.O and P13.CD other bump:2.66032 Ang A11.C and P13.CD neighbor-bump: 2.00296 Ang T12.CA and P13.CD neighbor-bump: 1.32553 Ang T12.C and P13.CD neighbor-bump: 2.15168 Ang T12.O and P13.CD other bump:2.23158 Ang A11.O and P13.CG other bump:3.13336 Ang A11.C and P13.CG neighbor-bump: 2.20272 Ang T12.C and P13.CG neighbor-bump: 2.2263 Ang T12.O and P13.CG Number of specific fragments= 4 total=44 Number of alignments=8 # Reading fragments from alignment file # T0191 read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1jaxA/T0191-1jaxA-2track-protein-STR-global-adpstyle1.pw.a2m.gz # 1jaxA read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1jaxA/T0191-1jaxA-2track-protein-STR-global-adpstyle1.pw.a2m.gz # adding 1jaxA to template set 1jaxA:Skipped atom 1185, because occupancy 0.5 <= existing 0.500001 Skipped atom 1187, because occupancy 0.5 <= existing 0.500001 Skipped atom 1189, because occupancy 0.5 <= existing 0.500001 Skipped atom 1191, because occupancy 0.5 <= existing 0.500001 Skipped atom 1193, because occupancy 0.5 <= existing 0.500001 Skipped atom 1195, because occupancy 0.5 <= existing 0.500001 Skipped atom 1197, because occupancy 0.5 <= existing 0.500001 Skipped atom 1199, because occupancy 0.5 <= existing 0.500001 Skipped atom 1256, because occupancy 0.5 <= existing 0.500001 Skipped atom 1258, because occupancy 0.5 <= existing 0.500001 Skipped atom 1260, because occupancy 0.5 <= existing 0.500001 Skipped atom 1262, because occupancy 0.5 <= existing 0.500001 Skipped atom 1264, because occupancy 0.5 <= existing 0.500001 Skipped atom 1266, because occupancy 0.5 <= existing 0.500001 Skipped atom 1284, because occupancy 0.5 <= existing 0.500001 Skipped atom 1286, because occupancy 0.5 <= existing 0.500001 Skipped atom 1288, because occupancy 0.5 <= existing 0.500001 Skipped atom 1290, because occupancy 0.5 <= existing 0.500001 Skipped atom 1292, because occupancy 0.5 <= existing 0.500001 Skipped atom 1294, because occupancy 0.5 <= existing 0.500001 Skipped atom 1313, because occupancy 0.5 <= existing 0.500001 Skipped atom 1315, because occupancy 0.5 <= existing 0.500001 Skipped atom 1317, because occupancy 0.5 <= existing 0.500001 Skipped atom 1319, because occupancy 0.5 <= existing 0.500001 Skipped atom 1321, because occupancy 0.5 <= existing 0.500001 Skipped atom 1323, because occupancy 0.5 <= existing 0.500001 Skipped atom 1325, because occupancy 0.5 <= existing 0.500001 Skipped atom 1327, because occupancy 0.5 <= existing 0.500001 Skipped atom 1384, because occupancy 0.5 <= existing 0.500001 Skipped atom 1386, because occupancy 0.5 <= existing 0.500001 Skipped atom 1388, because occupancy 0.5 <= existing 0.500001 Skipped atom 1390, because occupancy 0.5 <= existing 0.500001 Skipped atom 1392, because occupancy 0.5 <= existing 0.500001 Skipped atom 1394, because occupancy 0.5 <= existing 0.500001 Skipped atom 1396, because occupancy 0.5 <= existing 0.500001 Skipped atom 1583, because occupancy 0.5 <= existing 0.500001 Skipped atom 1585, because occupancy 0.5 <= existing 0.500001 Skipped atom 1587, because occupancy 0.5 <= existing 0.500001 Skipped atom 1589, because occupancy 0.5 <= existing 0.500001 Skipped atom 1591, because occupancy 0.5 <= existing 0.500001 Skipped atom 1593, because occupancy 0.5 <= existing 0.500001 Skipped atom 1595, because occupancy 0.5 <= existing 0.500001 Skipped atom 1597, because occupancy 0.5 <= existing 0.500001 Skipped atom 1599, because occupancy 0.5 <= existing 0.500001 Skipped atom 1613, because occupancy 0.5 <= existing 0.500001 Skipped atom 1615, because occupancy 0.5 <= existing 0.500001 Skipped atom 1617, because occupancy 0.5 <= existing 0.500001 Skipped atom 1619, because occupancy 0.5 <= existing 0.500001 Skipped atom 1621, because occupancy 0.5 <= existing 0.500001 Skipped atom 1623, because occupancy 0.5 <= existing 0.500001 Skipped atom 1625, because occupancy 0.5 <= existing 0.500001 Skipped atom 1627, because occupancy 0.5 <= existing 0.500001 # found chain 1jaxA in template set T0191 25 :NIVIYGA 1jaxA 2 :RVALLGG Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 9 residues other bump:2.60548 Ang I5.CB and A8.CB other bump:2.48976 Ang I5.CG2 and A8.CB other bump:2.24555 Ang I5.O and A8.CB other bump:2.91754 Ang I5.C and A8.CB other bump:3.14389 Ang I5.CG2 and A8.CA T0191 32 :GGAARAVAFELAK 1jaxA 10 :GNLGKGLALRLAT Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGLD 1jaxA 24 :GHEIVVGSRREEKAEAKAAEYRRIAGDASITGMKNEDAA Fragment has 81 clashes (null) has 81 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 41 residues other bump:2.93864 Ang V34.CB and L39.CD2 other bump:1.70767 Ang V34.CG2 and L39.CD2 other bump:2.60435 Ang I6.CB and L39.CD2 other bump:1.33969 Ang I6.CG1 and L39.CD2 other bump:1.68413 Ang I6.CD1 and L39.CD2 other bump:2.29645 Ang I7.O and L39.CD1 other bump:2.41783 Ang I7.C and L39.CD1 other bump:2.33376 Ang A8.N and L39.CD1 other bump:2.82692 Ang V34.CG2 and L39.CD1 other bump:2.11126 Ang A8.CA and L39.CD1 other bump:2.55666 Ang A8.CB and L39.CD1 other bump:3.08697 Ang V34.CB and L39.CG other bump:1.60756 Ang V34.CG2 and L39.CG other bump:2.81748 Ang I6.CG1 and L39.CG other bump:2.6943 Ang V34.CG2 and L39.CB other bump:2.91117 Ang V34.CG2 and L39.CA other bump:3.07176 Ang N9.CA and F36.CZ other bump:2.55044 Ang A8.O and F36.CZ other bump:2.99252 Ang A8.C and F36.CZ other bump:2.57132 Ang N9.CA and F36.CE2 other bump:2.78413 Ang N9.C and F36.CE2 other bump:3.14449 Ang R10.N and F36.CE2 other bump:3.06525 Ang N9.N and F36.CE2 other bump:2.92316 Ang A8.CB and F36.CE1 other bump:2.93525 Ang A8.C and F36.CE1 other bump:3.07999 Ang N9.CA and F36.CD2 other bump:2.76539 Ang N9.C and F36.CD2 other bump:2.50446 Ang A8.CB and F36.CD1 other bump:2.61283 Ang V12.CG2 and K35.CE other bump:2.87829 Ang V12.CG2 and K35.CD other bump:2.1409 Ang V12.CG2 and K35.CG other bump:2.87488 Ang I6.CG1 and V34.CG2 other bump:2.47604 Ang I6.CD1 and V34.CG2 other bump:2.8209 Ang I6.CD1 and V34.CG1 other bump:1.76559 Ang A15.C and E33.OE2 other bump:1.67864 Ang E16.N and E33.OE2 other bump:1.79763 Ang K14.C and E33.OE2 other bump:1.0317 Ang A15.N and E33.OE2 other bump:1.54786 Ang A15.CA and E33.OE2 other bump:2.51127 Ang A15.CB and E33.OE2 other bump:2.21594 Ang A15.C and E33.OE1 other bump:0.899862 Ang E16.N and E33.OE1 other bump:1.10488 Ang E16.CA and E33.OE1 other bump:1.61355 Ang E16.CB and E33.OE1 other bump:2.24411 Ang E16.C and E33.OE1 other bump:2.43633 Ang A15.O and E33.CD other bump:1.30434 Ang A15.C and E33.CD other bump:0.565897 Ang E16.N and E33.CD other bump:1.99209 Ang E16.CA and E33.CD other bump:2.81391 Ang E16.CB and E33.CD other bump:3.01536 Ang E16.C and E33.CD other bump:2.92884 Ang K14.C and E33.CD other bump:2.23224 Ang A15.N and E33.CD other bump:2.02599 Ang A15.CA and E33.CD other bump:2.66184 Ang A15.CB and E33.CD other bump:2.191 Ang A15.O and E33.CG other bump:1.48782 Ang A15.C and E33.CG other bump:1.70188 Ang E16.N and E33.CG other bump:2.63976 Ang E16.CA and E33.CG other bump:3.04308 Ang A15.N and E33.CG other bump:2.10154 Ang A15.CA and E33.CG other bump:2.0153 Ang A15.CB and E33.CG other bump:2.38329 Ang A15.O and E33.CB other bump:2.36144 Ang A15.C and E33.CB other bump:2.36679 Ang E16.N and E33.CB other bump:2.42495 Ang E16.CA and E33.CB other bump:2.8852 Ang F30.CD1 and E32.OE1 other bump:1.68779 Ang F30.CE1 and E32.OE1 other bump:2.16903 Ang F30.CZ and E32.OE1 other bump:2.81264 Ang F30.CZ and E32.CD other bump:2.93181 Ang N4.CB and F30.CE2 other bump:3.08236 Ang N4.CG and F30.CE2 other bump:2.76982 Ang N4.CA and F30.CD2 other bump:2.76488 Ang N4.CB and F30.CD2 other bump:2.82356 Ang N4.CG and F30.CD2 other bump:2.95391 Ang L26.CB and K29.CD other bump:2.89819 Ang I7.CD1 and A19.CA other bump:2.52503 Ang I7.CD1 and A19.N other bump:2.46765 Ang V12.CG1 and E16.OE2 other bump:2.85136 Ang N9.ND2 and K14.CE other bump:2.77127 Ang N9.ND2 and K14.CD T0191 87 :DGVDIIINATPIGMYP 1jaxA 63 :EACDIAVLTIPWEHAI Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 18 residues neighbor-bump: 2.74792 Ang Y16.CD2 and P17.CD other bump:2.81381 Ang V4.CG1 and I7.CG1 other bump:2.70337 Ang V4.CG2 and I6.C other bump:1.98462 Ang V4.CG2 and I6.O T0191 106 :VEPIVKAEKLREDMVVMDLI 1jaxA 79 :DTARDLKNILREKIVVSPLV Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 22 residues other bump:3.07213 Ang G1.C and P4.CD T0191 126 :YNPLETVLLKEAKKVNAK 1jaxA 109 :YSSERSAAEIVAEVLESE Fragment has 11 clashes (null) has 11 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 20 residues other bump:2.95556 Ang V16.CG1 and A18.CB other bump:2.27092 Ang V8.CG1 and E12.OE2 other bump:1.09645 Ang V8.O and E12.OE1 other bump:1.97665 Ang V8.C and E12.OE1 other bump:2.59762 Ang L9.CA and E12.OE1 other bump:3.15187 Ang V8.CG1 and E12.CD other bump:1.9506 Ang V8.O and E12.CD other bump:2.82767 Ang V8.C and E12.CD neighbor-bump: 2.53522 Ang N3.N and P4.CD neighbor-bump: 2.13017 Ang N3.C and P4.CD neighbor-bump: 2.61461 Ang N3.ND2 and P4.CD T0191 144 :TINGLGMLIYQGAVAFK 1jaxA 128 :VVSALHTIPAARFANLD Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 18 residues Number of specific fragments= 7 total=51 Number of alignments=9 # Reading fragments from alignment file # T0191 read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1jaxA/T0191-1jaxA-2track-protein-STR-global-adpstyle5.pw.a2m.gz # 1jaxA read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1jaxA/T0191-1jaxA-2track-protein-STR-global-adpstyle5.pw.a2m.gz # found chain 1jaxA in template set T0191 25 :NIVIYGA 1jaxA 2 :RVALLGG Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 9 residues other bump:2.60548 Ang I5.CB and A8.CB other bump:2.48976 Ang I5.CG2 and A8.CB other bump:2.24555 Ang I5.O and A8.CB other bump:2.91754 Ang I5.C and A8.CB other bump:3.14389 Ang I5.CG2 and A8.CA T0191 32 :GGAARAVAFELAK 1jaxA 10 :GNLGKGLALRLAT Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGLD 1jaxA 24 :GHEIVVGSRREEKAEAKAAEYRRIAGDASITGMKNEDAA Fragment has 81 clashes (null) has 81 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 41 residues other bump:2.93864 Ang V34.CB and L39.CD2 other bump:1.70767 Ang V34.CG2 and L39.CD2 other bump:2.60435 Ang I6.CB and L39.CD2 other bump:1.33969 Ang I6.CG1 and L39.CD2 other bump:1.68413 Ang I6.CD1 and L39.CD2 other bump:2.29645 Ang I7.O and L39.CD1 other bump:2.41783 Ang I7.C and L39.CD1 other bump:2.33376 Ang A8.N and L39.CD1 other bump:2.82692 Ang V34.CG2 and L39.CD1 other bump:2.11126 Ang A8.CA and L39.CD1 other bump:2.55666 Ang A8.CB and L39.CD1 other bump:3.08697 Ang V34.CB and L39.CG other bump:1.60756 Ang V34.CG2 and L39.CG other bump:2.81748 Ang I6.CG1 and L39.CG other bump:2.6943 Ang V34.CG2 and L39.CB other bump:2.91117 Ang V34.CG2 and L39.CA other bump:3.07176 Ang N9.CA and F36.CZ other bump:2.55044 Ang A8.O and F36.CZ other bump:2.99252 Ang A8.C and F36.CZ other bump:2.57132 Ang N9.CA and F36.CE2 other bump:2.78413 Ang N9.C and F36.CE2 other bump:3.14449 Ang R10.N and F36.CE2 other bump:3.06525 Ang N9.N and F36.CE2 other bump:2.92316 Ang A8.CB and F36.CE1 other bump:2.93525 Ang A8.C and F36.CE1 other bump:3.07999 Ang N9.CA and F36.CD2 other bump:2.76539 Ang N9.C and F36.CD2 other bump:2.50446 Ang A8.CB and F36.CD1 other bump:2.61283 Ang V12.CG2 and K35.CE other bump:2.87829 Ang V12.CG2 and K35.CD other bump:2.1409 Ang V12.CG2 and K35.CG other bump:2.87488 Ang I6.CG1 and V34.CG2 other bump:2.47604 Ang I6.CD1 and V34.CG2 other bump:2.8209 Ang I6.CD1 and V34.CG1 other bump:1.76559 Ang A15.C and E33.OE2 other bump:1.67864 Ang E16.N and E33.OE2 other bump:1.79763 Ang K14.C and E33.OE2 other bump:1.0317 Ang A15.N and E33.OE2 other bump:1.54786 Ang A15.CA and E33.OE2 other bump:2.51127 Ang A15.CB and E33.OE2 other bump:2.21594 Ang A15.C and E33.OE1 other bump:0.899862 Ang E16.N and E33.OE1 other bump:1.10488 Ang E16.CA and E33.OE1 other bump:1.61355 Ang E16.CB and E33.OE1 other bump:2.24411 Ang E16.C and E33.OE1 other bump:2.43633 Ang A15.O and E33.CD other bump:1.30434 Ang A15.C and E33.CD other bump:0.565897 Ang E16.N and E33.CD other bump:1.99209 Ang E16.CA and E33.CD other bump:2.81391 Ang E16.CB and E33.CD other bump:3.01536 Ang E16.C and E33.CD other bump:2.92884 Ang K14.C and E33.CD other bump:2.23224 Ang A15.N and E33.CD other bump:2.02599 Ang A15.CA and E33.CD other bump:2.66184 Ang A15.CB and E33.CD other bump:2.191 Ang A15.O and E33.CG other bump:1.48782 Ang A15.C and E33.CG other bump:1.70188 Ang E16.N and E33.CG other bump:2.63976 Ang E16.CA and E33.CG other bump:3.04308 Ang A15.N and E33.CG other bump:2.10154 Ang A15.CA and E33.CG other bump:2.0153 Ang A15.CB and E33.CG other bump:2.38329 Ang A15.O and E33.CB other bump:2.36144 Ang A15.C and E33.CB other bump:2.36679 Ang E16.N and E33.CB other bump:2.42495 Ang E16.CA and E33.CB other bump:2.8852 Ang F30.CD1 and E32.OE1 other bump:1.68779 Ang F30.CE1 and E32.OE1 other bump:2.16903 Ang F30.CZ and E32.OE1 other bump:2.81264 Ang F30.CZ and E32.CD other bump:2.93181 Ang N4.CB and F30.CE2 other bump:3.08236 Ang N4.CG and F30.CE2 other bump:2.76982 Ang N4.CA and F30.CD2 other bump:2.76488 Ang N4.CB and F30.CD2 other bump:2.82356 Ang N4.CG and F30.CD2 other bump:2.95391 Ang L26.CB and K29.CD other bump:2.89819 Ang I7.CD1 and A19.CA other bump:2.52503 Ang I7.CD1 and A19.N other bump:2.46765 Ang V12.CG1 and E16.OE2 other bump:2.85136 Ang N9.ND2 and K14.CE other bump:2.77127 Ang N9.ND2 and K14.CD T0191 87 :DGVDIIINATPIGMYPNIDVE 1jaxA 63 :EACDIAVLTIPWEHAIDTARD Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 23 residues neighbor-bump: 2.74793 Ang Y16.CD2 and P17.CD other bump:2.81381 Ang V4.CG1 and I7.CG1 other bump:2.70337 Ang V4.CG2 and I6.C other bump:1.98462 Ang V4.CG2 and I6.O T0191 149 :GMLIYQGA 1jaxA 133 :HTIPAARF Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 10 residues Number of specific fragments= 5 total=56 Number of alignments=10 # Reading fragments from alignment file # T0191 read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1fmcA/T0191-1fmcA-2track-protein-STR-global-adpstyle5.pw.a2m.gz # 1fmcA read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1fmcA/T0191-1fmcA-2track-protein-STR-global-adpstyle5.pw.a2m.gz # adding 1fmcA to template set 1fmcA:# found chain 1fmcA in template set T0191 3 :YNT 1fmcA 2 :FNS Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 5 residues other bump:2.87391 Ang Y2.CE2 and T4.CG2 T0191 17 :EIGRVKDKNIVIYGAG 1fmcA 5 :DNLRLDGKCAIITGAG Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 18 residues other bump:2.64343 Ang R5.NE and K7.CE T0191 33 :GAARAVAFELAK 1fmcA 22 :GIGKEIAITFAT Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:3.07616 Ang R5.CG and F9.CZ other bump:2.16023 Ang R5.NH1 and F9.CE1 T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGLDVD 1fmcA 35 :GASVVVSDINADAANHVVDEIQQLGGQAFACRCDITSEQEL Fragment has 43 clashes (null) has 43 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 43 residues other bump:2.97946 Ang V34.CG1 and V41.CG1 other bump:2.88234 Ang K35.N and V41.CG1 other bump:2.33425 Ang R10.NH2 and K35.NZ other bump:2.75278 Ang R10.NE and K35.NZ other bump:2.46903 Ang R10.CZ and K35.NZ other bump:3.08942 Ang R10.CZ and K35.CD other bump:2.95333 Ang R10.CG and K35.CG other bump:2.89546 Ang E32.CG and V34.CG2 other bump:2.95631 Ang E32.CD and V34.CG2 other bump:2.52883 Ang E32.OE1 and V34.CG2 other bump:2.86069 Ang V12.CG1 and E33.OE2 other bump:2.61053 Ang V12.CA and E33.OE1 other bump:2.12323 Ang V12.CB and E33.OE1 other bump:1.46015 Ang V12.CG1 and E33.OE1 other bump:2.53367 Ang V12.CG2 and E33.OE1 other bump:1.97801 Ang V12.CG1 and E33.CD other bump:2.64474 Ang V12.CG1 and E33.CG other bump:2.71105 Ang V12.CG1 and E33.CB other bump:1.97712 Ang A19.CA and K29.NZ other bump:2.04116 Ang A19.C and K29.NZ other bump:1.21907 Ang L18.O and K29.NZ other bump:1.90229 Ang L18.C and K29.NZ other bump:2.2055 Ang A19.N and K29.NZ other bump:2.78468 Ang I22.CB and K29.CE other bump:1.88544 Ang A19.CA and K29.CE other bump:1.93764 Ang A19.O and K29.CE other bump:2.1214 Ang A19.C and K29.CE other bump:2.39855 Ang A19.CA and K29.CD other bump:3.07583 Ang A19.CB and K29.CD other bump:3.22948 Ang A19.CA and K29.CG other bump:2.40177 Ang N4.CG and K28.CD other bump:2.4606 Ang N4.ND2 and K28.CD other bump:2.51844 Ang N4.OD1 and K28.CD other bump:2.58373 Ang N4.OD1 and K28.CB other bump:2.74316 Ang K25.CB and N27.ND2 other bump:3.03038 Ang I22.CG2 and N27.CG other bump:2.24775 Ang I22.CG2 and N27.CB other bump:2.72754 Ang I5.CD1 and I22.CD1 other bump:3.0841 Ang I7.CD1 and L18.CB other bump:2.37256 Ang N9.CG and T11.OG1 other bump:1.43799 Ang N9.OD1 and T11.OG1 other bump:2.57783 Ang N9.OD1 and T11.CB other bump:2.93639 Ang I5.CD1 and I7.CG2 T0191 86 :LDGVDIIINATPIGMYPNIDVE 1fmcA 86 :LGKVDILVNNAGGGGPKPFDMP Fragment has 16 clashes (null) has 16 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 24 residues other bump:2.34456 Ang N19.O and V22.CG2 neighbor-bump: 2.55885 Ang G15.O and M16.CG neighbor-bump: 2.03735 Ang G15.O and M16.CB neighbor-bump: 2.51066 Ang G15.C and M16.CB neighbor-bump: 2.44956 Ang P13.C and I14.CG2 neighbor-bump: 1.51342 Ang P13.O and I14.CG2 neighbor-bump: 2.20267 Ang T12.O and P13.CD neighbor-bump: 2.49281 Ang T12.N and P13.CD other bump:1.94137 Ang A11.O and P13.CD other bump:2.4874 Ang A11.C and P13.CD neighbor-bump: 1.87871 Ang T12.CA and P13.CD neighbor-bump: 1.3343 Ang T12.C and P13.CD other bump:2.07084 Ang A11.O and P13.CG other bump:2.9735 Ang A11.C and P13.CG neighbor-bump: 2.35092 Ang T12.C and P13.CG self-bump: 1.36654 Ang D3.CA and D3.CB T0191 108 :PIVKAEKLREDMVVMDLIYN 1fmcA 128 :LVAPEMEKNGGGVILTITSM Fragment has 15 clashes (null) has 15 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 22 residues neighbor-bump: 2.0331 Ang I19.O and Y20.CD1 neighbor-bump: 2.69062 Ang I19.C and Y20.CD1 neighbor-bump: 2.32221 Ang I19.CB and Y20.N neighbor-bump: 2.45307 Ang I19.CG1 and Y20.N other bump:2.74572 Ang E7.CG and M13.CE other bump:2.51494 Ang E7.CB and M13.SD other bump:2.40261 Ang E7.CG and M13.SD other bump:2.8974 Ang E7.CB and M13.CG other bump:2.9614 Ang E7.CG and M13.CG other bump:2.77059 Ang E7.CB and M13.CB other bump:2.53415 Ang E7.CG and M13.CB other bump:2.83654 Ang E7.CD and M13.CB other bump:2.553 Ang E7.OE1 and M13.CB other bump:2.41927 Ang E7.CD and R10.NH2 other bump:2.02177 Ang E7.OE2 and R10.NH2 T0191 139 :KVNAKTINGLGMLIYQGAVAF 1fmcA 148 :AAENKNINMTSYASSKAAASH Fragment has 14 clashes (null) has 14 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 23 residues other bump:3.28262 Ang V3.CG1 and G18.CA other bump:2.6718 Ang V3.CG2 and Q17.C other bump:2.5619 Ang V3.CG2 and Q17.CB other bump:3.16389 Ang V3.CG2 and Q17.CA other bump:2.12506 Ang K2.C and L14.CD1 other bump:1.03142 Ang K2.O and L14.CD1 other bump:2.55656 Ang K2.O and L14.CG other bump:1.44407 Ang K2.CD and M13.CE other bump:2.80087 Ang K2.CG and M13.CE other bump:1.71054 Ang K2.NZ and M13.CE other bump:1.61265 Ang K2.CE and M13.CE other bump:2.55012 Ang K2.CD and M13.SD other bump:1.6109 Ang K2.NZ and M13.SD other bump:2.52892 Ang K2.CE and M13.SD Number of specific fragments= 7 total=63 Number of alignments=11 # Reading fragments from alignment file # T0191 read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1fmcA/T0191-1fmcA-2track-protein-STR-global-adpstyle1.pw.a2m.gz # 1fmcA read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1fmcA/T0191-1fmcA-2track-protein-STR-global-adpstyle1.pw.a2m.gz # found chain 1fmcA in template set T0191 18 :IGR 1fmcA 2 :FNS Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 5 residues T0191 21 :VKDKNIVIYGAG 1fmcA 9 :LDGKCAIITGAG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues T0191 33 :GAARAVAFELAK 1fmcA 22 :GIGKEIAITFAT Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:3.07616 Ang R5.CG and F9.CZ other bump:2.16023 Ang R5.NH1 and F9.CE1 T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGLDVD 1fmcA 35 :GASVVVSDINADAANHVVDEIQQLGGQAFACRCDITSEQEL Fragment has 43 clashes (null) has 43 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 43 residues other bump:2.97946 Ang V34.CG1 and V41.CG1 other bump:2.88234 Ang K35.N and V41.CG1 other bump:2.33425 Ang R10.NH2 and K35.NZ other bump:2.75278 Ang R10.NE and K35.NZ other bump:2.46903 Ang R10.CZ and K35.NZ other bump:3.08942 Ang R10.CZ and K35.CD other bump:2.95333 Ang R10.CG and K35.CG other bump:2.89546 Ang E32.CG and V34.CG2 other bump:2.95631 Ang E32.CD and V34.CG2 other bump:2.52883 Ang E32.OE1 and V34.CG2 other bump:2.86069 Ang V12.CG1 and E33.OE2 other bump:2.61053 Ang V12.CA and E33.OE1 other bump:2.12323 Ang V12.CB and E33.OE1 other bump:1.46015 Ang V12.CG1 and E33.OE1 other bump:2.53367 Ang V12.CG2 and E33.OE1 other bump:1.97801 Ang V12.CG1 and E33.CD other bump:2.64474 Ang V12.CG1 and E33.CG other bump:2.71105 Ang V12.CG1 and E33.CB other bump:1.97712 Ang A19.CA and K29.NZ other bump:2.04116 Ang A19.C and K29.NZ other bump:1.21907 Ang L18.O and K29.NZ other bump:1.90229 Ang L18.C and K29.NZ other bump:2.2055 Ang A19.N and K29.NZ other bump:2.78468 Ang I22.CB and K29.CE other bump:1.88544 Ang A19.CA and K29.CE other bump:1.93764 Ang A19.O and K29.CE other bump:2.1214 Ang A19.C and K29.CE other bump:2.39855 Ang A19.CA and K29.CD other bump:3.07583 Ang A19.CB and K29.CD other bump:3.22948 Ang A19.CA and K29.CG other bump:2.40177 Ang N4.CG and K28.CD other bump:2.4606 Ang N4.ND2 and K28.CD other bump:2.51844 Ang N4.OD1 and K28.CD other bump:2.58373 Ang N4.OD1 and K28.CB other bump:2.74316 Ang K25.CB and N27.ND2 other bump:3.03038 Ang I22.CG2 and N27.CG other bump:2.24775 Ang I22.CG2 and N27.CB other bump:2.72754 Ang I5.CD1 and I22.CD1 other bump:3.0841 Ang I7.CD1 and L18.CB other bump:2.37256 Ang N9.CG and T11.OG1 other bump:1.43799 Ang N9.OD1 and T11.OG1 other bump:2.57783 Ang N9.OD1 and T11.CB other bump:2.93639 Ang I5.CD1 and I7.CG2 T0191 86 :LDGVDIIINATPIGMYPNIDVE 1fmcA 86 :LGKVDILVNNAGGGGPKPFDMP Fragment has 16 clashes (null) has 16 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 24 residues other bump:2.34456 Ang N19.O and V22.CG2 neighbor-bump: 2.55885 Ang G15.O and M16.CG neighbor-bump: 2.03735 Ang G15.O and M16.CB neighbor-bump: 2.51066 Ang G15.C and M16.CB neighbor-bump: 2.44956 Ang P13.C and I14.CG2 neighbor-bump: 1.51342 Ang P13.O and I14.CG2 neighbor-bump: 2.20267 Ang T12.O and P13.CD neighbor-bump: 2.49281 Ang T12.N and P13.CD other bump:1.94137 Ang A11.O and P13.CD other bump:2.4874 Ang A11.C and P13.CD neighbor-bump: 1.87871 Ang T12.CA and P13.CD neighbor-bump: 1.3343 Ang T12.C and P13.CD other bump:2.07084 Ang A11.O and P13.CG other bump:2.9735 Ang A11.C and P13.CG neighbor-bump: 2.35092 Ang T12.C and P13.CG self-bump: 1.36654 Ang D3.CA and D3.CB T0191 108 :PIVKAEKLREDMVVMDLIYN 1fmcA 128 :LVAPEMEKNGGGVILTITSM Fragment has 15 clashes (null) has 15 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 22 residues neighbor-bump: 2.0331 Ang I19.O and Y20.CD1 neighbor-bump: 2.69062 Ang I19.C and Y20.CD1 neighbor-bump: 2.32221 Ang I19.CB and Y20.N neighbor-bump: 2.45307 Ang I19.CG1 and Y20.N other bump:2.74572 Ang E7.CG and M13.CE other bump:2.51494 Ang E7.CB and M13.SD other bump:2.40261 Ang E7.CG and M13.SD other bump:2.8974 Ang E7.CB and M13.CG other bump:2.9614 Ang E7.CG and M13.CG other bump:2.77059 Ang E7.CB and M13.CB other bump:2.53415 Ang E7.CG and M13.CB other bump:2.83654 Ang E7.CD and M13.CB other bump:2.553 Ang E7.OE1 and M13.CB other bump:2.41927 Ang E7.CD and R10.NH2 other bump:2.02177 Ang E7.OE2 and R10.NH2 T0191 139 :KVNAKTINGLGMLIYQGAVAF 1fmcA 148 :AAENKNINMTSYASSKAAASH Fragment has 14 clashes (null) has 14 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 23 residues other bump:3.28262 Ang V3.CG1 and G18.CA other bump:2.6718 Ang V3.CG2 and Q17.C other bump:2.5619 Ang V3.CG2 and Q17.CB other bump:3.16389 Ang V3.CG2 and Q17.CA other bump:2.12506 Ang K2.C and L14.CD1 other bump:1.03142 Ang K2.O and L14.CD1 other bump:2.55656 Ang K2.O and L14.CG other bump:1.44407 Ang K2.CD and M13.CE other bump:2.80087 Ang K2.CG and M13.CE other bump:1.71054 Ang K2.NZ and M13.CE other bump:1.61265 Ang K2.CE and M13.CE other bump:2.55012 Ang K2.CD and M13.SD other bump:1.6109 Ang K2.NZ and M13.SD other bump:2.52892 Ang K2.CE and M13.SD Number of specific fragments= 7 total=70 Number of alignments=12 # Reading fragments from alignment file # T0191 read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1hu4A/T0191-1hu4A-2track-protein-STR-global-adpstyle1.pw.a2m.gz # 1hu4A read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1hu4A/T0191-1hu4A-2track-protein-STR-global-adpstyle1.pw.a2m.gz # adding 1hu4A to template set 1hu4A:# found chain 1hu4A in template set T0191 21 :VKDKNIVIYGAG 1hu4A 2 :SNTRVALVTGAN Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues neighbor-bump: 2.87181 Ang G1.C and V2.CG2 neighbor-bump: 2.44137 Ang G1.O and V2.CG2 T0191 33 :GAARAVAFELAK 1hu4A 15 :GIGFAIVRDLCR Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:2.35528 Ang F9.CE2 and K13.NZ other bump:2.48416 Ang F9.CZ and K13.NZ other bump:2.29426 Ang F9.CE2 and K13.CE other bump:2.18466 Ang F9.CZ and K13.CE other bump:3.11099 Ang F9.CE2 and K13.CD T0191 45 :DN 1hu4A 28 :FA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues T0191 47 :NIIIANRTVEKAEALAKEIAEKLNKKFGEEVK 1hu4A 31 :DVVLTARDVARGQAAVKQLQAEGLSPRFHQLD Fragment has 30 clashes (null) has 30 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 34 residues neighbor-bump: 2.154 Ang E31.O and V32.CG2 neighbor-bump: 2.74154 Ang E31.C and V32.CG2 other bump:1.85153 Ang F28.CE1 and E30.OE1 other bump:2.98508 Ang F28.CD1 and E30.OE1 other bump:2.03752 Ang F28.CZ and E30.OE1 other bump:2.31172 Ang F28.CE1 and E30.CD other bump:2.88502 Ang F28.CZ and E30.CD other bump:2.26847 Ang F28.CE1 and E30.CG neighbor-bump: 2.54246 Ang G29.O and E30.CG other bump:2.85479 Ang I3.CD1 and K27.CE other bump:2.82376 Ang I5.CG2 and K27.CD other bump:3.11969 Ang I3.CG1 and K27.CG other bump:2.2927 Ang E19.CB and E22.OE2 other bump:2.15613 Ang E19.CG and E22.OE2 other bump:1.37051 Ang E19.O and E22.OE2 other bump:1.58114 Ang E19.C and E22.OE2 other bump:1.72968 Ang E19.CA and E22.OE2 other bump:1.99289 Ang E19.O and E22.OE1 other bump:1.79408 Ang E19.C and E22.OE1 other bump:1.62173 Ang K18.O and E22.OE1 other bump:2.31065 Ang K18.C and E22.OE1 other bump:1.98957 Ang E19.CA and E22.OE1 other bump:1.24318 Ang E19.O and E22.CD other bump:1.6891 Ang E19.C and E22.CD other bump:2.05254 Ang E19.CA and E22.CD other bump:2.93174 Ang I20.N and E22.CD other bump:2.08363 Ang E19.O and E22.CG other bump:3.05102 Ang E19.C and E22.CG other bump:3.26185 Ang V10.CG1 and E14.CD other bump:3.14222 Ang N7.CB and A13.CB T0191 79 :FSGLDVDLDGVDIIINATPIGMYPNIDVE 1hu4A 73 :CDFLRKEYGGLDVLVNNAAIAFQLDNPTP Fragment has 13 clashes (null) has 13 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 31 residues other bump:3.21928 Ang M23.SD and V29.CG1 other bump:1.60456 Ang M23.CE and V29.CG1 other bump:2.7358 Ang M23.CE and V29.CB other bump:2.18883 Ang A18.O and P20.CD neighbor-bump: 2.00267 Ang T19.CA and P20.CD neighbor-bump: 2.08181 Ang T19.O and P20.CD neighbor-bump: 1.27164 Ang T19.C and P20.CD other bump:2.77933 Ang A18.C and P20.CD other bump:2.28601 Ang A18.O and P20.CG neighbor-bump: 2.11586 Ang T19.O and P20.CG neighbor-bump: 2.15184 Ang T19.C and P20.CG other bump:3.24322 Ang A18.C and P20.CG other bump:3.0354 Ang L5.CD1 and V12.CG2 T0191 108 :PIVKAEKLREDMVVMDLIYNPLE 1hu4A 121 :CTELLPLIKPQGRVVNVSSTEGV Fragment has 18 clashes (null) has 18 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 25 residues neighbor-bump: 2.25306 Ang I19.O and Y20.CD1 neighbor-bump: 2.45673 Ang I19.CB and Y20.N other bump:2.59244 Ang L9.CD2 and V15.CG2 other bump:2.00163 Ang L9.CB and M13.CE other bump:1.70148 Ang L9.C and M13.CE other bump:1.67417 Ang R10.N and M13.CE other bump:1.57384 Ang L9.CA and M13.CE other bump:2.86554 Ang L9.CG and M13.CE other bump:1.34606 Ang L9.CB and M13.SD other bump:2.29417 Ang L9.CA and M13.SD other bump:1.40697 Ang L9.CG and M13.SD other bump:2.60554 Ang L9.CD1 and M13.SD other bump:2.55254 Ang L9.CD2 and M13.SD other bump:3.03886 Ang L9.CB and M13.CG other bump:2.86616 Ang L9.CG and M13.CG other bump:2.50898 Ang R10.O and M13.CB other bump:2.19648 Ang V4.O and K8.NZ other bump:2.31447 Ang I3.O and E7.OE1 T0191 131 :TVLLKEAKKVNAKTINGLGMLIYQGAVAFK 1hu4A 150 :SPELQQKFKSETITEEELVGLMNKFVEDTK Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 31 residues other bump:2.6716 Ang G20.O and Y24.CD1 other bump:2.70468 Ang V11.CB and K14.NZ other bump:2.89171 Ang V11.CG1 and K14.NZ other bump:1.75915 Ang V11.CG2 and K14.NZ other bump:2.84716 Ang V11.CB and K14.CG Number of specific fragments= 7 total=77 Number of alignments=13 # Reading fragments from alignment file # T0191 read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1hu4A/T0191-1hu4A-2track-protein-STR-global-adpstyle5.pw.a2m.gz # 1hu4A read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1hu4A/T0191-1hu4A-2track-protein-STR-global-adpstyle5.pw.a2m.gz # found chain 1hu4A in template set T0191 21 :VKDKNIVIYGAG 1hu4A 2 :SNTRVALVTGAN Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues neighbor-bump: 2.87181 Ang G1.C and V2.CG2 neighbor-bump: 2.44137 Ang G1.O and V2.CG2 T0191 33 :GAARAVAFELAK 1hu4A 15 :GIGFAIVRDLCR Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:2.35528 Ang F9.CE2 and K13.NZ other bump:2.48416 Ang F9.CZ and K13.NZ other bump:2.29426 Ang F9.CE2 and K13.CE other bump:2.18466 Ang F9.CZ and K13.CE other bump:3.11099 Ang F9.CE2 and K13.CD T0191 45 :DN 1hu4A 28 :FA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues T0191 47 :NIIIANRTVEKAEALAKEIAEKLNKKFGEEVK 1hu4A 31 :DVVLTARDVARGQAAVKQLQAEGLSPRFHQLD Fragment has 30 clashes (null) has 30 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 34 residues neighbor-bump: 2.154 Ang E31.O and V32.CG2 neighbor-bump: 2.74154 Ang E31.C and V32.CG2 other bump:1.85153 Ang F28.CE1 and E30.OE1 other bump:2.98508 Ang F28.CD1 and E30.OE1 other bump:2.03752 Ang F28.CZ and E30.OE1 other bump:2.31172 Ang F28.CE1 and E30.CD other bump:2.88502 Ang F28.CZ and E30.CD other bump:2.26847 Ang F28.CE1 and E30.CG neighbor-bump: 2.54246 Ang G29.O and E30.CG other bump:2.85479 Ang I3.CD1 and K27.CE other bump:2.82376 Ang I5.CG2 and K27.CD other bump:3.11969 Ang I3.CG1 and K27.CG other bump:2.2927 Ang E19.CB and E22.OE2 other bump:2.15613 Ang E19.CG and E22.OE2 other bump:1.37051 Ang E19.O and E22.OE2 other bump:1.58114 Ang E19.C and E22.OE2 other bump:1.72968 Ang E19.CA and E22.OE2 other bump:1.99289 Ang E19.O and E22.OE1 other bump:1.79408 Ang E19.C and E22.OE1 other bump:1.62173 Ang K18.O and E22.OE1 other bump:2.31065 Ang K18.C and E22.OE1 other bump:1.98957 Ang E19.CA and E22.OE1 other bump:1.24318 Ang E19.O and E22.CD other bump:1.6891 Ang E19.C and E22.CD other bump:2.05254 Ang E19.CA and E22.CD other bump:2.93174 Ang I20.N and E22.CD other bump:2.08363 Ang E19.O and E22.CG other bump:3.05102 Ang E19.C and E22.CG other bump:3.26185 Ang V10.CG1 and E14.CD other bump:3.14222 Ang N7.CB and A13.CB T0191 86 :LDGVDIIINATPIGMYPNIDVE 1hu4A 80 :YGGLDVLVNNAAIAFQLDNPTP Fragment has 12 clashes (null) has 12 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 24 residues other bump:3.21928 Ang M16.SD and V22.CG1 other bump:1.60456 Ang M16.CE and V22.CG1 other bump:2.7358 Ang M16.CE and V22.CB other bump:2.18883 Ang A11.O and P13.CD neighbor-bump: 2.00267 Ang T12.CA and P13.CD neighbor-bump: 2.08181 Ang T12.O and P13.CD neighbor-bump: 1.27164 Ang T12.C and P13.CD other bump:2.77933 Ang A11.C and P13.CD other bump:2.28601 Ang A11.O and P13.CG neighbor-bump: 2.11586 Ang T12.O and P13.CG neighbor-bump: 2.15184 Ang T12.C and P13.CG other bump:3.24322 Ang A11.C and P13.CG T0191 108 :PIVKAEKLREDMVVMDLIYNPLETVL 1hu4A 121 :CTELLPLIKPQGRVVNVSSTEGVRAL Fragment has 18 clashes (null) has 18 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues neighbor-bump: 2.25306 Ang I19.O and Y20.CD1 neighbor-bump: 2.45673 Ang I19.CB and Y20.N other bump:2.59244 Ang L9.CD2 and V15.CG2 other bump:2.00163 Ang L9.CB and M13.CE other bump:1.70148 Ang L9.C and M13.CE other bump:1.67417 Ang R10.N and M13.CE other bump:1.57384 Ang L9.CA and M13.CE other bump:2.86554 Ang L9.CG and M13.CE other bump:1.34606 Ang L9.CB and M13.SD other bump:2.29417 Ang L9.CA and M13.SD other bump:1.40697 Ang L9.CG and M13.SD other bump:2.60554 Ang L9.CD1 and M13.SD other bump:2.55254 Ang L9.CD2 and M13.SD other bump:3.03886 Ang L9.CB and M13.CG other bump:2.86616 Ang L9.CG and M13.CG other bump:2.50898 Ang R10.O and M13.CB other bump:2.19648 Ang V4.O and K8.NZ other bump:2.31447 Ang I3.O and E7.OE1 T0191 134 :LKEAKKVNAKTINGLGMLIYQGAVAF 1hu4A 151 :PELQQKFKSETITEEELVGLMNKFVE Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:2.41901 Ang K7.CE and Y21.OH other bump:2.55748 Ang K7.CD and Y21.OH other bump:3.03502 Ang K7.CD and Y21.CE2 Number of specific fragments= 7 total=84 Number of alignments=14 # Reading fragments from alignment file # T0191 read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1cydA/T0191-1cydA-2track-protein-STR-global-adpstyle1.pw.a2m.gz # 1cydA read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1cydA/T0191-1cydA-2track-protein-STR-global-adpstyle1.pw.a2m.gz # adding 1cydA to template set 1cydA:# found chain 1cydA in template set T0191 20 :RVKDKNIVIYGAG 1cydA 4 :NFSGLRALVTGAG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues T0191 33 :GAARAVAFELAK 1cydA 18 :GIGRDTVKALHA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKK 1cydA 31 :GAKVVAVTRTNSDLVSLAKECPGIEPVC Fragment has 28 clashes (null) has 28 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 30 residues other bump:2.35913 Ang V12.N and K29.NZ other bump:2.01342 Ang V12.CA and K29.NZ other bump:1.17289 Ang V12.CB and K29.NZ other bump:1.53911 Ang V12.CG1 and K29.NZ other bump:1.25603 Ang V12.CG2 and K29.NZ other bump:3.06242 Ang T11.C and K29.CE other bump:1.94247 Ang V12.N and K29.CE other bump:1.84487 Ang V12.CA and K29.CE other bump:1.71937 Ang V12.CB and K29.CE other bump:1.3082 Ang V12.CG1 and K29.CE other bump:2.69639 Ang V12.CG2 and K29.CE other bump:2.91086 Ang V12.CB and K29.CD other bump:1.67655 Ang V12.CG1 and K29.CD other bump:2.86538 Ang V12.CG1 and K29.CG other bump:2.48335 Ang I5.CD1 and K25.NZ other bump:2.18248 Ang I7.CG1 and K25.NZ other bump:1.72455 Ang I7.CD1 and K25.NZ other bump:2.2857 Ang I5.CD1 and K25.CE other bump:2.57236 Ang I5.CG1 and K25.CE other bump:2.09268 Ang I7.CG1 and K25.CE other bump:2.12582 Ang I7.CD1 and K25.CE other bump:2.88053 Ang I5.CD1 and K25.CD other bump:3.07312 Ang I5.CG1 and K25.CD other bump:3.15783 Ang I5.CG1 and K25.CG neighbor-bump: 2.28952 Ang A23.O and E24.CG neighbor-bump: 2.81687 Ang A23.C and E24.CG neighbor-bump: 3.05478 Ang E21.C and I22.CG1 other bump:2.79592 Ang I5.CD1 and I7.CD1 T0191 74 :GEEVKFSGLDVD 1cydA 59 :VDLGDWDATEKA Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:3.07981 Ang E4.CA and L10.CD2 other bump:2.63169 Ang E4.OE1 and L10.CD2 other bump:2.78259 Ang E4.CD and L10.CD2 other bump:2.95609 Ang E4.CA and L10.CD1 other bump:2.49321 Ang E4.O and L10.CD1 other bump:2.6863 Ang E3.CD and K6.CE other bump:2.41592 Ang E3.OE1 and K6.CE T0191 86 :LDGVDIIINATPIGMYPNIDVE 1cydA 74 :IGPVDLLVNNAALVIMQPFLEV Fragment has 11 clashes (null) has 11 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 24 residues other bump:1.9689 Ang A11.O and P13.CD other bump:2.62767 Ang A11.C and P13.CD neighbor-bump: 2.1246 Ang T12.CA and P13.CD neighbor-bump: 2.20012 Ang T12.O and P13.CD neighbor-bump: 1.41579 Ang T12.C and P13.CD other bump:2.45057 Ang A11.O and P13.CG neighbor-bump: 2.39862 Ang T12.O and P13.CG neighbor-bump: 2.3511 Ang T12.C and P13.CG neighbor-bump: 2.47861 Ang D3.CB and G4.N self-bump: 2.19176 Ang D3.CB and D3.C self-bump: 1.29723 Ang D3.CA and D3.CB T0191 108 :PIVKAEKLREDMVVMDLIYNPLE 1cydA 118 :VARDMINRGVPGSIVNVSSMVAH Fragment has 17 clashes (null) has 17 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 25 residues other bump:2.88091 Ang I19.CB and L23.CD1 neighbor-bump: 2.1811 Ang N21.N and P22.CD neighbor-bump: 2.13128 Ang N21.ND2 and P22.CD neighbor-bump: 2.09423 Ang N21.C and P22.CD self-bump: 1.28005 Ang P22.N and P22.CD other bump:2.78915 Ang Y20.C and P22.CD other bump:3.03103 Ang Y20.CB and P22.CD self-bump: 2.15233 Ang P22.N and P22.CG neighbor-bump: 2.50302 Ang I19.O and Y20.CD1 neighbor-bump: 2.47769 Ang I19.CB and Y20.N other bump:2.8714 Ang M13.CE and V15.CG1 other bump:2.57276 Ang I3.CD1 and M13.CE other bump:2.43301 Ang I3.CD1 and M13.SD neighbor-bump: 2.70854 Ang L9.C and R10.CG neighbor-bump: 2.23086 Ang L9.O and R10.CB neighbor-bump: 2.48507 Ang L9.C and R10.CB other bump:2.84159 Ang V4.CG1 and K8.NZ T0191 131 :TVLLKEAKKVNAKTINGLGMLIYQGAVAFK 1cydA 144 :PNLITYSSTKGAMTMLTKAMAMELGPHKIR Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 31 residues other bump:2.51823 Ang V28.CG1 and F30.CE1 other bump:2.62653 Ang V28.CG1 and F30.CD1 other bump:2.21336 Ang G20.O and Y24.CD1 neighbor-bump: 2.6436 Ang T2.C and V3.CB Number of specific fragments= 7 total=91 Number of alignments=15 # Reading fragments from alignment file # T0191 read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1cydA/T0191-1cydA-2track-protein-STR-global-adpstyle5.pw.a2m.gz # 1cydA read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1cydA/T0191-1cydA-2track-protein-STR-global-adpstyle5.pw.a2m.gz # found chain 1cydA in template set T0191 20 :RVKDKNIVIYGAG 1cydA 4 :NFSGLRALVTGAG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues T0191 33 :GAARAVAFELAK 1cydA 18 :GIGRDTVKALHA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKK 1cydA 31 :GAKVVAVTRTNSDLVSLAKECPGIEPVC Fragment has 28 clashes (null) has 28 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 30 residues other bump:2.35913 Ang V12.N and K29.NZ other bump:2.01342 Ang V12.CA and K29.NZ other bump:1.17289 Ang V12.CB and K29.NZ other bump:1.53911 Ang V12.CG1 and K29.NZ other bump:1.25603 Ang V12.CG2 and K29.NZ other bump:3.06242 Ang T11.C and K29.CE other bump:1.94247 Ang V12.N and K29.CE other bump:1.84487 Ang V12.CA and K29.CE other bump:1.71937 Ang V12.CB and K29.CE other bump:1.3082 Ang V12.CG1 and K29.CE other bump:2.69639 Ang V12.CG2 and K29.CE other bump:2.91086 Ang V12.CB and K29.CD other bump:1.67655 Ang V12.CG1 and K29.CD other bump:2.86538 Ang V12.CG1 and K29.CG other bump:2.48335 Ang I5.CD1 and K25.NZ other bump:2.18248 Ang I7.CG1 and K25.NZ other bump:1.72455 Ang I7.CD1 and K25.NZ other bump:2.2857 Ang I5.CD1 and K25.CE other bump:2.57236 Ang I5.CG1 and K25.CE other bump:2.09268 Ang I7.CG1 and K25.CE other bump:2.12582 Ang I7.CD1 and K25.CE other bump:2.88053 Ang I5.CD1 and K25.CD other bump:3.07312 Ang I5.CG1 and K25.CD other bump:3.15783 Ang I5.CG1 and K25.CG neighbor-bump: 2.28952 Ang A23.O and E24.CG neighbor-bump: 2.81687 Ang A23.C and E24.CG neighbor-bump: 3.05478 Ang E21.C and I22.CG1 other bump:2.79592 Ang I5.CD1 and I7.CD1 T0191 74 :GEEVKFSGLDVD 1cydA 59 :VDLGDWDATEKA Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:3.07981 Ang E4.CA and L10.CD2 other bump:2.63169 Ang E4.OE1 and L10.CD2 other bump:2.78259 Ang E4.CD and L10.CD2 other bump:2.95609 Ang E4.CA and L10.CD1 other bump:2.49321 Ang E4.O and L10.CD1 other bump:2.6863 Ang E3.CD and K6.CE other bump:2.41592 Ang E3.OE1 and K6.CE T0191 86 :LDGVDIIINATPIGMYPNIDVE 1cydA 74 :IGPVDLLVNNAALVIMQPFLEV Fragment has 11 clashes (null) has 11 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 24 residues other bump:1.9689 Ang A11.O and P13.CD other bump:2.62767 Ang A11.C and P13.CD neighbor-bump: 2.1246 Ang T12.CA and P13.CD neighbor-bump: 2.20012 Ang T12.O and P13.CD neighbor-bump: 1.41579 Ang T12.C and P13.CD other bump:2.45057 Ang A11.O and P13.CG neighbor-bump: 2.39862 Ang T12.O and P13.CG neighbor-bump: 2.3511 Ang T12.C and P13.CG neighbor-bump: 2.47861 Ang D3.CB and G4.N self-bump: 2.19176 Ang D3.CB and D3.C self-bump: 1.29723 Ang D3.CA and D3.CB T0191 108 :PIVKAEKLREDMVVMDL 1cydA 118 :VARDMINRGVPGSIVNV Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 19 residues other bump:2.8714 Ang M13.CE and V15.CG1 other bump:2.57276 Ang I3.CD1 and M13.CE other bump:2.43301 Ang I3.CD1 and M13.SD neighbor-bump: 2.70854 Ang L9.C and R10.CG neighbor-bump: 2.48507 Ang L9.C and R10.CB neighbor-bump: 2.23086 Ang L9.O and R10.CB other bump:2.84159 Ang V4.CG1 and K8.NZ T0191 125 :IYNPLETV 1cydA 136 :SMVAHVTF Fragment has 11 clashes (null) has 11 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 10 residues other bump:2.97458 Ang N4.CG and V9.CG2 other bump:2.09621 Ang N4.OD1 and V9.CG2 other bump:2.69464 Ang Y3.C and P5.CD other bump:1.59043 Ang I2.O and P5.CD other bump:3.28372 Ang I2.CA and P5.CD other bump:2.374 Ang I2.C and P5.CD neighbor-bump: 2.50644 Ang N4.N and P5.CD other bump:1.76404 Ang I2.O and P5.CG other bump:2.96441 Ang I2.C and P5.CG other bump:2.77415 Ang I2.CG2 and N4.N neighbor-bump: 3.02778 Ang G1.C and I2.CG1 T0191 133 :LLKEAKKVNAKTINGLGMLIYQ 1cydA 146 :LITYSSTKGAMTMLTKAMAMEL Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 24 residues other bump:2.21336 Ang G18.O and Y22.CD1 Number of specific fragments= 8 total=99 Number of alignments=16 # Reading fragments from alignment file # T0191 read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1ff9A/T0191-1ff9A-2track-protein-STR-local-adpstyle5.pw.a2m.gz # 1ff9A read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1ff9A/T0191-1ff9A-2track-protein-STR-local-adpstyle5.pw.a2m.gz # found chain 1ff9A in template set T0191 23 :DKNIVIYGAGGAARAVAFELAK 1ff9A 3 :TKSVLMLGSGFVTRPTLDVLTD Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 24 residues other bump:2.47698 Ang I5.CD1 and L21.CD1 other bump:2.82716 Ang R15.CG and F19.CZ other bump:2.38157 Ang R15.NE and F19.CZ other bump:2.87952 Ang R15.CG and F19.CE2 other bump:2.99735 Ang R15.CD and F19.CE2 other bump:2.27429 Ang R15.NE and F19.CE2 other bump:3.12943 Ang R15.CZ and F19.CE2 other bump:2.44894 Ang V6.CG1 and Y8.OH other bump:2.57918 Ang V6.CG1 and Y8.CZ other bump:2.81169 Ang V6.CG1 and Y8.CE1 T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKK 1ff9A 26 :GIKVTVACRTLESAKKLSAGVQHSTPIS Fragment has 33 clashes (null) has 33 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 30 residues other bump:3.08149 Ang T11.C and K29.CD other bump:2.61092 Ang R10.O and K29.CD other bump:2.96438 Ang T11.CA and K29.CD other bump:2.72308 Ang V12.N and K29.CD other bump:2.85131 Ang V12.N and K29.CG other bump:2.1743 Ang V12.CG2 and K29.CG other bump:2.31532 Ang I7.CG1 and N27.OD1 other bump:2.59361 Ang I7.CD1 and N27.OD1 other bump:2.4925 Ang A19.CB and N27.OD1 other bump:2.5622 Ang A19.CB and N27.ND2 other bump:2.84903 Ang A19.CB and N27.CG other bump:2.50901 Ang A15.O and N27.CG other bump:2.93406 Ang A15.C and N27.CG other bump:2.70886 Ang I7.CB and K25.NZ other bump:1.44641 Ang I7.CG1 and K25.NZ other bump:1.84148 Ang I7.CD1 and K25.NZ other bump:2.44083 Ang A19.CB and K25.NZ other bump:2.59486 Ang I7.CG1 and K25.CE other bump:1.96902 Ang I7.CD1 and K25.CE other bump:2.3557 Ang A19.CA and K25.CE other bump:1.50683 Ang A19.CB and K25.CE other bump:2.579 Ang A19.CA and K25.CD other bump:1.92171 Ang A19.CB and K25.CD other bump:2.50739 Ang E16.O and K20.CG other bump:2.94247 Ang I7.CD1 and A19.CB other bump:2.39144 Ang N9.ND2 and K14.NZ other bump:2.20145 Ang N9.ND2 and K14.CE other bump:1.44098 Ang N9.ND2 and K14.CD other bump:2.27746 Ang N9.CG and K14.CD other bump:2.57192 Ang N9.OD1 and K14.CD other bump:2.17406 Ang N9.ND2 and K14.CG other bump:2.75282 Ang N9.CG and K14.CG other bump:2.80008 Ang N9.CG and K14.CB T0191 74 :GEEVKFSGLDVDLDGVDIIINAT 1ff9A 54 :LDVNDDAALDAEVAKHDLVISLI Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 25 residues other bump:2.58717 Ang V17.CG1 and I19.O neighbor-bump: 2.44145 Ang D18.O and I19.CG2 other bump:2.8004 Ang V17.CG1 and I19.N other bump:2.75038 Ang E4.OE1 and L10.CD1 T0191 101 :YP 1ff9A 81 :HA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues T0191 108 :PIVKAEKLREDMVVMDLIYNPLETVLLKEAKKVNAKTINGLG 1ff9A 83 :TVIKSAIRQKKHVVTTSYVSPAMMELDQAAKDAGITVMNEIG Fragment has 34 clashes (null) has 34 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 44 residues other bump:3.03577 Ang M16.SD and N40.OD1 other bump:2.11026 Ang Y20.CD1 and N40.ND2 other bump:0.90171 Ang Y20.CE1 and N40.ND2 other bump:3.1025 Ang Y20.CE2 and N40.ND2 other bump:1.83973 Ang Y20.CZ and N40.ND2 other bump:2.3193 Ang Y20.OH and N40.ND2 other bump:2.66217 Ang Y20.CD1 and N40.CG other bump:1.70604 Ang Y20.CE1 and N40.CG other bump:2.6386 Ang Y20.OH and N40.CG other bump:3.03911 Ang Y20.CD1 and N40.CB other bump:2.28734 Ang Y20.CE1 and N40.CB other bump:2.93095 Ang Y20.CE2 and N40.CB other bump:2.21507 Ang Y20.CZ and N40.CB other bump:2.55247 Ang Y20.OH and N40.CB other bump:2.91574 Ang Y20.CZ and N40.CA other bump:2.51191 Ang Y20.OH and N40.CA other bump:2.70621 Ang Y20.CZ and N40.N other bump:1.65958 Ang Y20.OH and N40.N other bump:2.63681 Ang Y20.OH and I39.C other bump:2.6489 Ang K8.NZ and L27.CD2 other bump:2.87968 Ang K8.NZ and L27.CD1 other bump:2.30564 Ang K8.NZ and L27.CG other bump:2.76483 Ang K8.CE and L27.CB other bump:1.42576 Ang K8.NZ and L27.CB other bump:2.4554 Ang K8.NZ and L27.CA other bump:2.54715 Ang P22.O and V26.CG2 other bump:2.88229 Ang M16.CE and L18.CD1 other bump:2.76847 Ang E7.CG and V14.CG2 other bump:2.39354 Ang I3.O and E7.OE2 other bump:0.955899 Ang I3.O and E7.OE1 other bump:1.85571 Ang I3.C and E7.OE1 other bump:2.57732 Ang V4.CA and E7.OE1 other bump:1.86853 Ang I3.O and E7.CD other bump:2.75978 Ang I3.C and E7.CD Number of specific fragments= 5 total=104 Number of alignments=17 # Reading fragments from alignment file # T0191 read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1ff9A/T0191-1ff9A-2track-protein-STR-local-adpstyle1.pw.a2m.gz # 1ff9A read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1ff9A/T0191-1ff9A-2track-protein-STR-local-adpstyle1.pw.a2m.gz # found chain 1ff9A in template set T0191 24 :KNIVIYGAGGAARAVAFELAK 1ff9A 4 :KSVLMLGSGFVTRPTLDVLTD Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 23 residues other bump:2.47698 Ang I4.CD1 and L20.CD1 other bump:2.82716 Ang R14.CG and F18.CZ other bump:2.38157 Ang R14.NE and F18.CZ other bump:2.87952 Ang R14.CG and F18.CE2 other bump:2.99735 Ang R14.CD and F18.CE2 other bump:2.27429 Ang R14.NE and F18.CE2 other bump:3.12943 Ang R14.CZ and F18.CE2 other bump:2.44894 Ang V5.CG1 and Y7.OH other bump:2.57918 Ang V5.CG1 and Y7.CZ other bump:2.81169 Ang V5.CG1 and Y7.CE1 T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKK 1ff9A 26 :GIKVTVACRTLESAKKLSAGVQHSTPIS Fragment has 33 clashes (null) has 33 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 30 residues other bump:3.08149 Ang T11.C and K29.CD other bump:2.61092 Ang R10.O and K29.CD other bump:2.96438 Ang T11.CA and K29.CD other bump:2.72308 Ang V12.N and K29.CD other bump:2.85131 Ang V12.N and K29.CG other bump:2.1743 Ang V12.CG2 and K29.CG other bump:2.31532 Ang I7.CG1 and N27.OD1 other bump:2.59361 Ang I7.CD1 and N27.OD1 other bump:2.4925 Ang A19.CB and N27.OD1 other bump:2.5622 Ang A19.CB and N27.ND2 other bump:2.84903 Ang A19.CB and N27.CG other bump:2.50901 Ang A15.O and N27.CG other bump:2.93406 Ang A15.C and N27.CG other bump:2.70886 Ang I7.CB and K25.NZ other bump:1.44641 Ang I7.CG1 and K25.NZ other bump:1.84148 Ang I7.CD1 and K25.NZ other bump:2.44083 Ang A19.CB and K25.NZ other bump:2.59486 Ang I7.CG1 and K25.CE other bump:1.96902 Ang I7.CD1 and K25.CE other bump:2.3557 Ang A19.CA and K25.CE other bump:1.50683 Ang A19.CB and K25.CE other bump:2.579 Ang A19.CA and K25.CD other bump:1.92171 Ang A19.CB and K25.CD other bump:2.50739 Ang E16.O and K20.CG other bump:2.94247 Ang I7.CD1 and A19.CB other bump:2.39144 Ang N9.ND2 and K14.NZ other bump:2.20145 Ang N9.ND2 and K14.CE other bump:1.44098 Ang N9.ND2 and K14.CD other bump:2.27746 Ang N9.CG and K14.CD other bump:2.57192 Ang N9.OD1 and K14.CD other bump:2.17406 Ang N9.ND2 and K14.CG other bump:2.75282 Ang N9.CG and K14.CG other bump:2.80008 Ang N9.CG and K14.CB T0191 74 :GEEVKFSGLDVDLDGVDIIINAT 1ff9A 54 :LDVNDDAALDAEVAKHDLVISLI Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 25 residues other bump:2.58717 Ang V17.CG1 and I19.O neighbor-bump: 2.44145 Ang D18.O and I19.CG2 other bump:2.8004 Ang V17.CG1 and I19.N other bump:2.75038 Ang E4.OE1 and L10.CD1 T0191 101 :YP 1ff9A 81 :HA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues T0191 108 :PIVKAEKLREDMVVMDLIYNPLETVLLKEAKKVNAKTINGLG 1ff9A 83 :TVIKSAIRQKKHVVTTSYVSPAMMELDQAAKDAGITVMNEIG Fragment has 34 clashes (null) has 34 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 44 residues other bump:3.03577 Ang M16.SD and N40.OD1 other bump:2.11026 Ang Y20.CD1 and N40.ND2 other bump:0.90171 Ang Y20.CE1 and N40.ND2 other bump:3.1025 Ang Y20.CE2 and N40.ND2 other bump:1.83973 Ang Y20.CZ and N40.ND2 other bump:2.3193 Ang Y20.OH and N40.ND2 other bump:2.66217 Ang Y20.CD1 and N40.CG other bump:1.70604 Ang Y20.CE1 and N40.CG other bump:2.6386 Ang Y20.OH and N40.CG other bump:3.03911 Ang Y20.CD1 and N40.CB other bump:2.28734 Ang Y20.CE1 and N40.CB other bump:2.93095 Ang Y20.CE2 and N40.CB other bump:2.21507 Ang Y20.CZ and N40.CB other bump:2.55247 Ang Y20.OH and N40.CB other bump:2.91574 Ang Y20.CZ and N40.CA other bump:2.51191 Ang Y20.OH and N40.CA other bump:2.70621 Ang Y20.CZ and N40.N other bump:1.65958 Ang Y20.OH and N40.N other bump:2.63681 Ang Y20.OH and I39.C other bump:2.6489 Ang K8.NZ and L27.CD2 other bump:2.87968 Ang K8.NZ and L27.CD1 other bump:2.30564 Ang K8.NZ and L27.CG other bump:2.76483 Ang K8.CE and L27.CB other bump:1.42576 Ang K8.NZ and L27.CB other bump:2.4554 Ang K8.NZ and L27.CA other bump:2.54715 Ang P22.O and V26.CG2 other bump:2.88229 Ang M16.CE and L18.CD1 other bump:2.76847 Ang E7.CG and V14.CG2 other bump:2.39354 Ang I3.O and E7.OE2 other bump:0.955899 Ang I3.O and E7.OE1 other bump:1.85571 Ang I3.C and E7.OE1 other bump:2.57732 Ang V4.CA and E7.OE1 other bump:1.86853 Ang I3.O and E7.CD other bump:2.75978 Ang I3.C and E7.CD Number of specific fragments= 5 total=109 Number of alignments=18 # Reading fragments from alignment file # T0191 read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1jayA/T0191-1jayA-2track-protein-STR-global-adpstyle5.pw.a2m.gz # 1jayA read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1jayA/T0191-1jayA-2track-protein-STR-global-adpstyle5.pw.a2m.gz # adding 1jayA to template set 1jayA:Skipped atom 597, because occupancy 0.4 <= existing 0.600001 Skipped atom 599, because occupancy 0.4 <= existing 0.600001 Skipped atom 601, because occupancy 0.4 <= existing 0.600001 Skipped atom 603, because occupancy 0.4 <= existing 0.600001 Skipped atom 605, because occupancy 0.4 <= existing 0.600001 Skipped atom 607, because occupancy 0.4 <= existing 0.600001 Skipped atom 609, because occupancy 0.4 <= existing 0.600001 Skipped atom 611, because occupancy 0.4 <= existing 0.600001 Skipped atom 613, because occupancy 0.4 <= existing 0.600001 Skipped atom 615, because occupancy 0.4 <= existing 0.600001 Skipped atom 617, because occupancy 0.4 <= existing 0.600001 Skipped atom 1170, because occupancy 0.45 <= existing 0.550001 Skipped atom 1172, because occupancy 0.45 <= existing 0.550001 Skipped atom 1174, because occupancy 0.45 <= existing 0.550001 Skipped atom 1176, because occupancy 0.45 <= existing 0.550001 Skipped atom 1178, because occupancy 0.45 <= existing 0.550001 Skipped atom 1180, because occupancy 0.45 <= existing 0.550001 Skipped atom 1310, because occupancy 0.4 <= existing 0.600001 Skipped atom 1312, because occupancy 0.4 <= existing 0.600001 Skipped atom 1314, because occupancy 0.4 <= existing 0.600001 Skipped atom 1316, because occupancy 0.4 <= existing 0.600001 Skipped atom 1318, because occupancy 0.4 <= existing 0.600001 Skipped atom 1320, because occupancy 0.4 <= existing 0.600001 Skipped atom 1322, because occupancy 0.4 <= existing 0.600001 Skipped atom 1324, because occupancy 0.4 <= existing 0.600001 Skipped atom 1410, because occupancy 0.3 <= existing 0.700001 Skipped atom 1412, because occupancy 0.3 <= existing 0.700001 Skipped atom 1414, because occupancy 0.3 <= existing 0.700001 Skipped atom 1416, because occupancy 0.3 <= existing 0.700001 Skipped atom 1418, because occupancy 0.3 <= existing 0.700001 Skipped atom 1420, because occupancy 0.3 <= existing 0.700001 Skipped atom 1600, because occupancy 0.5 <= existing 0.500001 Skipped atom 1602, because occupancy 0.5 <= existing 0.500001 Skipped atom 1604, because occupancy 0.5 <= existing 0.500001 Skipped atom 1606, because occupancy 0.5 <= existing 0.500001 Skipped atom 1608, because occupancy 0.5 <= existing 0.500001 Skipped atom 1610, because occupancy 0.5 <= existing 0.500001 Skipped atom 1612, because occupancy 0.5 <= existing 0.500001 Skipped atom 1614, because occupancy 0.5 <= existing 0.500001 # found chain 1jayA in template set T0191 25 :NIVIYGA 1jayA 2 :RVALLGG Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 9 residues other bump:2.26145 Ang I5.O and A8.CB other bump:3.09585 Ang I5.C and A8.CB other bump:2.8295 Ang I5.CB and A8.CB T0191 32 :GGAARAVAFELAK 1jayA 10 :GNLGKGLALRLAT Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGLDVD 1jayA 24 :GHEIVVGSRREEKAEAKAAEYRRIAGDASITGMKNEDAAEA Fragment has 65 clashes (null) has 65 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 43 residues other bump:2.73282 Ang I6.CB and L39.CD2 other bump:1.51995 Ang I6.CG1 and L39.CD2 other bump:1.92903 Ang I6.CD1 and L39.CD2 other bump:2.17771 Ang V34.CG2 and L39.CD2 other bump:1.90456 Ang A8.CA and L39.CD1 other bump:2.28081 Ang A8.CB and L39.CD1 other bump:2.50061 Ang I7.C and L39.CD1 other bump:2.21443 Ang A8.N and L39.CD1 other bump:2.49815 Ang I7.O and L39.CD1 other bump:3.02789 Ang I6.CG1 and L39.CG other bump:2.18962 Ang V34.CG2 and L39.CG other bump:3.23643 Ang A8.C and F36.CZ other bump:2.83621 Ang N9.CA and F36.CE2 other bump:2.84976 Ang N9.C and F36.CE2 other bump:2.96489 Ang R10.N and F36.CE2 other bump:3.08046 Ang A8.CB and F36.CE1 other bump:3.20197 Ang A8.C and F36.CE1 other bump:3.27579 Ang N9.CA and F36.CD2 other bump:2.83723 Ang N9.C and F36.CD2 other bump:2.66909 Ang A8.CB and F36.CD1 other bump:2.82855 Ang I6.CD1 and V34.CG2 other bump:1.03868 Ang A15.N and E33.OE2 other bump:1.40164 Ang A15.CA and E33.OE2 other bump:2.30971 Ang A15.CB and E33.OE2 other bump:1.76044 Ang A15.C and E33.OE2 other bump:1.80472 Ang E16.N and E33.OE2 other bump:1.92814 Ang K14.C and E33.OE2 other bump:1.95477 Ang A15.C and E33.OE1 other bump:0.640383 Ang E16.N and E33.OE1 other bump:1.14293 Ang E16.CA and E33.OE1 other bump:2.2803 Ang E16.C and E33.OE1 other bump:1.83439 Ang E16.CB and E33.OE1 other bump:2.25518 Ang A15.N and E33.CD other bump:1.85163 Ang A15.CA and E33.CD other bump:2.44784 Ang A15.CB and E33.CD other bump:2.34296 Ang A15.O and E33.CD other bump:1.18326 Ang A15.C and E33.CD other bump:0.740274 Ang E16.N and E33.CD other bump:2.19358 Ang E16.CA and E33.CD other bump:3.16208 Ang E16.C and E33.CD other bump:3.04467 Ang E16.CB and E33.CD other bump:3.00048 Ang K14.C and E33.CD other bump:3.13486 Ang A15.N and E33.CG other bump:2.05368 Ang A15.CA and E33.CG other bump:1.8522 Ang A15.CB and E33.CG other bump:2.28212 Ang A15.O and E33.CG other bump:1.60349 Ang A15.C and E33.CG other bump:1.9129 Ang E16.N and E33.CG other bump:2.93229 Ang E16.CA and E33.CG other bump:2.3601 Ang A15.O and E33.CB other bump:2.35824 Ang A15.C and E33.CB other bump:2.48045 Ang E16.N and E33.CB other bump:2.7196 Ang E16.CA and E33.CB other bump:2.02038 Ang F30.CZ and E32.OE1 other bump:2.37178 Ang F30.CE1 and E32.OE1 other bump:3.0507 Ang F30.CZ and E32.CD other bump:2.28724 Ang L26.CD1 and K29.NZ other bump:2.71608 Ang L26.CD1 and K29.CE other bump:2.22039 Ang L26.CD1 and K29.CD neighbor-bump: 2.25362 Ang L26.O and N27.CB neighbor-bump: 2.63962 Ang L26.C and N27.CB other bump:3.05244 Ang I7.CD1 and A19.CA other bump:2.66412 Ang I7.CD1 and A19.N other bump:2.84289 Ang N9.ND2 and K14.CD other bump:2.22957 Ang N9.OD1 and T11.N T0191 86 :LDGVDIIINATPIGMYPNIDVE 1jayA 87 :ILREKIVVSPLVPVSRGAKGFT Fragment has 14 clashes (null) has 14 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 24 residues other bump:2.68385 Ang P18.CG and D21.C other bump:3.05477 Ang P18.CD and D21.C other bump:1.46414 Ang P18.CG and D21.O other bump:2.06321 Ang P18.CD and D21.O neighbor-bump: 2.30614 Ang I20.O and D21.OD2 neighbor-bump: 1.9546 Ang I20.O and D21.CG neighbor-bump: 2.69259 Ang I20.C and D21.CG neighbor-bump: 2.2079 Ang I20.O and D21.CB neighbor-bump: 2.64037 Ang I20.C and D21.CB neighbor-bump: 2.30896 Ang Y17.CA and P18.CD neighbor-bump: 1.7837 Ang Y17.C and P18.CD other bump:2.43631 Ang A11.O and P13.CD neighbor-bump: 2.05435 Ang T12.C and P13.CD neighbor-bump: 2.81577 Ang T12.C and P13.CG T0191 109 :IVKAEKLR 1jayA 134 :TIPAARFA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 10 residues T0191 117 :EDMVVMDLIYNPLETVLLKEAKKV 1jayA 144 :DEKFDWDVPVCGDDDESKKVVMSL Fragment has 17 clashes (null) has 17 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 26 residues other bump:2.89212 Ang P13.CG and L19.CD2 other bump:3.00216 Ang P13.CD and L19.CD1 other bump:2.32612 Ang P13.CG and L19.CD1 other bump:2.85749 Ang P13.CG and L19.CG neighbor-bump: 2.03033 Ang N12.CA and P13.CD neighbor-bump: 1.19346 Ang N12.C and P13.CD neighbor-bump: 1.8841 Ang N12.O and P13.CD neighbor-bump: 2.44948 Ang N12.C and P13.CG neighbor-bump: 2.68494 Ang N12.C and P13.CB other bump:2.75126 Ang L9.CD1 and Y11.OH other bump:2.44695 Ang L9.CD1 and Y11.CZ other bump:2.55791 Ang L9.CD1 and Y11.CE1 other bump:2.52587 Ang L9.O and Y11.CE1 other bump:3.22208 Ang L9.C and Y11.CE1 other bump:2.30606 Ang L9.O and Y11.CD1 other bump:3.13334 Ang V5.CG1 and M7.SD other bump:2.85423 Ang V5.CG1 and M7.CG T0191 141 :NAKTING 1jayA 173 :GLRPLDA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 9 residues Number of specific fragments= 7 total=116 Number of alignments=19 # Reading fragments from alignment file # T0191 read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1jayA/T0191-1jayA-2track-protein-STR-global-adpstyle1.pw.a2m.gz # 1jayA read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1jayA/T0191-1jayA-2track-protein-STR-global-adpstyle1.pw.a2m.gz # found chain 1jayA in template set T0191 25 :NIVIYGA 1jayA 2 :RVALLGG Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 9 residues other bump:2.26145 Ang I5.O and A8.CB other bump:3.09585 Ang I5.C and A8.CB other bump:2.8295 Ang I5.CB and A8.CB T0191 32 :GGAARAVAFELAK 1jayA 10 :GNLGKGLALRLAT Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGLDVD 1jayA 24 :GHEIVVGSRREEKAEAKAAEYRRIAGDASITGMKNEDAAEA Fragment has 65 clashes (null) has 65 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 43 residues other bump:2.73282 Ang I6.CB and L39.CD2 other bump:1.51995 Ang I6.CG1 and L39.CD2 other bump:1.92903 Ang I6.CD1 and L39.CD2 other bump:2.17771 Ang V34.CG2 and L39.CD2 other bump:1.90456 Ang A8.CA and L39.CD1 other bump:2.28081 Ang A8.CB and L39.CD1 other bump:2.50061 Ang I7.C and L39.CD1 other bump:2.21443 Ang A8.N and L39.CD1 other bump:2.49815 Ang I7.O and L39.CD1 other bump:3.02789 Ang I6.CG1 and L39.CG other bump:2.18962 Ang V34.CG2 and L39.CG other bump:3.23643 Ang A8.C and F36.CZ other bump:2.83621 Ang N9.CA and F36.CE2 other bump:2.84976 Ang N9.C and F36.CE2 other bump:2.96489 Ang R10.N and F36.CE2 other bump:3.08046 Ang A8.CB and F36.CE1 other bump:3.20197 Ang A8.C and F36.CE1 other bump:3.27579 Ang N9.CA and F36.CD2 other bump:2.83723 Ang N9.C and F36.CD2 other bump:2.66909 Ang A8.CB and F36.CD1 other bump:2.82855 Ang I6.CD1 and V34.CG2 other bump:1.03868 Ang A15.N and E33.OE2 other bump:1.40164 Ang A15.CA and E33.OE2 other bump:2.30971 Ang A15.CB and E33.OE2 other bump:1.76044 Ang A15.C and E33.OE2 other bump:1.80472 Ang E16.N and E33.OE2 other bump:1.92814 Ang K14.C and E33.OE2 other bump:1.95477 Ang A15.C and E33.OE1 other bump:0.640383 Ang E16.N and E33.OE1 other bump:1.14293 Ang E16.CA and E33.OE1 other bump:2.2803 Ang E16.C and E33.OE1 other bump:1.83439 Ang E16.CB and E33.OE1 other bump:2.25518 Ang A15.N and E33.CD other bump:1.85163 Ang A15.CA and E33.CD other bump:2.44784 Ang A15.CB and E33.CD other bump:2.34296 Ang A15.O and E33.CD other bump:1.18326 Ang A15.C and E33.CD other bump:0.740274 Ang E16.N and E33.CD other bump:2.19358 Ang E16.CA and E33.CD other bump:3.16208 Ang E16.C and E33.CD other bump:3.04467 Ang E16.CB and E33.CD other bump:3.00048 Ang K14.C and E33.CD other bump:3.13486 Ang A15.N and E33.CG other bump:2.05368 Ang A15.CA and E33.CG other bump:1.8522 Ang A15.CB and E33.CG other bump:2.28212 Ang A15.O and E33.CG other bump:1.60349 Ang A15.C and E33.CG other bump:1.9129 Ang E16.N and E33.CG other bump:2.93229 Ang E16.CA and E33.CG other bump:2.3601 Ang A15.O and E33.CB other bump:2.35824 Ang A15.C and E33.CB other bump:2.48045 Ang E16.N and E33.CB other bump:2.7196 Ang E16.CA and E33.CB other bump:2.02038 Ang F30.CZ and E32.OE1 other bump:2.37178 Ang F30.CE1 and E32.OE1 other bump:3.0507 Ang F30.CZ and E32.CD other bump:2.28724 Ang L26.CD1 and K29.NZ other bump:2.71608 Ang L26.CD1 and K29.CE other bump:2.22039 Ang L26.CD1 and K29.CD neighbor-bump: 2.25362 Ang L26.O and N27.CB neighbor-bump: 2.63962 Ang L26.C and N27.CB other bump:3.05244 Ang I7.CD1 and A19.CA other bump:2.66412 Ang I7.CD1 and A19.N other bump:2.84289 Ang N9.ND2 and K14.CD other bump:2.22957 Ang N9.OD1 and T11.N T0191 86 :LDGVDIIINATPIGMYPNIDVE 1jayA 87 :ILREKIVVSPLVPVSRGAKGFT Fragment has 14 clashes (null) has 14 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 24 residues other bump:2.68385 Ang P18.CG and D21.C other bump:3.05477 Ang P18.CD and D21.C other bump:1.46414 Ang P18.CG and D21.O other bump:2.06321 Ang P18.CD and D21.O neighbor-bump: 2.30614 Ang I20.O and D21.OD2 neighbor-bump: 1.9546 Ang I20.O and D21.CG neighbor-bump: 2.69259 Ang I20.C and D21.CG neighbor-bump: 2.2079 Ang I20.O and D21.CB neighbor-bump: 2.64037 Ang I20.C and D21.CB neighbor-bump: 2.30896 Ang Y17.CA and P18.CD neighbor-bump: 1.7837 Ang Y17.C and P18.CD other bump:2.43631 Ang A11.O and P13.CD neighbor-bump: 2.05435 Ang T12.C and P13.CD neighbor-bump: 2.81577 Ang T12.C and P13.CG T0191 108 :PIVKAEKLR 1jayA 133 :HTIPAARFA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues T0191 117 :EDMVVMDLIYNPLETVLLKEAKKV 1jayA 144 :DEKFDWDVPVCGDDDESKKVVMSL Fragment has 17 clashes (null) has 17 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 26 residues other bump:2.89212 Ang P13.CG and L19.CD2 other bump:3.00216 Ang P13.CD and L19.CD1 other bump:2.32612 Ang P13.CG and L19.CD1 other bump:2.85749 Ang P13.CG and L19.CG neighbor-bump: 2.03033 Ang N12.CA and P13.CD neighbor-bump: 1.19346 Ang N12.C and P13.CD neighbor-bump: 1.8841 Ang N12.O and P13.CD neighbor-bump: 2.44948 Ang N12.C and P13.CG neighbor-bump: 2.68494 Ang N12.C and P13.CB other bump:2.75126 Ang L9.CD1 and Y11.OH other bump:2.44695 Ang L9.CD1 and Y11.CZ other bump:2.55791 Ang L9.CD1 and Y11.CE1 other bump:2.52587 Ang L9.O and Y11.CE1 other bump:3.22208 Ang L9.C and Y11.CE1 other bump:2.30606 Ang L9.O and Y11.CD1 other bump:3.13334 Ang V5.CG1 and M7.SD other bump:2.85423 Ang V5.CG1 and M7.CG T0191 141 :NAKTINGLGMLIYQGAVAFK 1jayA 173 :GLRPLDAGPLSNSRLVESLT Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 21 residues other bump:2.61207 Ang L9.CB and I13.CD1 Number of specific fragments= 7 total=123 Number of alignments=20 # Reading fragments from alignment file # T0191 read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1ybvA/T0191-1ybvA-2track-protein-STR-global-adpstyle5.pw.a2m.gz # 1ybvA read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1ybvA/T0191-1ybvA-2track-protein-STR-global-adpstyle5.pw.a2m.gz # adding 1ybvA to template set 1ybvA:# found chain 1ybvA in template set T0191 17 :EIG 1ybvA 15 :AIP Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 5 residues T0191 21 :VKDKNIVIYGAG 1ybvA 27 :LEGKVALVTGAG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues T0191 33 :GAARAVAFELAK 1ybvA 40 :GIGREMAMELGR Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:2.6813 Ang R5.NE and F9.CE2 T0191 45 :DNNIIIANRT 1ybvA 53 :GCKVIVNYAN Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 12 residues self-bump: 1.3821 Ang R10.CA and R10.CB T0191 55 :VEKAEALAKEIAEKLNKKFGEEVK 1ybvA 64 :TESAEEVVAAIKKNGSDAACVKAN Fragment has 21 clashes (null) has 21 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 26 residues neighbor-bump: 2.91478 Ang E23.C and V24.CG2 neighbor-bump: 2.53248 Ang E23.O and V24.CG2 other bump:1.53548 Ang L8.O and K19.NZ other bump:2.03666 Ang L8.C and K19.NZ other bump:2.14856 Ang A9.N and K19.NZ other bump:1.81125 Ang A9.CA and K19.NZ other bump:2.11459 Ang K10.N and K19.NZ other bump:1.87903 Ang A9.O and K19.NZ other bump:1.39854 Ang A9.C and K19.NZ other bump:2.85306 Ang A9.N and K19.CE other bump:1.72317 Ang A9.CA and K19.CE other bump:2.83049 Ang A9.CB and K19.CE other bump:2.78008 Ang K10.N and K19.CE other bump:1.25267 Ang A9.O and K19.CE other bump:1.48483 Ang A9.C and K19.CE other bump:2.92861 Ang A9.N and K19.CD other bump:1.96387 Ang A9.CA and K19.CD other bump:2.79173 Ang A9.CB and K19.CD other bump:2.72578 Ang A9.C and K19.CD other bump:2.9624 Ang A9.CA and K19.CG other bump:3.06467 Ang A9.CB and K19.CG T0191 79 :FSGLDVDLDGVDIIINATPIGMYPNIDVE 1ybvA 98 :FEEAVKIFGKLDIVCSNSGVVSFGHVKDV Fragment has 24 clashes (null) has 24 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 31 residues other bump:1.71953 Ang N26.CG and D28.OD1 other bump:0.823298 Ang N26.OD1 and D28.OD1 other bump:2.41049 Ang N26.CB and D28.OD1 other bump:2.84032 Ang N26.CG and D28.CG other bump:1.84714 Ang N26.OD1 and D28.CG neighbor-bump: 2.63947 Ang Y24.N and P25.CD neighbor-bump: 2.07167 Ang Y24.CA and P25.CD neighbor-bump: 1.67303 Ang Y24.O and P25.CD neighbor-bump: 1.11153 Ang Y24.C and P25.CD neighbor-bump: 2.22951 Ang Y24.O and P25.CG neighbor-bump: 2.36997 Ang Y24.C and P25.CG neighbor-bump: 2.63691 Ang Y24.C and P25.CB neighbor-bump: 2.15787 Ang T19.O and P20.CD neighbor-bump: 1.33716 Ang T19.C and P20.CD other bump:2.09619 Ang A18.O and P20.CD other bump:2.72974 Ang A18.C and P20.CD neighbor-bump: 2.01921 Ang T19.CA and P20.CD neighbor-bump: 2.2784 Ang T19.O and P20.CG neighbor-bump: 2.23718 Ang T19.C and P20.CG other bump:2.14038 Ang A18.O and P20.CG other bump:3.18769 Ang A18.C and P20.CG other bump:2.771 Ang D6.OD1 and V12.CG2 self-bump: 1.39746 Ang D10.CA and D10.CB self-bump: 1.36358 Ang D8.CA and D8.CB T0191 108 :PIVKAEKLREDMVVMDLIYNPLETVLLKEAKKVNAKTINGL 1ybvA 190 :RCMAIDMADKKITVNVVAPGGIKTDMYHAVCREYIPNGENL Fragment has 28 clashes (null) has 28 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 43 residues other bump:2.93773 Ang I39.CB and L42.CD1 other bump:2.67613 Ang I39.CG2 and L42.CD1 other bump:2.96235 Ang A36.N and I39.CD1 other bump:2.33098 Ang A36.CB and I39.CD1 other bump:2.27761 Ang K33.O and I39.CD1 other bump:2.25217 Ang K33.CA and I39.CD1 other bump:2.51902 Ang K33.C and I39.CD1 other bump:2.41419 Ang A36.CB and I39.CG2 other bump:2.90666 Ang A36.CB and I39.CG1 other bump:3.01599 Ang K33.CA and I39.CG1 other bump:3.02563 Ang K33.C and I39.CG1 other bump:3.1197 Ang A36.CB and I39.CB neighbor-bump: 2.18767 Ang K37.O and T38.OG1 neighbor-bump: 2.7807 Ang K37.C and T38.OG1 other bump:2.87162 Ang L28.CD2 and K32.CE neighbor-bump: 1.93157 Ang N21.CA and P22.CD neighbor-bump: 1.14799 Ang N21.O and P22.CD neighbor-bump: 0.738688 Ang N21.C and P22.CD neighbor-bump: 2.05258 Ang N21.O and P22.CG neighbor-bump: 2.19877 Ang N21.C and P22.CG other bump:2.3645 Ang L18.CD2 and Y20.OH other bump:2.52211 Ang L18.CD2 and Y20.CZ other bump:2.77287 Ang L18.CD2 and Y20.CE1 other bump:2.92563 Ang K8.CD and V15.CG2 other bump:2.55839 Ang K5.O and L9.CD2 other bump:1.94535 Ang K5.O and L9.CD1 other bump:2.68967 Ang V4.CG1 and K8.CE other bump:2.07156 Ang V4.CG1 and K8.CD Number of specific fragments= 7 total=130 Number of alignments=21 # Reading fragments from alignment file # T0191 read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1ybvA/T0191-1ybvA-2track-protein-STR-global-adpstyle1.pw.a2m.gz # 1ybvA read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1ybvA/T0191-1ybvA-2track-protein-STR-global-adpstyle1.pw.a2m.gz # found chain 1ybvA in template set T0191 17 :EIGR 1ybvA 15 :AIPG Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 6 residues neighbor-bump: 1.5086 Ang G4.O and R5.CG neighbor-bump: 2.5065 Ang G4.C and R5.CG neighbor-bump: 2.30352 Ang G4.O and R5.CB neighbor-bump: 2.67118 Ang G4.C and R5.CB T0191 21 :VKDKNIVIYGAG 1ybvA 27 :LEGKVALVTGAG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues T0191 33 :GAARAVAFELAK 1ybvA 40 :GIGREMAMELGR Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:2.6813 Ang R5.NE and F9.CE2 T0191 45 :DNNIIIANRT 1ybvA 53 :GCKVIVNYAN Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 12 residues self-bump: 1.3821 Ang R10.CA and R10.CB T0191 55 :VEKAEALAKEIAEKLNKKFGEEVK 1ybvA 64 :TESAEEVVAAIKKNGSDAACVKAN Fragment has 21 clashes (null) has 21 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 26 residues neighbor-bump: 2.91478 Ang E23.C and V24.CG2 neighbor-bump: 2.53248 Ang E23.O and V24.CG2 other bump:1.53548 Ang L8.O and K19.NZ other bump:2.03666 Ang L8.C and K19.NZ other bump:2.14856 Ang A9.N and K19.NZ other bump:1.81125 Ang A9.CA and K19.NZ other bump:2.11459 Ang K10.N and K19.NZ other bump:1.87903 Ang A9.O and K19.NZ other bump:1.39854 Ang A9.C and K19.NZ other bump:2.85306 Ang A9.N and K19.CE other bump:1.72317 Ang A9.CA and K19.CE other bump:2.83049 Ang A9.CB and K19.CE other bump:2.78008 Ang K10.N and K19.CE other bump:1.25267 Ang A9.O and K19.CE other bump:1.48483 Ang A9.C and K19.CE other bump:2.92861 Ang A9.N and K19.CD other bump:1.96387 Ang A9.CA and K19.CD other bump:2.79173 Ang A9.CB and K19.CD other bump:2.72578 Ang A9.C and K19.CD other bump:2.9624 Ang A9.CA and K19.CG other bump:3.06467 Ang A9.CB and K19.CG T0191 79 :FSGLDVDLDGVDIIINATPIGMYPNIDVE 1ybvA 98 :FEEAVKIFGKLDIVCSNSGVVSFGHVKDV Fragment has 24 clashes (null) has 24 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 31 residues other bump:1.71953 Ang N26.CG and D28.OD1 other bump:0.823298 Ang N26.OD1 and D28.OD1 other bump:2.41049 Ang N26.CB and D28.OD1 other bump:2.84032 Ang N26.CG and D28.CG other bump:1.84714 Ang N26.OD1 and D28.CG neighbor-bump: 2.63947 Ang Y24.N and P25.CD neighbor-bump: 2.07167 Ang Y24.CA and P25.CD neighbor-bump: 1.67303 Ang Y24.O and P25.CD neighbor-bump: 1.11153 Ang Y24.C and P25.CD neighbor-bump: 2.22951 Ang Y24.O and P25.CG neighbor-bump: 2.36997 Ang Y24.C and P25.CG neighbor-bump: 2.63691 Ang Y24.C and P25.CB neighbor-bump: 2.15787 Ang T19.O and P20.CD neighbor-bump: 1.33716 Ang T19.C and P20.CD other bump:2.09619 Ang A18.O and P20.CD other bump:2.72974 Ang A18.C and P20.CD neighbor-bump: 2.01921 Ang T19.CA and P20.CD neighbor-bump: 2.2784 Ang T19.O and P20.CG neighbor-bump: 2.23718 Ang T19.C and P20.CG other bump:2.14038 Ang A18.O and P20.CG other bump:3.18769 Ang A18.C and P20.CG other bump:2.771 Ang D6.OD1 and V12.CG2 self-bump: 1.39746 Ang D10.CA and D10.CB self-bump: 1.36358 Ang D8.CA and D8.CB T0191 108 :PIVKAEKLREDMVVMDLIYNPLETVLLKEAKKVNAKTINGLGMLIYQGAVAFK 1ybvA 190 :RCMAIDMADKKITVNVVAPGGIKTDMYHAVCREYIPNGENLSNEEVDEYAAVQ Fragment has 59 clashes (null) has 59 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 54 residues neighbor-bump: 2.88491 Ang F53.CE2 and K54.NZ other bump:1.4857 Ang K32.NZ and V51.CG2 other bump:3.14252 Ang K32.CD and V51.CG2 other bump:2.26965 Ang K32.CE and V51.CG2 other bump:3.00377 Ang K32.NZ and V51.CG1 other bump:2.28524 Ang K32.NZ and V51.CB other bump:2.09178 Ang E24.OE1 and Q48.OE1 other bump:2.24995 Ang K32.CB and Y47.OH other bump:1.70064 Ang K32.CG and Y47.OH other bump:1.76535 Ang K32.CD and Y47.OH other bump:2.30367 Ang L28.CD2 and Y47.OH other bump:1.84767 Ang K32.CE and Y47.OH other bump:2.80386 Ang K32.NZ and Y47.CZ other bump:2.15631 Ang K32.CB and Y47.CZ other bump:1.37245 Ang K32.CG and Y47.CZ other bump:0.493428 Ang K32.CD and Y47.CZ other bump:1.63819 Ang K32.CE and Y47.CZ other bump:2.52286 Ang K32.NZ and Y47.CE2 other bump:2.72818 Ang K32.CG and Y47.CE2 other bump:1.31416 Ang K32.CD and Y47.CE2 other bump:1.90471 Ang K32.CE and Y47.CE2 other bump:1.96352 Ang K32.CB and Y47.CE1 other bump:0.987164 Ang K32.CG and Y47.CE1 other bump:1.27625 Ang K32.CD and Y47.CE1 other bump:2.61872 Ang K32.CE and Y47.CE1 other bump:2.13249 Ang K32.CD and Y47.CD2 other bump:2.95195 Ang K32.CE and Y47.CD2 other bump:3.01696 Ang K32.CB and Y47.CD1 other bump:2.36513 Ang K32.CG and Y47.CD1 other bump:2.13368 Ang K32.CD and Y47.CD1 other bump:2.47306 Ang K32.CD and Y47.CG other bump:2.67613 Ang I39.CG2 and L42.CD1 other bump:2.93773 Ang I39.CB and L42.CD1 other bump:2.33098 Ang A36.CB and I39.CD1 other bump:2.96235 Ang A36.N and I39.CD1 other bump:2.25217 Ang K33.CA and I39.CD1 other bump:2.27761 Ang K33.O and I39.CD1 other bump:2.51902 Ang K33.C and I39.CD1 other bump:2.41419 Ang A36.CB and I39.CG2 other bump:2.90666 Ang A36.CB and I39.CG1 other bump:3.01599 Ang K33.CA and I39.CG1 other bump:3.02563 Ang K33.C and I39.CG1 other bump:3.1197 Ang A36.CB and I39.CB neighbor-bump: 2.18767 Ang K37.O and T38.OG1 neighbor-bump: 2.7807 Ang K37.C and T38.OG1 other bump:2.87162 Ang L28.CD2 and K32.CE neighbor-bump: 1.93157 Ang N21.CA and P22.CD neighbor-bump: 1.14799 Ang N21.O and P22.CD neighbor-bump: 0.738688 Ang N21.C and P22.CD neighbor-bump: 2.05258 Ang N21.O and P22.CG neighbor-bump: 2.19877 Ang N21.C and P22.CG other bump:2.3645 Ang L18.CD2 and Y20.OH other bump:2.52211 Ang L18.CD2 and Y20.CZ other bump:2.77287 Ang L18.CD2 and Y20.CE1 other bump:2.92563 Ang K8.CD and V15.CG2 other bump:2.55839 Ang K5.O and L9.CD2 other bump:1.94535 Ang K5.O and L9.CD1 other bump:2.68967 Ang V4.CG1 and K8.CE other bump:2.07156 Ang V4.CG1 and K8.CD Number of specific fragments= 7 total=137 Number of alignments=22 # Reading fragments from alignment file # T0191 read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1g0oA/T0191-1g0oA-2track-protein-STR-global-adpstyle1.pw.a2m.gz # 1g0oA read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1g0oA/T0191-1g0oA-2track-protein-STR-global-adpstyle1.pw.a2m.gz # adding 1g0oA to template set 1g0oA:# found chain 1g0oA in template set T0191 16 :EEIGR 1g0oA 13 :YDAIP Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 7 residues T0191 21 :VKDKNIVIYGAG 1g0oA 27 :LEGKVALVTGAG Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:3.00792 Ang I9.CD1 and A12.CB other bump:2.89438 Ang I9.CG1 and A12.CB T0191 33 :GAARAVAFELAK 1g0oA 40 :GIGREMAMELGR Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:2.55297 Ang R5.NE and F9.CZ other bump:2.70148 Ang R5.NE and F9.CE2 T0191 45 :DNNIIIANRT 1g0oA 53 :GCKVIVNYAN Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 12 residues other bump:2.89591 Ang N3.CG and I5.CG2 other bump:1.87682 Ang N3.OD1 and I5.CG2 neighbor-bump: 2.64326 Ang N3.CG and N4.O T0191 55 :VEKAEALAKEIAEKLNKKFGEEVK 1g0oA 64 :TESAEEVVAAIKKNGSDAACVKAN Fragment has 27 clashes (null) has 27 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 26 residues neighbor-bump: 2.53664 Ang E23.O and V24.CG2 neighbor-bump: 2.91904 Ang E23.C and V24.CG2 other bump:3.0445 Ang K18.CG and F20.CE2 other bump:2.88373 Ang K18.CD and F20.CE2 other bump:1.76238 Ang L8.O and K19.NZ other bump:1.72085 Ang A9.O and K19.NZ other bump:1.24139 Ang A9.C and K19.NZ other bump:1.78859 Ang K10.N and K19.NZ other bump:2.68903 Ang K10.CA and K19.NZ other bump:2.72142 Ang K10.C and K19.NZ other bump:2.18664 Ang L8.C and K19.NZ other bump:2.27884 Ang A9.N and K19.NZ other bump:1.99971 Ang A9.CA and K19.NZ other bump:0.892189 Ang A9.O and K19.CE other bump:1.13665 Ang A9.C and K19.CE other bump:2.42999 Ang K10.N and K19.CE other bump:2.80158 Ang A9.N and K19.CE other bump:1.7045 Ang A9.CA and K19.CE other bump:2.85676 Ang A9.CB and K19.CE other bump:2.37089 Ang A9.O and K19.CD other bump:2.31453 Ang A9.C and K19.CD other bump:3.11559 Ang L8.C and K19.CD other bump:2.61941 Ang A9.N and K19.CD other bump:1.6005 Ang A9.CA and K19.CD other bump:2.60367 Ang A9.CB and K19.CD other bump:2.60469 Ang A9.CA and K19.CG other bump:2.76879 Ang A9.CB and K19.CG T0191 79 :FSGLDVDLDGVDIIINATPIGMYPNIDVEPI 1g0oA 98 :FEEAVKIFGKLDIVCSNSGVVSFGHVKDVTP Fragment has 35 clashes (null) has 35 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 33 residues other bump:2.37608 Ang I27.N and E30.OE2 other bump:2.51178 Ang I27.CA and E30.OE2 other bump:2.35461 Ang P25.O and E30.OE2 other bump:2.34704 Ang N26.O and E30.OE2 other bump:2.32965 Ang N26.C and E30.OE2 other bump:2.13596 Ang I27.CA and E30.OE1 other bump:1.73857 Ang I27.O and E30.OE1 other bump:2.05527 Ang I27.C and E30.OE1 other bump:2.63719 Ang I27.CA and E30.CD other bump:2.56776 Ang N26.O and E30.CD other bump:3.01843 Ang N26.C and E30.CD other bump:3.03773 Ang I27.C and E30.CD other bump:1.93716 Ang N26.CG and D28.OD1 other bump:1.04739 Ang N26.OD1 and D28.OD1 other bump:2.52507 Ang N26.CB and D28.OD1 other bump:3.08343 Ang N26.CG and D28.CG other bump:2.05097 Ang N26.OD1 and D28.CG neighbor-bump: 2.14723 Ang Y24.CA and P25.CD neighbor-bump: 1.17253 Ang Y24.C and P25.CD neighbor-bump: 2.67401 Ang Y24.N and P25.CD neighbor-bump: 1.71695 Ang Y24.O and P25.CD neighbor-bump: 2.42334 Ang Y24.C and P25.CG neighbor-bump: 2.30052 Ang Y24.O and P25.CG neighbor-bump: 2.66074 Ang Y24.C and P25.CB other bump:2.00428 Ang A18.O and P20.CD other bump:2.67516 Ang A18.C and P20.CD neighbor-bump: 2.23067 Ang T19.O and P20.CD neighbor-bump: 1.39114 Ang T19.C and P20.CD neighbor-bump: 2.05447 Ang T19.CA and P20.CD other bump:2.1161 Ang A18.O and P20.CG other bump:3.10166 Ang A18.C and P20.CG neighbor-bump: 2.26627 Ang T19.O and P20.CG neighbor-bump: 2.21941 Ang T19.C and P20.CG other bump:2.53114 Ang D6.OD1 and V12.CG2 self-bump: 1.37974 Ang D8.CA and D8.CB T0191 135 :KEAKKVNAKTINGLGMLIYQGAVAFK 1g0oA 129 :EEFDRVFTINTRGQFFVAREAYKHLE Fragment has 20 clashes (null) has 20 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 27 residues other bump:2.60915 Ang G22.CA and F26.CZ other bump:3.16105 Ang G22.C and F26.CZ other bump:2.78131 Ang A23.N and F26.CE1 other bump:1.73343 Ang G22.CA and F26.CE1 other bump:2.08303 Ang G22.O and F26.CE1 other bump:1.79551 Ang G22.C and F26.CE1 other bump:2.81409 Ang A23.N and F26.CD1 other bump:2.6806 Ang G22.CA and F26.CD1 other bump:1.32388 Ang G22.O and F26.CD1 other bump:1.87369 Ang G22.C and F26.CD1 other bump:2.4196 Ang G22.O and F26.CG other bump:3.23975 Ang G22.C and F26.CG neighbor-bump: 2.93042 Ang Y20.CD1 and Q21.NE2 neighbor-bump: 2.02335 Ang Y20.CE1 and Q21.NE2 neighbor-bump: 2.54511 Ang Y20.CZ and Q21.NE2 other bump:2.9622 Ang M17.CA and Y20.CD2 other bump:3.15654 Ang M17.C and Y20.CD2 other bump:2.58239 Ang M17.O and Y20.CD2 other bump:2.52614 Ang N13.OD1 and M17.CE other bump:2.6437 Ang T11.O and L15.CD1 Number of specific fragments= 7 total=144 Number of alignments=23 # Reading fragments from alignment file # T0191 read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1g0oA/T0191-1g0oA-2track-protein-STR-global-adpstyle5.pw.a2m.gz # 1g0oA read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1g0oA/T0191-1g0oA-2track-protein-STR-global-adpstyle5.pw.a2m.gz # found chain 1g0oA in template set T0191 16 :EEI 1g0oA 13 :YDA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 5 residues T0191 21 :VKDKNIVIYGAG 1g0oA 27 :LEGKVALVTGAG Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:3.00792 Ang I9.CD1 and A12.CB other bump:2.89438 Ang I9.CG1 and A12.CB T0191 33 :GAARAVAFELAK 1g0oA 40 :GIGREMAMELGR Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:2.55297 Ang R5.NE and F9.CZ other bump:2.70148 Ang R5.NE and F9.CE2 T0191 45 :DNNIIIANRT 1g0oA 53 :GCKVIVNYAN Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 12 residues other bump:2.89591 Ang N3.CG and I5.CG2 other bump:1.87682 Ang N3.OD1 and I5.CG2 neighbor-bump: 2.64326 Ang N3.CG and N4.O T0191 55 :VEKAEALAKEIAEKLNKKFGEEVK 1g0oA 64 :TESAEEVVAAIKKNGSDAACVKAN Fragment has 27 clashes (null) has 27 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 26 residues neighbor-bump: 2.53664 Ang E23.O and V24.CG2 neighbor-bump: 2.91904 Ang E23.C and V24.CG2 other bump:3.0445 Ang K18.CG and F20.CE2 other bump:2.88373 Ang K18.CD and F20.CE2 other bump:1.76238 Ang L8.O and K19.NZ other bump:1.72085 Ang A9.O and K19.NZ other bump:1.24139 Ang A9.C and K19.NZ other bump:1.78859 Ang K10.N and K19.NZ other bump:2.68903 Ang K10.CA and K19.NZ other bump:2.72142 Ang K10.C and K19.NZ other bump:2.18664 Ang L8.C and K19.NZ other bump:2.27884 Ang A9.N and K19.NZ other bump:1.99971 Ang A9.CA and K19.NZ other bump:0.892189 Ang A9.O and K19.CE other bump:1.13665 Ang A9.C and K19.CE other bump:2.42999 Ang K10.N and K19.CE other bump:2.80158 Ang A9.N and K19.CE other bump:1.7045 Ang A9.CA and K19.CE other bump:2.85676 Ang A9.CB and K19.CE other bump:2.37089 Ang A9.O and K19.CD other bump:2.31453 Ang A9.C and K19.CD other bump:3.11559 Ang L8.C and K19.CD other bump:2.61941 Ang A9.N and K19.CD other bump:1.6005 Ang A9.CA and K19.CD other bump:2.60367 Ang A9.CB and K19.CD other bump:2.60469 Ang A9.CA and K19.CG other bump:2.76879 Ang A9.CB and K19.CG T0191 79 :FSGLDVDLDGVDIIINATPIGMYPNIDVE 1g0oA 98 :FEEAVKIFGKLDIVCSNSGVVSFGHVKDV Fragment has 23 clashes (null) has 23 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 31 residues other bump:1.93716 Ang N26.CG and D28.OD1 other bump:1.04739 Ang N26.OD1 and D28.OD1 other bump:2.52507 Ang N26.CB and D28.OD1 other bump:3.08343 Ang N26.CG and D28.CG other bump:2.05097 Ang N26.OD1 and D28.CG neighbor-bump: 2.14723 Ang Y24.CA and P25.CD neighbor-bump: 1.17253 Ang Y24.C and P25.CD neighbor-bump: 2.67401 Ang Y24.N and P25.CD neighbor-bump: 1.71695 Ang Y24.O and P25.CD neighbor-bump: 2.42334 Ang Y24.C and P25.CG neighbor-bump: 2.30052 Ang Y24.O and P25.CG neighbor-bump: 2.66074 Ang Y24.C and P25.CB other bump:2.00428 Ang A18.O and P20.CD other bump:2.67516 Ang A18.C and P20.CD neighbor-bump: 2.23067 Ang T19.O and P20.CD neighbor-bump: 1.39114 Ang T19.C and P20.CD neighbor-bump: 2.05447 Ang T19.CA and P20.CD other bump:2.1161 Ang A18.O and P20.CG other bump:3.10166 Ang A18.C and P20.CG neighbor-bump: 2.26627 Ang T19.O and P20.CG neighbor-bump: 2.21941 Ang T19.C and P20.CG other bump:2.53114 Ang D6.OD1 and V12.CG2 self-bump: 1.37974 Ang D8.CA and D8.CB Number of specific fragments= 6 total=150 Number of alignments=24 # Reading fragments from alignment file # T0191 read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1jaxA/T0191-1jaxA-2track-protein-STR-local-adpstyle1.pw.a2m.gz # 1jaxA read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1jaxA/T0191-1jaxA-2track-protein-STR-local-adpstyle1.pw.a2m.gz # found chain 1jaxA in template set T0191 25 :NIVIYGA 1jaxA 2 :RVALLGG Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 9 residues other bump:2.60548 Ang I5.CB and A8.CB other bump:2.48976 Ang I5.CG2 and A8.CB other bump:2.24555 Ang I5.O and A8.CB other bump:2.91754 Ang I5.C and A8.CB other bump:3.14389 Ang I5.CG2 and A8.CA T0191 32 :GGAARAVAFELAK 1jaxA 10 :GNLGKGLALRLAT Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGLD 1jaxA 24 :GHEIVVGSRREEKAEAKAAEYRRIAGDASITGMKNEDAA Fragment has 81 clashes (null) has 81 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 41 residues other bump:2.93864 Ang V34.CB and L39.CD2 other bump:1.70767 Ang V34.CG2 and L39.CD2 other bump:2.60435 Ang I6.CB and L39.CD2 other bump:1.33969 Ang I6.CG1 and L39.CD2 other bump:1.68413 Ang I6.CD1 and L39.CD2 other bump:2.29645 Ang I7.O and L39.CD1 other bump:2.41783 Ang I7.C and L39.CD1 other bump:2.33376 Ang A8.N and L39.CD1 other bump:2.82692 Ang V34.CG2 and L39.CD1 other bump:2.11126 Ang A8.CA and L39.CD1 other bump:2.55666 Ang A8.CB and L39.CD1 other bump:3.08697 Ang V34.CB and L39.CG other bump:1.60756 Ang V34.CG2 and L39.CG other bump:2.81748 Ang I6.CG1 and L39.CG other bump:2.6943 Ang V34.CG2 and L39.CB other bump:2.91117 Ang V34.CG2 and L39.CA other bump:3.07176 Ang N9.CA and F36.CZ other bump:2.55044 Ang A8.O and F36.CZ other bump:2.99252 Ang A8.C and F36.CZ other bump:2.57132 Ang N9.CA and F36.CE2 other bump:2.78413 Ang N9.C and F36.CE2 other bump:3.14449 Ang R10.N and F36.CE2 other bump:3.06525 Ang N9.N and F36.CE2 other bump:2.92316 Ang A8.CB and F36.CE1 other bump:2.93525 Ang A8.C and F36.CE1 other bump:3.07999 Ang N9.CA and F36.CD2 other bump:2.76539 Ang N9.C and F36.CD2 other bump:2.50446 Ang A8.CB and F36.CD1 other bump:2.61283 Ang V12.CG2 and K35.CE other bump:2.87829 Ang V12.CG2 and K35.CD other bump:2.1409 Ang V12.CG2 and K35.CG other bump:2.87488 Ang I6.CG1 and V34.CG2 other bump:2.47604 Ang I6.CD1 and V34.CG2 other bump:2.8209 Ang I6.CD1 and V34.CG1 other bump:1.76559 Ang A15.C and E33.OE2 other bump:1.67864 Ang E16.N and E33.OE2 other bump:1.79763 Ang K14.C and E33.OE2 other bump:1.0317 Ang A15.N and E33.OE2 other bump:1.54786 Ang A15.CA and E33.OE2 other bump:2.51127 Ang A15.CB and E33.OE2 other bump:2.21594 Ang A15.C and E33.OE1 other bump:0.899862 Ang E16.N and E33.OE1 other bump:1.10488 Ang E16.CA and E33.OE1 other bump:1.61355 Ang E16.CB and E33.OE1 other bump:2.24411 Ang E16.C and E33.OE1 other bump:2.43633 Ang A15.O and E33.CD other bump:1.30434 Ang A15.C and E33.CD other bump:0.565897 Ang E16.N and E33.CD other bump:1.99209 Ang E16.CA and E33.CD other bump:2.81391 Ang E16.CB and E33.CD other bump:3.01536 Ang E16.C and E33.CD other bump:2.92884 Ang K14.C and E33.CD other bump:2.23224 Ang A15.N and E33.CD other bump:2.02599 Ang A15.CA and E33.CD other bump:2.66184 Ang A15.CB and E33.CD other bump:2.191 Ang A15.O and E33.CG other bump:1.48782 Ang A15.C and E33.CG other bump:1.70188 Ang E16.N and E33.CG other bump:2.63976 Ang E16.CA and E33.CG other bump:3.04308 Ang A15.N and E33.CG other bump:2.10154 Ang A15.CA and E33.CG other bump:2.0153 Ang A15.CB and E33.CG other bump:2.38329 Ang A15.O and E33.CB other bump:2.36144 Ang A15.C and E33.CB other bump:2.36679 Ang E16.N and E33.CB other bump:2.42495 Ang E16.CA and E33.CB other bump:2.8852 Ang F30.CD1 and E32.OE1 other bump:1.68779 Ang F30.CE1 and E32.OE1 other bump:2.16903 Ang F30.CZ and E32.OE1 other bump:2.81264 Ang F30.CZ and E32.CD other bump:2.93181 Ang N4.CB and F30.CE2 other bump:3.08236 Ang N4.CG and F30.CE2 other bump:2.76982 Ang N4.CA and F30.CD2 other bump:2.76488 Ang N4.CB and F30.CD2 other bump:2.82356 Ang N4.CG and F30.CD2 other bump:2.95391 Ang L26.CB and K29.CD other bump:2.89819 Ang I7.CD1 and A19.CA other bump:2.52503 Ang I7.CD1 and A19.N other bump:2.46765 Ang V12.CG1 and E16.OE2 other bump:2.85136 Ang N9.ND2 and K14.CE other bump:2.77127 Ang N9.ND2 and K14.CD T0191 87 :DGVDIIINATPIGMYP 1jaxA 63 :EACDIAVLTIPWEHAI Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 18 residues neighbor-bump: 2.74792 Ang Y16.CD2 and P17.CD other bump:2.81381 Ang V4.CG1 and I7.CG1 other bump:2.70337 Ang V4.CG2 and I6.C other bump:1.98462 Ang V4.CG2 and I6.O T0191 107 :EPIVKAEKLREDMVVMDLIYN 1jaxA 79 :DTARDLKNILREKIVVSPLVP Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 23 residues other bump:2.47542 Ang D18.OD2 and I20.CB other bump:2.95588 Ang M17.CE and L19.CD1 Number of specific fragments= 5 total=155 Number of alignments=25 # Reading fragments from alignment file # T0191 read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1jaxA/T0191-1jaxA-2track-protein-STR-local-adpstyle5.pw.a2m.gz # 1jaxA read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1jaxA/T0191-1jaxA-2track-protein-STR-local-adpstyle5.pw.a2m.gz # found chain 1jaxA in template set T0191 25 :NIVIYGA 1jaxA 2 :RVALLGG Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 9 residues other bump:2.60548 Ang I5.CB and A8.CB other bump:2.48976 Ang I5.CG2 and A8.CB other bump:2.24555 Ang I5.O and A8.CB other bump:2.91754 Ang I5.C and A8.CB other bump:3.14389 Ang I5.CG2 and A8.CA T0191 32 :GGAARAVAFELAK 1jaxA 10 :GNLGKGLALRLAT Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGLD 1jaxA 24 :GHEIVVGSRREEKAEAKAAEYRRIAGDASITGMKNEDAA Fragment has 81 clashes (null) has 81 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 41 residues other bump:2.93864 Ang V34.CB and L39.CD2 other bump:1.70767 Ang V34.CG2 and L39.CD2 other bump:2.60435 Ang I6.CB and L39.CD2 other bump:1.33969 Ang I6.CG1 and L39.CD2 other bump:1.68413 Ang I6.CD1 and L39.CD2 other bump:2.29645 Ang I7.O and L39.CD1 other bump:2.41783 Ang I7.C and L39.CD1 other bump:2.33376 Ang A8.N and L39.CD1 other bump:2.82692 Ang V34.CG2 and L39.CD1 other bump:2.11126 Ang A8.CA and L39.CD1 other bump:2.55666 Ang A8.CB and L39.CD1 other bump:3.08697 Ang V34.CB and L39.CG other bump:1.60756 Ang V34.CG2 and L39.CG other bump:2.81748 Ang I6.CG1 and L39.CG other bump:2.6943 Ang V34.CG2 and L39.CB other bump:2.91117 Ang V34.CG2 and L39.CA other bump:3.07176 Ang N9.CA and F36.CZ other bump:2.55044 Ang A8.O and F36.CZ other bump:2.99252 Ang A8.C and F36.CZ other bump:2.57132 Ang N9.CA and F36.CE2 other bump:2.78413 Ang N9.C and F36.CE2 other bump:3.14449 Ang R10.N and F36.CE2 other bump:3.06525 Ang N9.N and F36.CE2 other bump:2.92316 Ang A8.CB and F36.CE1 other bump:2.93525 Ang A8.C and F36.CE1 other bump:3.07999 Ang N9.CA and F36.CD2 other bump:2.76539 Ang N9.C and F36.CD2 other bump:2.50446 Ang A8.CB and F36.CD1 other bump:2.61283 Ang V12.CG2 and K35.CE other bump:2.87829 Ang V12.CG2 and K35.CD other bump:2.1409 Ang V12.CG2 and K35.CG other bump:2.87488 Ang I6.CG1 and V34.CG2 other bump:2.47604 Ang I6.CD1 and V34.CG2 other bump:2.8209 Ang I6.CD1 and V34.CG1 other bump:1.76559 Ang A15.C and E33.OE2 other bump:1.67864 Ang E16.N and E33.OE2 other bump:1.79763 Ang K14.C and E33.OE2 other bump:1.0317 Ang A15.N and E33.OE2 other bump:1.54786 Ang A15.CA and E33.OE2 other bump:2.51127 Ang A15.CB and E33.OE2 other bump:2.21594 Ang A15.C and E33.OE1 other bump:0.899862 Ang E16.N and E33.OE1 other bump:1.10488 Ang E16.CA and E33.OE1 other bump:1.61355 Ang E16.CB and E33.OE1 other bump:2.24411 Ang E16.C and E33.OE1 other bump:2.43633 Ang A15.O and E33.CD other bump:1.30434 Ang A15.C and E33.CD other bump:0.565897 Ang E16.N and E33.CD other bump:1.99209 Ang E16.CA and E33.CD other bump:2.81391 Ang E16.CB and E33.CD other bump:3.01536 Ang E16.C and E33.CD other bump:2.92884 Ang K14.C and E33.CD other bump:2.23224 Ang A15.N and E33.CD other bump:2.02599 Ang A15.CA and E33.CD other bump:2.66184 Ang A15.CB and E33.CD other bump:2.191 Ang A15.O and E33.CG other bump:1.48782 Ang A15.C and E33.CG other bump:1.70188 Ang E16.N and E33.CG other bump:2.63976 Ang E16.CA and E33.CG other bump:3.04308 Ang A15.N and E33.CG other bump:2.10154 Ang A15.CA and E33.CG other bump:2.0153 Ang A15.CB and E33.CG other bump:2.38329 Ang A15.O and E33.CB other bump:2.36144 Ang A15.C and E33.CB other bump:2.36679 Ang E16.N and E33.CB other bump:2.42495 Ang E16.CA and E33.CB other bump:2.8852 Ang F30.CD1 and E32.OE1 other bump:1.68779 Ang F30.CE1 and E32.OE1 other bump:2.16903 Ang F30.CZ and E32.OE1 other bump:2.81264 Ang F30.CZ and E32.CD other bump:2.93181 Ang N4.CB and F30.CE2 other bump:3.08236 Ang N4.CG and F30.CE2 other bump:2.76982 Ang N4.CA and F30.CD2 other bump:2.76488 Ang N4.CB and F30.CD2 other bump:2.82356 Ang N4.CG and F30.CD2 other bump:2.95391 Ang L26.CB and K29.CD other bump:2.89819 Ang I7.CD1 and A19.CA other bump:2.52503 Ang I7.CD1 and A19.N other bump:2.46765 Ang V12.CG1 and E16.OE2 other bump:2.85136 Ang N9.ND2 and K14.CE other bump:2.77127 Ang N9.ND2 and K14.CD T0191 87 :DGVDIIINATPIGMYPN 1jaxA 63 :EACDIAVLTIPWEHAID Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 19 residues neighbor-bump: 2.74793 Ang Y16.CD2 and P17.CD other bump:2.81381 Ang V4.CG1 and I7.CG1 other bump:2.70337 Ang V4.CG2 and I6.C other bump:1.98462 Ang V4.CG2 and I6.O T0191 108 :PIVKAEKLREDMVVMDLIY 1jaxA 80 :TARDLKNILREKIVVSPLV Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 21 residues other bump:2.47542 Ang D17.OD2 and I19.CB other bump:2.95588 Ang M16.CE and L18.CD1 Number of specific fragments= 5 total=160 Number of alignments=26 # Reading fragments from alignment file # T0191 read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1sayA/T0191-1sayA-2track-protein-STR-local-adpstyle5.pw.a2m.gz # 1sayA read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1sayA/T0191-1sayA-2track-protein-STR-local-adpstyle5.pw.a2m.gz # adding 1sayA to template set 1sayA:# found chain 1sayA in template set T0191 6 :DGIGARMALEEEIGR 1sayA 141 :VQFGARFLERQQGGR Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 17 residues neighbor-bump: 2.40439 Ang E13.O and I14.CD1 neighbor-bump: 1.9122 Ang E13.O and I14.CG1 neighbor-bump: 2.5899 Ang E13.C and I14.CG1 neighbor-bump: 2.03206 Ang E13.O and I14.CB neighbor-bump: 2.51803 Ang E13.C and I14.CB neighbor-bump: 3.23064 Ang R7.NE and M8.CE T0191 21 :VKDKNIVIYGAGGAARAVAFELAK 1sayA 165 :VKPGKVVILGGGVVGTEAAKMAVG Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 26 residues other bump:2.56061 Ang I7.CD1 and L23.CD2 other bump:2.48157 Ang I7.CG1 and L23.CD1 other bump:1.10128 Ang I7.CD1 and L23.CD1 other bump:1.86376 Ang I7.CD1 and L23.CG other bump:2.28339 Ang I7.CD1 and L23.CB other bump:1.86192 Ang G11.O and A16.CB other bump:2.91693 Ang G11.C and A16.CB T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLN 1sayA 190 :GAQVQIFDINVERLSYLETLFGSRVE Fragment has 19 clashes (null) has 19 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:2.98708 Ang I22.CD1 and L26.CD2 other bump:2.54972 Ang I5.CD1 and L26.CD2 other bump:2.38607 Ang I5.CD1 and L26.CD1 other bump:2.46588 Ang I5.CG1 and L26.CD1 other bump:2.24959 Ang I5.CD1 and L26.CG other bump:2.47498 Ang I5.CG1 and L26.CG self-bump: 2.21791 Ang A23.CB and A23.C self-bump: 1.22414 Ang A23.CA and A23.CB other bump:1.70685 Ang V12.CG1 and E16.OE2 other bump:1.12933 Ang V12.O and E16.OE1 other bump:1.88395 Ang V12.C and E16.OE1 other bump:2.3869 Ang E13.CA and E16.OE1 other bump:1.91758 Ang V12.O and E16.CD other bump:2.73332 Ang V12.C and E16.CD other bump:2.75496 Ang V12.CG1 and E16.CD other bump:1.45654 Ang N9.OD1 and T11.OG1 other bump:2.45045 Ang N9.CG and T11.OG1 other bump:2.92142 Ang N3.CG and I5.CG2 other bump:1.96143 Ang N3.ND2 and I5.CG2 T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLREDMVVMDLIY 1sayA 216 :LLYSNSAEIETAVAEADLLIGAVLVPGRRAPILVPASLVEQMRTGSVIVDVAV Fragment has 42 clashes (null) has 42 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 55 residues other bump:2.51253 Ang T24.N and I53.CD1 other bump:2.05606 Ang T24.C and I53.CD1 other bump:2.93499 Ang P25.N and I53.CD1 other bump:2.6843 Ang T24.CA and I53.CD1 other bump:2.99341 Ang T24.CB and I53.CD1 other bump:2.54819 Ang T24.OG1 and I53.CD1 other bump:1.58666 Ang T24.O and I53.CD1 other bump:3.04979 Ang T24.C and I53.CG1 other bump:2.76659 Ang N22.CB and D51.OD2 other bump:2.23101 Ang N22.CG and D51.OD2 other bump:1.36216 Ang N22.OD1 and D51.OD2 other bump:2.65553 Ang N22.CB and D51.OD1 other bump:2.42288 Ang N22.CG and D51.OD1 other bump:2.46217 Ang N22.CB and D51.CG other bump:2.39239 Ang N22.CG and D51.CG other bump:2.11572 Ang N22.OD1 and D51.CG other bump:3.07608 Ang N22.CB and D51.CB other bump:3.25209 Ang N22.CB and D51.CA other bump:2.70117 Ang I20.CG2 and V49.CG1 other bump:2.47352 Ang L43.CD2 and M47.CE other bump:2.86871 Ang L43.CG and M47.SD other bump:2.20917 Ang L43.CD2 and M47.SD other bump:2.95067 Ang L43.CD1 and M47.SD other bump:2.83464 Ang D15.OD1 and K42.C other bump:2.10641 Ang D15.OD1 and K42.O other bump:2.36746 Ang L14.CG and K39.NZ other bump:2.51947 Ang L14.CB and K39.NZ other bump:1.70521 Ang L14.CD1 and K39.NZ other bump:2.27098 Ang E35.CD and K39.NZ other bump:1.37195 Ang E35.OE2 and K39.NZ other bump:2.40629 Ang L14.CG and K39.CE other bump:2.66309 Ang L14.CB and K39.CE other bump:1.29673 Ang L14.CD1 and K39.CE other bump:2.74995 Ang L14.CD1 and K39.CD other bump:2.62443 Ang D33.OD1 and E35.C other bump:3.00272 Ang I20.CD1 and E35.OE2 other bump:2.91817 Ang L14.CD1 and E35.OE2 self-bump: 1.34485 Ang M28.CA and M28.CB other bump:2.81175 Ang A23.C and P25.CD other bump:2.50518 Ang L14.CD2 and I20.CD1 other bump:2.83688 Ang V17.CG1 and I19.C other bump:2.60825 Ang V17.CG1 and I19.O Number of specific fragments= 4 total=164 Number of alignments=27 # Reading fragments from alignment file # T0191 read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1sayA/T0191-1sayA-2track-protein-STR-local-adpstyle1.pw.a2m.gz # 1sayA read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1sayA/T0191-1sayA-2track-protein-STR-local-adpstyle1.pw.a2m.gz # found chain 1sayA in template set T0191 2 :GYNTDGIGARMALEEEIGR 1sayA 137 :GRLSVQFGARFLERQQGGR Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 21 residues neighbor-bump: 2.40439 Ang E17.O and I18.CD1 neighbor-bump: 1.9122 Ang E17.O and I18.CG1 neighbor-bump: 2.5899 Ang E17.C and I18.CG1 neighbor-bump: 2.03206 Ang E17.O and I18.CB neighbor-bump: 2.51803 Ang E17.C and I18.CB neighbor-bump: 3.23064 Ang R11.NE and M12.CE T0191 21 :VKDKNIVIYGAGGAARAVAFELAK 1sayA 165 :VKPGKVVILGGGVVGTEAAKMAVG Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 26 residues other bump:2.56061 Ang I7.CD1 and L23.CD2 other bump:2.48157 Ang I7.CG1 and L23.CD1 other bump:1.10128 Ang I7.CD1 and L23.CD1 other bump:1.86376 Ang I7.CD1 and L23.CG other bump:2.28339 Ang I7.CD1 and L23.CB other bump:1.86192 Ang G11.O and A16.CB other bump:2.91693 Ang G11.C and A16.CB T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLN 1sayA 190 :GAQVQIFDINVERLSYLETLFGSRVE Fragment has 19 clashes (null) has 19 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:2.98708 Ang I22.CD1 and L26.CD2 other bump:2.54972 Ang I5.CD1 and L26.CD2 other bump:2.38607 Ang I5.CD1 and L26.CD1 other bump:2.46588 Ang I5.CG1 and L26.CD1 other bump:2.24959 Ang I5.CD1 and L26.CG other bump:2.47498 Ang I5.CG1 and L26.CG self-bump: 2.21791 Ang A23.CB and A23.C self-bump: 1.22414 Ang A23.CA and A23.CB other bump:1.70685 Ang V12.CG1 and E16.OE2 other bump:1.12933 Ang V12.O and E16.OE1 other bump:1.88395 Ang V12.C and E16.OE1 other bump:2.3869 Ang E13.CA and E16.OE1 other bump:1.91758 Ang V12.O and E16.CD other bump:2.73332 Ang V12.C and E16.CD other bump:2.75496 Ang V12.CG1 and E16.CD other bump:1.45654 Ang N9.OD1 and T11.OG1 other bump:2.45045 Ang N9.CG and T11.OG1 other bump:2.92142 Ang N3.CG and I5.CG2 other bump:1.96143 Ang N3.ND2 and I5.CG2 T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLREDMVVMDLIY 1sayA 216 :LLYSNSAEIETAVAEADLLIGAVLVPGRRAPILVPASLVEQMRTGSVIVDVAV Fragment has 42 clashes (null) has 42 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 55 residues other bump:2.51253 Ang T24.N and I53.CD1 other bump:2.05606 Ang T24.C and I53.CD1 other bump:2.93499 Ang P25.N and I53.CD1 other bump:2.6843 Ang T24.CA and I53.CD1 other bump:2.99341 Ang T24.CB and I53.CD1 other bump:2.54819 Ang T24.OG1 and I53.CD1 other bump:1.58666 Ang T24.O and I53.CD1 other bump:3.04979 Ang T24.C and I53.CG1 other bump:2.76659 Ang N22.CB and D51.OD2 other bump:2.23101 Ang N22.CG and D51.OD2 other bump:1.36216 Ang N22.OD1 and D51.OD2 other bump:2.65553 Ang N22.CB and D51.OD1 other bump:2.42288 Ang N22.CG and D51.OD1 other bump:2.46217 Ang N22.CB and D51.CG other bump:2.39239 Ang N22.CG and D51.CG other bump:2.11572 Ang N22.OD1 and D51.CG other bump:3.07608 Ang N22.CB and D51.CB other bump:3.25209 Ang N22.CB and D51.CA other bump:2.70117 Ang I20.CG2 and V49.CG1 other bump:2.47352 Ang L43.CD2 and M47.CE other bump:2.86871 Ang L43.CG and M47.SD other bump:2.20917 Ang L43.CD2 and M47.SD other bump:2.95067 Ang L43.CD1 and M47.SD other bump:2.83464 Ang D15.OD1 and K42.C other bump:2.10641 Ang D15.OD1 and K42.O other bump:2.36746 Ang L14.CG and K39.NZ other bump:2.51947 Ang L14.CB and K39.NZ other bump:1.70521 Ang L14.CD1 and K39.NZ other bump:2.27098 Ang E35.CD and K39.NZ other bump:1.37195 Ang E35.OE2 and K39.NZ other bump:2.40629 Ang L14.CG and K39.CE other bump:2.66309 Ang L14.CB and K39.CE other bump:1.29673 Ang L14.CD1 and K39.CE other bump:2.74995 Ang L14.CD1 and K39.CD other bump:2.62443 Ang D33.OD1 and E35.C other bump:3.00272 Ang I20.CD1 and E35.OE2 other bump:2.91817 Ang L14.CD1 and E35.OE2 self-bump: 1.34485 Ang M28.CA and M28.CB other bump:2.81175 Ang A23.C and P25.CD other bump:2.50518 Ang L14.CD2 and I20.CD1 other bump:2.83688 Ang V17.CG1 and I19.C other bump:2.60825 Ang V17.CG1 and I19.O Number of specific fragments= 4 total=168 Number of alignments=28 # Reading fragments from alignment file # T0191 read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/2ae2A/T0191-2ae2A-2track-protein-STR-global-adpstyle1.pw.a2m.gz # 2ae2A read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/2ae2A/T0191-2ae2A-2track-protein-STR-global-adpstyle1.pw.a2m.gz # adding 2ae2A to template set 2ae2A:# found chain 2ae2A in template set T0191 17 :EIGRVKDKNIVIYGAG 2ae2A 3 :GRWNLEGCTALVTGGS Fragment has 13 clashes (null) has 13 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 18 residues other bump:2.55951 Ang E2.CG and R5.NH2 other bump:2.49924 Ang E2.CD and R5.NH2 other bump:1.86053 Ang E2.OE2 and R5.NH2 other bump:2.47361 Ang E2.CG and R5.NH1 other bump:1.98561 Ang E2.CG and R5.CZ other bump:2.5602 Ang E2.CD and R5.CZ other bump:2.37591 Ang E2.OE2 and R5.CZ other bump:2.88474 Ang E2.CB and R5.NE other bump:2.07355 Ang E2.CG and R5.NE other bump:2.88818 Ang E2.N and R5.NE other bump:2.62862 Ang E2.CG and R5.CD other bump:3.1268 Ang E2.CB and R5.CG other bump:3.15106 Ang E2.N and R5.CG T0191 33 :GAARAVAFELAK 2ae2A 20 :GIGYGIVEELAS Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:3.06801 Ang R5.CZ and F9.CZ other bump:2.6714 Ang R5.CZ and F9.CE2 other bump:2.64616 Ang R5.NH1 and F9.CE2 other bump:2.9653 Ang R5.NH2 and F9.CE2 T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGLDVD 2ae2A 33 :GASVYTCSRNQKELNDCLTQWRSKGFKVEASVCDLSSRSER Fragment has 20 clashes (null) has 20 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 43 residues other bump:2.39146 Ang V34.CG2 and V41.CG1 other bump:3.16318 Ang K35.N and V41.CG1 other bump:2.95389 Ang R10.CG and K35.CG other bump:2.9691 Ang A8.CB and V34.CG1 other bump:2.43292 Ang V12.CB and E33.OE1 other bump:1.02211 Ang V12.CG2 and E33.OE1 other bump:2.10747 Ang V12.CG2 and E33.CD other bump:2.45283 Ang F30.CZ and E32.OE1 other bump:2.80423 Ang F30.CE2 and E32.OE1 other bump:2.15307 Ang L18.O and K29.NZ other bump:2.86238 Ang L18.C and K29.NZ other bump:2.05807 Ang I22.CB and K29.NZ other bump:1.81182 Ang I22.CG1 and K29.NZ other bump:2.12203 Ang I22.CB and K29.CE other bump:2.78168 Ang I22.CG2 and K29.CE other bump:2.5956 Ang I22.CG1 and K29.CE other bump:3.30762 Ang I22.CG1 and K29.CD other bump:2.79053 Ang I22.CG2 and N27.CB other bump:1.98154 Ang N9.OD1 and T11.OG1 neighbor-bump: 2.54874 Ang I7.CG2 and A8.N T0191 86 :LDGVDIIINATPIGMYPNIDVE 2ae2A 85 :HGKLNILVNNAGIVIYKEAKDY Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 24 residues other bump:2.69924 Ang P18.CB and E23.OE2 other bump:1.91617 Ang A11.O and P13.CD other bump:2.61628 Ang A11.C and P13.CD neighbor-bump: 2.08529 Ang T12.CA and P13.CD neighbor-bump: 2.20702 Ang T12.O and P13.CD neighbor-bump: 1.40823 Ang T12.C and P13.CD other bump:2.32549 Ang A11.O and P13.CG other bump:3.2525 Ang A11.C and P13.CG neighbor-bump: 2.35516 Ang T12.O and P13.CG neighbor-bump: 2.30821 Ang T12.C and P13.CG T0191 108 :PIVKAEKLREDMVVMDLIYNPLETVLLKEAK 2ae2A 171 :RCLAFEWAKDNIRVNGVGPGVIATSLVEMTI Fragment has 21 clashes (null) has 21 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 33 residues other bump:2.70438 Ang E24.CD and K29.NZ other bump:2.31739 Ang Y20.CD1 and L23.CD2 other bump:2.49841 Ang Y20.CE1 and L23.CD2 other bump:2.5468 Ang N21.CG and L23.CD1 other bump:2.86978 Ang N21.ND2 and L23.CD1 other bump:1.76503 Ang N21.OD1 and L23.CD1 neighbor-bump: 3.01829 Ang N21.CG and P22.C neighbor-bump: 2.42657 Ang N21.OD1 and P22.C neighbor-bump: 2.54065 Ang N21.CB and P22.CD neighbor-bump: 3.23955 Ang N21.CG and P22.CA neighbor-bump: 2.82892 Ang N21.OD1 and P22.CA neighbor-bump: 2.32032 Ang N21.CG and P22.N neighbor-bump: 2.19986 Ang N21.CB and P22.N other bump:1.60216 Ang K5.O and L9.CD1 other bump:2.7817 Ang K5.C and L9.CD1 other bump:1.07477 Ang V4.CG1 and K8.NZ other bump:2.77983 Ang V4.CA and K8.NZ other bump:1.96592 Ang V4.CB and K8.NZ other bump:2.36305 Ang V4.CG2 and K8.NZ other bump:1.6388 Ang V4.CG1 and K8.CE other bump:3.01834 Ang V4.CG1 and K8.CD T0191 139 :KVNAKTINGLGMLIYQGAVAF 2ae2A 217 :CALRRMGEPKELAAMVAFLCF Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 23 residues Number of specific fragments= 6 total=174 Number of alignments=29 # Reading fragments from alignment file # T0191 read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/2ae2A/T0191-2ae2A-2track-protein-STR-global-adpstyle5.pw.a2m.gz # 2ae2A read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/2ae2A/T0191-2ae2A-2track-protein-STR-global-adpstyle5.pw.a2m.gz # found chain 2ae2A in template set T0191 17 :EIGRVKDKNIVIYGAG 2ae2A 3 :GRWNLEGCTALVTGGS Fragment has 13 clashes (null) has 13 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 18 residues other bump:2.55951 Ang E2.CG and R5.NH2 other bump:2.49924 Ang E2.CD and R5.NH2 other bump:1.86053 Ang E2.OE2 and R5.NH2 other bump:2.47361 Ang E2.CG and R5.NH1 other bump:1.98561 Ang E2.CG and R5.CZ other bump:2.5602 Ang E2.CD and R5.CZ other bump:2.37591 Ang E2.OE2 and R5.CZ other bump:2.88474 Ang E2.CB and R5.NE other bump:2.07355 Ang E2.CG and R5.NE other bump:2.88818 Ang E2.N and R5.NE other bump:2.62862 Ang E2.CG and R5.CD other bump:3.1268 Ang E2.CB and R5.CG other bump:3.15106 Ang E2.N and R5.CG T0191 33 :GAARAVAFELAK 2ae2A 20 :GIGYGIVEELAS Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:3.06801 Ang R5.CZ and F9.CZ other bump:2.6714 Ang R5.CZ and F9.CE2 other bump:2.64616 Ang R5.NH1 and F9.CE2 other bump:2.9653 Ang R5.NH2 and F9.CE2 T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGLDVD 2ae2A 33 :GASVYTCSRNQKELNDCLTQWRSKGFKVEASVCDLSSRSER Fragment has 20 clashes (null) has 20 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 43 residues other bump:2.39146 Ang V34.CG2 and V41.CG1 other bump:3.16318 Ang K35.N and V41.CG1 other bump:2.95389 Ang R10.CG and K35.CG other bump:2.9691 Ang A8.CB and V34.CG1 other bump:2.43292 Ang V12.CB and E33.OE1 other bump:1.02211 Ang V12.CG2 and E33.OE1 other bump:2.10747 Ang V12.CG2 and E33.CD other bump:2.45283 Ang F30.CZ and E32.OE1 other bump:2.80423 Ang F30.CE2 and E32.OE1 other bump:2.15307 Ang L18.O and K29.NZ other bump:2.86238 Ang L18.C and K29.NZ other bump:2.05807 Ang I22.CB and K29.NZ other bump:1.81182 Ang I22.CG1 and K29.NZ other bump:2.12203 Ang I22.CB and K29.CE other bump:2.78168 Ang I22.CG2 and K29.CE other bump:2.5956 Ang I22.CG1 and K29.CE other bump:3.30762 Ang I22.CG1 and K29.CD other bump:2.79053 Ang I22.CG2 and N27.CB other bump:1.98154 Ang N9.OD1 and T11.OG1 neighbor-bump: 2.54874 Ang I7.CG2 and A8.N T0191 86 :LDGVDIIINATPIGMYPNIDVE 2ae2A 85 :HGKLNILVNNAGIVIYKEAKDY Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 24 residues other bump:2.69924 Ang P18.CB and E23.OE2 other bump:1.91617 Ang A11.O and P13.CD other bump:2.61628 Ang A11.C and P13.CD neighbor-bump: 2.08529 Ang T12.CA and P13.CD neighbor-bump: 2.20702 Ang T12.O and P13.CD neighbor-bump: 1.40823 Ang T12.C and P13.CD other bump:2.32549 Ang A11.O and P13.CG other bump:3.2525 Ang A11.C and P13.CG neighbor-bump: 2.35516 Ang T12.O and P13.CG neighbor-bump: 2.30821 Ang T12.C and P13.CG T0191 108 :PIVKAEKLRE 2ae2A 171 :RCLAFEWAKD Fragment has 8 clashes (null) has 8 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 12 residues other bump:1.60216 Ang K5.O and L9.CD1 other bump:2.7817 Ang K5.C and L9.CD1 other bump:2.77983 Ang V4.CA and K8.NZ other bump:1.96592 Ang V4.CB and K8.NZ other bump:1.07477 Ang V4.CG1 and K8.NZ other bump:2.36305 Ang V4.CG2 and K8.NZ other bump:1.6388 Ang V4.CG1 and K8.CE other bump:3.01834 Ang V4.CG1 and K8.CD Number of specific fragments= 5 total=179 Number of alignments=30 # Reading fragments from alignment file # T0191 read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1pjbA/T0191-1pjbA-2track-protein-STR-local-adpstyle5.pw.a2m.gz # 1pjbA read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1pjbA/T0191-1pjbA-2track-protein-STR-local-adpstyle5.pw.a2m.gz # adding 1pjbA to template set 1pjbA:# found chain 1pjbA in template set T0191 7 :GIGARMALEEEIGR 1pjbA 142 :QFGARFLERQQGGR Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 16 residues neighbor-bump: 2.35254 Ang E12.O and I13.CD1 neighbor-bump: 1.89109 Ang E12.O and I13.CG1 neighbor-bump: 2.50232 Ang E12.C and I13.CG1 neighbor-bump: 1.87766 Ang E12.O and I13.CB neighbor-bump: 2.40335 Ang E12.C and I13.CB T0191 21 :VKDKNIVIYGAGGAARAVAFELAK 1pjbA 165 :VKPGKVVILGGGVVGTEAAKMAVG Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 26 residues other bump:2.87104 Ang I7.CD1 and L23.CD2 other bump:2.48007 Ang I7.CG1 and L23.CD1 other bump:1.07324 Ang I7.CD1 and L23.CD1 other bump:2.03151 Ang I7.CD1 and L23.CG other bump:2.39615 Ang I7.CD1 and L23.CB other bump:1.92836 Ang G11.O and A16.CB other bump:2.95158 Ang G11.C and A16.CB T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLN 1pjbA 190 :GAQVQIFDINVERLSYLETLFGSRVE Fragment has 19 clashes (null) has 19 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:2.94969 Ang I22.CD1 and L26.CD2 other bump:2.86667 Ang I5.CD1 and L26.CD2 other bump:2.7084 Ang I5.CG1 and L26.CD1 other bump:2.69185 Ang I5.CD1 and L26.CD1 other bump:2.68568 Ang I5.CG1 and L26.CG other bump:2.55449 Ang I5.CD1 and L26.CG self-bump: 2.20268 Ang A23.CB and A23.C self-bump: 1.22982 Ang A23.CA and A23.CB other bump:1.69946 Ang V12.CG1 and E16.OE2 other bump:1.09857 Ang V12.O and E16.OE1 other bump:1.78251 Ang V12.C and E16.OE1 other bump:2.24801 Ang E13.N and E16.OE1 other bump:2.29401 Ang E13.CA and E16.OE1 other bump:2.77824 Ang E13.C and E16.OE1 other bump:1.88968 Ang V12.O and E16.CD other bump:2.64365 Ang V12.C and E16.CD other bump:2.76124 Ang V12.CG1 and E16.CD other bump:2.98556 Ang N3.CG and I5.CG2 other bump:1.94842 Ang N3.ND2 and I5.CG2 T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLREDMVVMDLIY 1pjbA 216 :LLYSNSAEIETAVAEADLLIGAVLVPGRRAPILVPASLVEQMRTGSVIVDVAV Fragment has 41 clashes (null) has 41 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 55 residues other bump:2.62164 Ang T24.N and I53.CD1 other bump:2.72237 Ang T24.CA and I53.CD1 other bump:1.83179 Ang T24.C and I53.CD1 other bump:2.54505 Ang P25.N and I53.CD1 other bump:2.42416 Ang P25.CG and I53.CD1 other bump:2.88348 Ang P25.CD and I53.CD1 other bump:2.9826 Ang P25.CA and I53.CD1 other bump:3.02195 Ang P25.CB and I53.CD1 other bump:3.01 Ang T24.OG1 and I53.CD1 other bump:1.39498 Ang T24.O and I53.CD1 other bump:2.27341 Ang P25.CG and I53.CG1 other bump:2.56688 Ang P25.CB and I53.CG1 other bump:2.30318 Ang N22.CG and D51.OD2 other bump:1.41777 Ang N22.OD1 and D51.OD2 other bump:2.6915 Ang N22.CB and D51.OD1 other bump:2.41436 Ang N22.CG and D51.OD1 other bump:2.49701 Ang N22.CB and D51.CG other bump:2.42431 Ang N22.CG and D51.CG other bump:2.1063 Ang N22.OD1 and D51.CG other bump:3.11224 Ang N22.CB and D51.CB other bump:3.23977 Ang N22.CB and D51.CA other bump:3.03327 Ang I20.CG1 and V49.CG1 other bump:3.04491 Ang I20.CD1 and V49.CG1 other bump:1.36164 Ang V17.O and M47.CE other bump:2.3306 Ang V17.C and M47.CE other bump:2.41025 Ang V17.O and M47.SD other bump:3.08109 Ang D18.CA and M47.SD other bump:2.74048 Ang D18.O and M47.SD other bump:2.69265 Ang D18.C and M47.SD other bump:2.13005 Ang D15.OD1 and K42.O other bump:2.55501 Ang L14.CB and K39.NZ other bump:2.85577 Ang L14.CB and K39.CE other bump:2.63275 Ang D33.OD1 and E35.C other bump:3.03091 Ang L14.CD1 and E35.OE2 other bump:2.89138 Ang I20.CD1 and E35.OE1 self-bump: 1.34334 Ang M28.CA and M28.CB other bump:2.72802 Ang A23.C and P25.CD other bump:2.55923 Ang V17.CG1 and I20.CG2 other bump:2.87573 Ang V17.CG1 and I19.C other bump:2.67136 Ang V17.CG1 and I19.O other bump:2.76978 Ang V5.CG1 and L10.CD1 Number of specific fragments= 4 total=183 Number of alignments=31 # Reading fragments from alignment file # T0191 read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1pjbA/T0191-1pjbA-2track-protein-STR-local-adpstyle1.pw.a2m.gz # 1pjbA read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1pjbA/T0191-1pjbA-2track-protein-STR-local-adpstyle1.pw.a2m.gz # found chain 1pjbA in template set T0191 2 :GYNTDGIGARMALEEEIGR 1pjbA 137 :GRLSVQFGARFLERQQGGR Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 21 residues neighbor-bump: 2.35254 Ang E17.O and I18.CD1 neighbor-bump: 1.89109 Ang E17.O and I18.CG1 neighbor-bump: 2.50232 Ang E17.C and I18.CG1 neighbor-bump: 1.87766 Ang E17.O and I18.CB neighbor-bump: 2.40335 Ang E17.C and I18.CB T0191 21 :VKDKNIVIYGAGGAARAVAFELAK 1pjbA 165 :VKPGKVVILGGGVVGTEAAKMAVG Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 26 residues other bump:2.87104 Ang I7.CD1 and L23.CD2 other bump:2.48007 Ang I7.CG1 and L23.CD1 other bump:1.07324 Ang I7.CD1 and L23.CD1 other bump:2.03151 Ang I7.CD1 and L23.CG other bump:2.39615 Ang I7.CD1 and L23.CB other bump:1.92836 Ang G11.O and A16.CB other bump:2.95158 Ang G11.C and A16.CB T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLN 1pjbA 190 :GAQVQIFDINVERLSYLETLFGSRVE Fragment has 19 clashes (null) has 19 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:2.94969 Ang I22.CD1 and L26.CD2 other bump:2.86667 Ang I5.CD1 and L26.CD2 other bump:2.7084 Ang I5.CG1 and L26.CD1 other bump:2.69185 Ang I5.CD1 and L26.CD1 other bump:2.68568 Ang I5.CG1 and L26.CG other bump:2.55449 Ang I5.CD1 and L26.CG self-bump: 2.20268 Ang A23.CB and A23.C self-bump: 1.22982 Ang A23.CA and A23.CB other bump:1.69946 Ang V12.CG1 and E16.OE2 other bump:1.09857 Ang V12.O and E16.OE1 other bump:1.78251 Ang V12.C and E16.OE1 other bump:2.24801 Ang E13.N and E16.OE1 other bump:2.29401 Ang E13.CA and E16.OE1 other bump:2.77824 Ang E13.C and E16.OE1 other bump:1.88968 Ang V12.O and E16.CD other bump:2.64365 Ang V12.C and E16.CD other bump:2.76124 Ang V12.CG1 and E16.CD other bump:2.98556 Ang N3.CG and I5.CG2 other bump:1.94842 Ang N3.ND2 and I5.CG2 T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLREDMVVMDLIY 1pjbA 216 :LLYSNSAEIETAVAEADLLIGAVLVPGRRAPILVPASLVEQMRTGSVIVDVAV Fragment has 41 clashes (null) has 41 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 55 residues other bump:2.62164 Ang T24.N and I53.CD1 other bump:2.72237 Ang T24.CA and I53.CD1 other bump:1.83179 Ang T24.C and I53.CD1 other bump:2.54505 Ang P25.N and I53.CD1 other bump:2.42416 Ang P25.CG and I53.CD1 other bump:2.88348 Ang P25.CD and I53.CD1 other bump:2.9826 Ang P25.CA and I53.CD1 other bump:3.02195 Ang P25.CB and I53.CD1 other bump:3.01 Ang T24.OG1 and I53.CD1 other bump:1.39498 Ang T24.O and I53.CD1 other bump:2.27341 Ang P25.CG and I53.CG1 other bump:2.56688 Ang P25.CB and I53.CG1 other bump:2.30318 Ang N22.CG and D51.OD2 other bump:1.41777 Ang N22.OD1 and D51.OD2 other bump:2.6915 Ang N22.CB and D51.OD1 other bump:2.41436 Ang N22.CG and D51.OD1 other bump:2.49701 Ang N22.CB and D51.CG other bump:2.42431 Ang N22.CG and D51.CG other bump:2.1063 Ang N22.OD1 and D51.CG other bump:3.11224 Ang N22.CB and D51.CB other bump:3.23977 Ang N22.CB and D51.CA other bump:3.03327 Ang I20.CG1 and V49.CG1 other bump:3.04491 Ang I20.CD1 and V49.CG1 other bump:1.36164 Ang V17.O and M47.CE other bump:2.3306 Ang V17.C and M47.CE other bump:2.41025 Ang V17.O and M47.SD other bump:3.08109 Ang D18.CA and M47.SD other bump:2.74048 Ang D18.O and M47.SD other bump:2.69265 Ang D18.C and M47.SD other bump:2.13005 Ang D15.OD1 and K42.O other bump:2.55501 Ang L14.CB and K39.NZ other bump:2.85577 Ang L14.CB and K39.CE other bump:2.63275 Ang D33.OD1 and E35.C other bump:3.03091 Ang L14.CD1 and E35.OE2 other bump:2.89138 Ang I20.CD1 and E35.OE1 self-bump: 1.34334 Ang M28.CA and M28.CB other bump:2.72802 Ang A23.C and P25.CD other bump:2.55923 Ang V17.CG1 and I20.CG2 other bump:2.87573 Ang V17.CG1 and I19.C other bump:2.67136 Ang V17.CG1 and I19.O other bump:2.76978 Ang V5.CG1 and L10.CD1 Number of specific fragments= 4 total=187 Number of alignments=32 # Reading fragments from alignment file # T0191 read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1gcoA/T0191-1gcoA-2track-protein-STR-global-adpstyle5.pw.a2m.gz # 1gcoA read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1gcoA/T0191-1gcoA-2track-protein-STR-global-adpstyle5.pw.a2m.gz # adding 1gcoA to template set 1gcoA:# found chain 1gcoA in template set T0191 18 :IGRVKDKNIVIYGAG 1gcoA 2 :YKDLEGKVVVITGSS Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 17 residues T0191 33 :GAARAVAFELAK 1gcoA 18 :GLGKSMAIRFAT Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:2.87008 Ang R5.CZ and F9.CE1 other bump:3.00356 Ang R5.NH1 and F9.CE1 T0191 45 :DNNIIIANRT 1gcoA 31 :KAKVVVNYRS Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 12 residues T0191 55 :VEKAEALAKEIAEKLNKKFGEEVK 1gcoA 42 :EDEANSVLEEIKKVGGEAIAVKGD Fragment has 13 clashes (null) has 13 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 26 residues neighbor-bump: 2.01798 Ang E23.O and V24.CG2 neighbor-bump: 2.6733 Ang E23.C and V24.CG2 other bump:2.65146 Ang F20.CD1 and E22.OE1 other bump:1.88263 Ang F20.CE1 and E22.OE1 other bump:2.362 Ang I12.CD1 and K19.CD other bump:2.4516 Ang I12.CG2 and N17.CB other bump:1.84065 Ang V2.CG1 and E6.OE2 other bump:1.35685 Ang V2.O and E6.OE1 other bump:2.11145 Ang V2.C and E6.OE1 other bump:2.53126 Ang E3.CA and E6.OE1 other bump:2.18372 Ang V2.O and E6.CD other bump:2.89094 Ang V2.CG1 and E6.CD other bump:2.94427 Ang V2.C and E6.CD T0191 86 :LDGVDIIINATPIGMYPNIDVE 1gcoA 134 :NDIKGTVINMSSVHEKIPWPLF Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 24 residues neighbor-bump: 2.69006 Ang D21.C and V22.CB self-bump: 2.18708 Ang D21.CB and D21.C self-bump: 1.24461 Ang D21.CA and D21.CB other bump:2.77272 Ang I14.C and P18.CD other bump:1.63196 Ang I14.O and P18.CD neighbor-bump: 2.15874 Ang T12.CA and P13.CD neighbor-bump: 1.54448 Ang T12.C and P13.CD neighbor-bump: 2.40259 Ang T12.O and P13.CD neighbor-bump: 2.808 Ang T12.C and P13.CG neighbor-bump: 2.41047 Ang T12.CB and P13.N T0191 108 :PIVKAEKLREDMVVMDLIYNPLETVLLKEAK 1gcoA 170 :ETLALEYAPKGIRVNNIGPGAINTPINAEKF Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 33 residues other bump:1.83564 Ang N21.OD1 and L23.CD1 neighbor-bump: 2.8974 Ang N21.OD1 and P22.C neighbor-bump: 2.72821 Ang N21.CB and P22.CD neighbor-bump: 2.46003 Ang N21.CB and P22.N other bump:1.90978 Ang K5.O and L9.CD1 T0191 139 :KVNA 1gcoA 210 :ESMI Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 6 residues T0191 144 :TINGLGMLIYQGAV 1gcoA 217 :YIGEPEEIAAVAAW Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 16 residues Number of specific fragments= 8 total=195 Number of alignments=33 # Reading fragments from alignment file # T0191 read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1gcoA/T0191-1gcoA-2track-protein-STR-global-adpstyle1.pw.a2m.gz # 1gcoA read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1gcoA/T0191-1gcoA-2track-protein-STR-global-adpstyle1.pw.a2m.gz # found chain 1gcoA in template set T0191 18 :IGRVKDKNIVIYGAG 1gcoA 2 :YKDLEGKVVVITGSS Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 17 residues T0191 33 :GAARAVAFELAK 1gcoA 18 :GLGKSMAIRFAT Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:2.87008 Ang R5.CZ and F9.CE1 other bump:3.00356 Ang R5.NH1 and F9.CE1 T0191 45 :DNNIIIANRT 1gcoA 31 :KAKVVVNYRS Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 12 residues T0191 55 :VEKAEALAKEIAEKLNKKFGEEVK 1gcoA 42 :EDEANSVLEEIKKVGGEAIAVKGD Fragment has 13 clashes (null) has 13 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 26 residues neighbor-bump: 2.01798 Ang E23.O and V24.CG2 neighbor-bump: 2.6733 Ang E23.C and V24.CG2 other bump:2.65146 Ang F20.CD1 and E22.OE1 other bump:1.88263 Ang F20.CE1 and E22.OE1 other bump:2.362 Ang I12.CD1 and K19.CD other bump:2.4516 Ang I12.CG2 and N17.CB other bump:1.84065 Ang V2.CG1 and E6.OE2 other bump:1.35685 Ang V2.O and E6.OE1 other bump:2.11145 Ang V2.C and E6.OE1 other bump:2.53126 Ang E3.CA and E6.OE1 other bump:2.18372 Ang V2.O and E6.CD other bump:2.89094 Ang V2.CG1 and E6.CD other bump:2.94427 Ang V2.C and E6.CD T0191 79 :FSGLDVD 1gcoA 106 :LSDWNKV Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 9 residues other bump:2.4191 Ang F2.CD1 and D6.OD2 T0191 86 :LDGVDIIINATPIGMYPNIDVE 1gcoA 134 :NDIKGTVINMSSVHEKIPWPLF Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 24 residues neighbor-bump: 2.69006 Ang D21.C and V22.CB self-bump: 2.18708 Ang D21.CB and D21.C self-bump: 1.24461 Ang D21.CA and D21.CB other bump:2.77272 Ang I14.C and P18.CD other bump:1.63196 Ang I14.O and P18.CD neighbor-bump: 2.15874 Ang T12.CA and P13.CD neighbor-bump: 1.54448 Ang T12.C and P13.CD neighbor-bump: 2.40259 Ang T12.O and P13.CD neighbor-bump: 2.808 Ang T12.C and P13.CG neighbor-bump: 2.41047 Ang T12.CB and P13.N T0191 108 :PIVKAEKLREDMVVMDLIYNPLETVLLKEAK 1gcoA 170 :ETLALEYAPKGIRVNNIGPGAINTPINAEKF Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 33 residues other bump:1.83564 Ang N21.OD1 and L23.CD1 neighbor-bump: 2.8974 Ang N21.OD1 and P22.C neighbor-bump: 2.72821 Ang N21.CB and P22.CD neighbor-bump: 2.46003 Ang N21.CB and P22.N other bump:1.90978 Ang K5.O and L9.CD1 T0191 139 :KVNAKTINGLGMLIYQGAVAFK 1gcoA 214 :PMGYIGEPEEIAAVAAWLASSE Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 23 residues Number of specific fragments= 8 total=203 Number of alignments=34 # Reading fragments from alignment file # T0191 read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1gegA/T0191-1gegA-2track-protein-STR-local-adpstyle5.pw.a2m.gz # 1gegA read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1gegA/T0191-1gegA-2track-protein-STR-local-adpstyle5.pw.a2m.gz # found chain 1gegA in template set T0191 24 :KNIVIYGAG 1gegA 3 :KVALVTGAG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues T0191 33 :GAARAVAFELAK 1gegA 13 :GIGKAIALRLVK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGLDVD 1gegA 26 :GFAVAIADYNDATAKAVASEINQAGGHAVAVKVDVSDRDQV Fragment has 32 clashes (null) has 32 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 43 residues other bump:2.61574 Ang V34.CG2 and V41.CG1 other bump:2.09426 Ang V12.CG1 and E33.OE2 other bump:2.9359 Ang V12.CG1 and E33.CD other bump:1.10458 Ang L18.O and K29.NZ other bump:2.92713 Ang I22.CG1 and K29.NZ other bump:2.43746 Ang A19.N and K29.NZ other bump:2.30579 Ang A19.CA and K29.NZ other bump:2.13947 Ang A19.C and K29.NZ other bump:1.97321 Ang L18.C and K29.NZ other bump:2.51833 Ang I22.CB and K29.CE other bump:2.97804 Ang I22.CG1 and K29.CE other bump:2.01908 Ang A19.CA and K29.CE other bump:1.64907 Ang A19.O and K29.CE other bump:1.91244 Ang A19.C and K29.CE other bump:3.07408 Ang L18.C and K29.CE other bump:3.23272 Ang I22.CG1 and K29.CD other bump:2.81068 Ang I22.CD1 and K29.CD other bump:2.93745 Ang A19.N and K29.CD other bump:2.03154 Ang A19.CA and K29.CD other bump:2.84717 Ang A19.C and K29.CD other bump:2.89385 Ang A19.CB and K29.CD other bump:2.80244 Ang A19.CA and K29.CG other bump:2.92437 Ang A19.CB and K29.CG other bump:2.87953 Ang N4.CG and K28.CD other bump:2.56843 Ang N4.ND2 and K28.CD other bump:2.69794 Ang N4.OD1 and K28.CB other bump:2.78354 Ang I22.CG2 and N27.ND2 other bump:2.83123 Ang I22.CG2 and N27.CG other bump:2.55965 Ang I22.CG2 and N27.CB other bump:2.12886 Ang N9.CG and T11.OG1 other bump:1.26249 Ang N9.OD1 and T11.OG1 other bump:2.40651 Ang N9.OD1 and T11.CB T0191 86 :LDGVDIIINATPIGMYPNIDVEPIVKAEK 1gegA 77 :LGGFDVIVNNAGVAPSTPIESITPEIVDK Fragment has 26 clashes (null) has 26 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 31 residues other bump:1.89471 Ang I25.CG1 and E29.OE2 other bump:2.18272 Ang I25.CD1 and E29.OE2 other bump:2.42293 Ang I25.O and E29.OE2 other bump:2.78434 Ang V26.CA and E29.OE1 other bump:0.976067 Ang I25.O and E29.OE1 other bump:1.92808 Ang I25.C and E29.OE1 other bump:2.95778 Ang I25.CG1 and E29.CD other bump:1.88106 Ang I25.O and E29.CD other bump:2.81622 Ang I25.C and E29.CD other bump:2.63461 Ang M16.SD and K27.NZ other bump:1.56368 Ang M16.CE and K27.NZ other bump:2.88386 Ang M16.CE and K27.CE other bump:2.92791 Ang P24.CG and K27.CD other bump:2.6561 Ang P24.CD and K27.CD other bump:2.95736 Ang P24.CG and K27.CG neighbor-bump: 1.99253 Ang Y17.C and P18.CD neighbor-bump: 2.49673 Ang Y17.C and P18.CG other bump:2.01595 Ang A11.O and P13.CD other bump:2.66032 Ang A11.C and P13.CD neighbor-bump: 2.15168 Ang T12.O and P13.CD neighbor-bump: 2.00296 Ang T12.CA and P13.CD neighbor-bump: 1.32553 Ang T12.C and P13.CD other bump:2.23158 Ang A11.O and P13.CG other bump:3.13336 Ang A11.C and P13.CG neighbor-bump: 2.2263 Ang T12.O and P13.CG neighbor-bump: 2.20272 Ang T12.C and P13.CG Number of specific fragments= 4 total=207 Number of alignments=35 # Reading fragments from alignment file # T0191 read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1gegA/T0191-1gegA-2track-protein-STR-local-adpstyle1.pw.a2m.gz # 1gegA read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1gegA/T0191-1gegA-2track-protein-STR-local-adpstyle1.pw.a2m.gz # found chain 1gegA in template set T0191 24 :KNIVIYGAG 1gegA 3 :KVALVTGAG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues T0191 33 :GAARAVAFELAK 1gegA 13 :GIGKAIALRLVK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGLDVD 1gegA 26 :GFAVAIADYNDATAKAVASEINQAGGHAVAVKVDVSDRDQV Fragment has 32 clashes (null) has 32 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 43 residues other bump:2.61574 Ang V34.CG2 and V41.CG1 other bump:2.09426 Ang V12.CG1 and E33.OE2 other bump:2.9359 Ang V12.CG1 and E33.CD other bump:1.10458 Ang L18.O and K29.NZ other bump:2.92713 Ang I22.CG1 and K29.NZ other bump:2.43746 Ang A19.N and K29.NZ other bump:2.30579 Ang A19.CA and K29.NZ other bump:2.13947 Ang A19.C and K29.NZ other bump:1.97321 Ang L18.C and K29.NZ other bump:2.51833 Ang I22.CB and K29.CE other bump:2.97804 Ang I22.CG1 and K29.CE other bump:2.01908 Ang A19.CA and K29.CE other bump:1.64907 Ang A19.O and K29.CE other bump:1.91244 Ang A19.C and K29.CE other bump:3.07408 Ang L18.C and K29.CE other bump:3.23272 Ang I22.CG1 and K29.CD other bump:2.81068 Ang I22.CD1 and K29.CD other bump:2.93745 Ang A19.N and K29.CD other bump:2.03154 Ang A19.CA and K29.CD other bump:2.84717 Ang A19.C and K29.CD other bump:2.89385 Ang A19.CB and K29.CD other bump:2.80244 Ang A19.CA and K29.CG other bump:2.92437 Ang A19.CB and K29.CG other bump:2.87953 Ang N4.CG and K28.CD other bump:2.56843 Ang N4.ND2 and K28.CD other bump:2.69794 Ang N4.OD1 and K28.CB other bump:2.78354 Ang I22.CG2 and N27.ND2 other bump:2.83123 Ang I22.CG2 and N27.CG other bump:2.55965 Ang I22.CG2 and N27.CB other bump:2.12886 Ang N9.CG and T11.OG1 other bump:1.26249 Ang N9.OD1 and T11.OG1 other bump:2.40651 Ang N9.OD1 and T11.CB T0191 86 :LDGVDIIINATPIGMYPNIDVEPIVKAEKL 1gegA 77 :LGGFDVIVNNAGVAPSTPIESITPEIVDKV Fragment has 26 clashes (null) has 26 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 32 residues other bump:1.89471 Ang I25.CG1 and E29.OE2 other bump:2.18272 Ang I25.CD1 and E29.OE2 other bump:2.42293 Ang I25.O and E29.OE2 other bump:2.78434 Ang V26.CA and E29.OE1 other bump:0.976067 Ang I25.O and E29.OE1 other bump:1.92808 Ang I25.C and E29.OE1 other bump:2.95778 Ang I25.CG1 and E29.CD other bump:1.88106 Ang I25.O and E29.CD other bump:2.81622 Ang I25.C and E29.CD other bump:2.63461 Ang M16.SD and K27.NZ other bump:1.56368 Ang M16.CE and K27.NZ other bump:2.88386 Ang M16.CE and K27.CE other bump:2.92791 Ang P24.CG and K27.CD other bump:2.6561 Ang P24.CD and K27.CD other bump:2.95736 Ang P24.CG and K27.CG neighbor-bump: 1.99253 Ang Y17.C and P18.CD neighbor-bump: 2.49673 Ang Y17.C and P18.CG other bump:2.01595 Ang A11.O and P13.CD other bump:2.66032 Ang A11.C and P13.CD neighbor-bump: 2.15168 Ang T12.O and P13.CD neighbor-bump: 2.00296 Ang T12.CA and P13.CD neighbor-bump: 1.32553 Ang T12.C and P13.CD other bump:2.23158 Ang A11.O and P13.CG other bump:3.13336 Ang A11.C and P13.CG neighbor-bump: 2.2263 Ang T12.O and P13.CG neighbor-bump: 2.20272 Ang T12.C and P13.CG Number of specific fragments= 4 total=211 Number of alignments=36 # Reading fragments from alignment file # T0191 read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1fmcA/T0191-1fmcA-2track-protein-STR-local-adpstyle5.pw.a2m.gz # 1fmcA read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1fmcA/T0191-1fmcA-2track-protein-STR-local-adpstyle5.pw.a2m.gz # found chain 1fmcA in template set T0191 18 :IGRVKDKNIVIYGAG 1fmcA 6 :NLRLDGKCAIITGAG Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 17 residues other bump:2.64343 Ang R4.NE and K6.CE T0191 33 :GAARAVAFELAK 1fmcA 22 :GIGKEIAITFAT Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:3.07616 Ang R5.CG and F9.CZ other bump:2.16023 Ang R5.NH1 and F9.CE1 T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGLDVD 1fmcA 35 :GASVVVSDINADAANHVVDEIQQLGGQAFACRCDITSEQEL Fragment has 43 clashes (null) has 43 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 43 residues other bump:2.97946 Ang V34.CG1 and V41.CG1 other bump:2.88234 Ang K35.N and V41.CG1 other bump:2.33425 Ang R10.NH2 and K35.NZ other bump:2.75278 Ang R10.NE and K35.NZ other bump:2.46903 Ang R10.CZ and K35.NZ other bump:3.08942 Ang R10.CZ and K35.CD other bump:2.95333 Ang R10.CG and K35.CG other bump:2.89546 Ang E32.CG and V34.CG2 other bump:2.95631 Ang E32.CD and V34.CG2 other bump:2.52883 Ang E32.OE1 and V34.CG2 other bump:2.86069 Ang V12.CG1 and E33.OE2 other bump:2.61053 Ang V12.CA and E33.OE1 other bump:2.12323 Ang V12.CB and E33.OE1 other bump:1.46015 Ang V12.CG1 and E33.OE1 other bump:2.53367 Ang V12.CG2 and E33.OE1 other bump:1.97801 Ang V12.CG1 and E33.CD other bump:2.64474 Ang V12.CG1 and E33.CG other bump:2.71105 Ang V12.CG1 and E33.CB other bump:1.97712 Ang A19.CA and K29.NZ other bump:2.04116 Ang A19.C and K29.NZ other bump:1.21907 Ang L18.O and K29.NZ other bump:1.90229 Ang L18.C and K29.NZ other bump:2.2055 Ang A19.N and K29.NZ other bump:2.78468 Ang I22.CB and K29.CE other bump:1.88544 Ang A19.CA and K29.CE other bump:1.93764 Ang A19.O and K29.CE other bump:2.1214 Ang A19.C and K29.CE other bump:2.39855 Ang A19.CA and K29.CD other bump:3.07583 Ang A19.CB and K29.CD other bump:3.22948 Ang A19.CA and K29.CG other bump:2.40177 Ang N4.CG and K28.CD other bump:2.4606 Ang N4.ND2 and K28.CD other bump:2.51844 Ang N4.OD1 and K28.CD other bump:2.58373 Ang N4.OD1 and K28.CB other bump:2.74316 Ang K25.CB and N27.ND2 other bump:3.03038 Ang I22.CG2 and N27.CG other bump:2.24775 Ang I22.CG2 and N27.CB other bump:2.72754 Ang I5.CD1 and I22.CD1 other bump:3.0841 Ang I7.CD1 and L18.CB other bump:2.37256 Ang N9.CG and T11.OG1 other bump:1.43799 Ang N9.OD1 and T11.OG1 other bump:2.57783 Ang N9.OD1 and T11.CB other bump:2.93639 Ang I5.CD1 and I7.CG2 T0191 86 :LDGVDIIINATPIGMYPNIDVEP 1fmcA 86 :LGKVDILVNNAGGGGPKPFDMPM Fragment has 16 clashes (null) has 16 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 25 residues other bump:2.34456 Ang N19.O and V22.CG2 neighbor-bump: 2.55885 Ang G15.O and M16.CG neighbor-bump: 2.03735 Ang G15.O and M16.CB neighbor-bump: 2.51066 Ang G15.C and M16.CB neighbor-bump: 2.44956 Ang P13.C and I14.CG2 neighbor-bump: 1.51342 Ang P13.O and I14.CG2 neighbor-bump: 2.20267 Ang T12.O and P13.CD neighbor-bump: 2.49281 Ang T12.N and P13.CD other bump:1.94137 Ang A11.O and P13.CD other bump:2.4874 Ang A11.C and P13.CD neighbor-bump: 1.87871 Ang T12.CA and P13.CD neighbor-bump: 1.3343 Ang T12.C and P13.CD other bump:2.07084 Ang A11.O and P13.CG other bump:2.9735 Ang A11.C and P13.CG neighbor-bump: 2.35092 Ang T12.C and P13.CG self-bump: 1.36654 Ang D3.CA and D3.CB Number of specific fragments= 4 total=215 Number of alignments=37 # Reading fragments from alignment file # T0191 read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1fmcA/T0191-1fmcA-2track-protein-STR-local-adpstyle1.pw.a2m.gz # 1fmcA read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1fmcA/T0191-1fmcA-2track-protein-STR-local-adpstyle1.pw.a2m.gz # found chain 1fmcA in template set T0191 18 :IGRVKDKNIVIYGAG 1fmcA 6 :NLRLDGKCAIITGAG Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 17 residues other bump:2.64343 Ang R4.NE and K6.CE T0191 33 :GAARAVAFELAK 1fmcA 22 :GIGKEIAITFAT Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:3.07616 Ang R5.CG and F9.CZ other bump:2.16023 Ang R5.NH1 and F9.CE1 T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGLDVD 1fmcA 35 :GASVVVSDINADAANHVVDEIQQLGGQAFACRCDITSEQEL Fragment has 43 clashes (null) has 43 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 43 residues other bump:2.97946 Ang V34.CG1 and V41.CG1 other bump:2.88234 Ang K35.N and V41.CG1 other bump:2.33425 Ang R10.NH2 and K35.NZ other bump:2.75278 Ang R10.NE and K35.NZ other bump:2.46903 Ang R10.CZ and K35.NZ other bump:3.08942 Ang R10.CZ and K35.CD other bump:2.95333 Ang R10.CG and K35.CG other bump:2.89546 Ang E32.CG and V34.CG2 other bump:2.95631 Ang E32.CD and V34.CG2 other bump:2.52883 Ang E32.OE1 and V34.CG2 other bump:2.86069 Ang V12.CG1 and E33.OE2 other bump:2.61053 Ang V12.CA and E33.OE1 other bump:2.12323 Ang V12.CB and E33.OE1 other bump:1.46015 Ang V12.CG1 and E33.OE1 other bump:2.53367 Ang V12.CG2 and E33.OE1 other bump:1.97801 Ang V12.CG1 and E33.CD other bump:2.64474 Ang V12.CG1 and E33.CG other bump:2.71105 Ang V12.CG1 and E33.CB other bump:1.97712 Ang A19.CA and K29.NZ other bump:2.04116 Ang A19.C and K29.NZ other bump:1.21907 Ang L18.O and K29.NZ other bump:1.90229 Ang L18.C and K29.NZ other bump:2.2055 Ang A19.N and K29.NZ other bump:2.78468 Ang I22.CB and K29.CE other bump:1.88544 Ang A19.CA and K29.CE other bump:1.93764 Ang A19.O and K29.CE other bump:2.1214 Ang A19.C and K29.CE other bump:2.39855 Ang A19.CA and K29.CD other bump:3.07583 Ang A19.CB and K29.CD other bump:3.22948 Ang A19.CA and K29.CG other bump:2.40177 Ang N4.CG and K28.CD other bump:2.4606 Ang N4.ND2 and K28.CD other bump:2.51844 Ang N4.OD1 and K28.CD other bump:2.58373 Ang N4.OD1 and K28.CB other bump:2.74316 Ang K25.CB and N27.ND2 other bump:3.03038 Ang I22.CG2 and N27.CG other bump:2.24775 Ang I22.CG2 and N27.CB other bump:2.72754 Ang I5.CD1 and I22.CD1 other bump:3.0841 Ang I7.CD1 and L18.CB other bump:2.37256 Ang N9.CG and T11.OG1 other bump:1.43799 Ang N9.OD1 and T11.OG1 other bump:2.57783 Ang N9.OD1 and T11.CB other bump:2.93639 Ang I5.CD1 and I7.CG2 T0191 86 :LDGVDIIINATPIGMYPNIDVEP 1fmcA 86 :LGKVDILVNNAGGGGPKPFDMPM Fragment has 16 clashes (null) has 16 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 25 residues other bump:2.34456 Ang N19.O and V22.CG2 neighbor-bump: 2.55885 Ang G15.O and M16.CG neighbor-bump: 2.03735 Ang G15.O and M16.CB neighbor-bump: 2.51066 Ang G15.C and M16.CB neighbor-bump: 2.44956 Ang P13.C and I14.CG2 neighbor-bump: 1.51342 Ang P13.O and I14.CG2 neighbor-bump: 2.20267 Ang T12.O and P13.CD neighbor-bump: 2.49281 Ang T12.N and P13.CD other bump:1.94137 Ang A11.O and P13.CD other bump:2.4874 Ang A11.C and P13.CD neighbor-bump: 1.87871 Ang T12.CA and P13.CD neighbor-bump: 1.3343 Ang T12.C and P13.CD other bump:2.07084 Ang A11.O and P13.CG other bump:2.9735 Ang A11.C and P13.CG neighbor-bump: 2.35092 Ang T12.C and P13.CG self-bump: 1.36654 Ang D3.CA and D3.CB Number of specific fragments= 4 total=219 Number of alignments=38 # Reading fragments from alignment file # T0191 read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1ja9A/T0191-1ja9A-2track-protein-STR-global-adpstyle1.pw.a2m.gz # 1ja9A read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1ja9A/T0191-1ja9A-2track-protein-STR-global-adpstyle1.pw.a2m.gz # adding 1ja9A to template set 1ja9A:# found chain 1ja9A in template set T0191 19 :GRVKDKNIVIYGAG 1ja9A 25 :KPLAGKVALTTGAG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 16 residues T0191 33 :GAARAVAFELAK 1ja9A 40 :GIGRGIAIELGR Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:2.85728 Ang R5.CG and F9.CE1 other bump:2.88741 Ang R5.CZ and F9.CE1 other bump:2.94117 Ang R5.NH1 and F9.CE1 T0191 45 :DNNIIIANRT 1ja9A 53 :GASVVVNYGS Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 12 residues self-bump: 1.3897 Ang R10.CA and R10.CB other bump:3.01155 Ang I5.CD1 and I7.CG2 T0191 55 :VEKAEALAKEIAEKLNKKFGEEVKFSGLDVD 1ja9A 64 :SKAAEEVVAELKKLGAQGVAIQADISKPSEV Fragment has 31 clashes (null) has 31 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 33 residues other bump:3.06391 Ang V24.CG1 and V31.C other bump:2.50817 Ang V24.CG1 and V31.O other bump:2.48554 Ang V24.CG1 and V31.CG1 other bump:2.73549 Ang K25.N and V31.CG1 neighbor-bump: 2.45045 Ang E23.O and V24.CG2 neighbor-bump: 2.92735 Ang E23.C and V24.CG2 other bump:1.37741 Ang A9.CA and K19.NZ other bump:2.79379 Ang A9.CB and K19.NZ other bump:2.24606 Ang A9.O and K19.NZ other bump:1.31781 Ang A9.C and K19.NZ other bump:1.78874 Ang K10.N and K19.NZ other bump:1.65104 Ang L8.C and K19.NZ other bump:1.42613 Ang A9.N and K19.NZ other bump:1.76442 Ang L8.O and K19.NZ other bump:0.935012 Ang A9.CA and K19.CE other bump:2.18335 Ang A9.CB and K19.CE other bump:1.76757 Ang A9.O and K19.CE other bump:1.37167 Ang A9.C and K19.CE other bump:2.60345 Ang K10.N and K19.CE other bump:2.75885 Ang L8.C and K19.CE other bump:2.1597 Ang A9.N and K19.CE other bump:2.91193 Ang I12.CD1 and K19.CD other bump:1.63379 Ang A9.CA and K19.CD other bump:2.45234 Ang A9.CB and K19.CD other bump:2.8436 Ang A9.C and K19.CD other bump:2.96009 Ang L8.C and K19.CD other bump:2.35857 Ang A9.N and K19.CD other bump:2.71931 Ang A9.CA and K19.CG other bump:2.78499 Ang A9.CB and K19.CG other bump:3.12403 Ang I12.CD1 and K19.CB other bump:3.05408 Ang I12.CG2 and N17.C T0191 86 :LDGVDIIINATPIGMYPNIDVE 1ja9A 105 :FGGLDFVMSNSGMEVWCDELEV Fragment has 20 clashes (null) has 20 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 24 residues other bump:2.5102 Ang I20.CA and E23.OE2 other bump:2.42672 Ang P18.O and E23.OE2 other bump:2.59599 Ang N19.C and E23.OE2 other bump:2.10593 Ang I20.CA and E23.OE1 other bump:1.7054 Ang I20.O and E23.OE1 other bump:2.03201 Ang I20.C and E23.OE1 other bump:2.62359 Ang I20.CA and E23.CD other bump:3.04973 Ang I20.C and E23.CD other bump:3.18528 Ang N19.C and E23.CD neighbor-bump: 2.45839 Ang Y17.CA and P18.CD neighbor-bump: 1.76985 Ang Y17.C and P18.CD other bump:2.6268 Ang A11.C and P13.CD neighbor-bump: 2.22047 Ang T12.O and P13.CD other bump:1.94407 Ang A11.O and P13.CD neighbor-bump: 2.02649 Ang T12.CA and P13.CD neighbor-bump: 1.35838 Ang T12.C and P13.CD other bump:3.08644 Ang A11.C and P13.CG neighbor-bump: 2.30673 Ang T12.O and P13.CG other bump:2.14854 Ang A11.O and P13.CG neighbor-bump: 2.22394 Ang T12.C and P13.CG T0191 108 :PIVKAEKLREDMVVMDLIYNPLETVLLKEAKKVNAK 1ja9A 190 :RAFAVDCGAKGVTVNCIAPGGVKTDMFDENSWHYAP Fragment has 37 clashes (null) has 37 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 38 residues other bump:2.20411 Ang L28.CG and K32.NZ other bump:1.15115 Ang L28.CD2 and K32.NZ other bump:0.8332 Ang L28.CG and K32.CE other bump:1.94242 Ang L28.CD1 and K32.CE other bump:2.07149 Ang L28.CB and K32.CE other bump:0.574991 Ang L28.CD2 and K32.CE other bump:2.99298 Ang L28.C and K32.CE other bump:2.04952 Ang L28.CG and K32.CD other bump:2.58221 Ang L28.CD1 and K32.CD other bump:1.41564 Ang L28.CD2 and K32.CD other bump:3.14534 Ang L28.C and K32.CD other bump:2.54923 Ang L28.CG and K32.CG other bump:2.74709 Ang L28.CD1 and K32.CG other bump:2.66821 Ang L28.CD2 and K32.CG other bump:2.27153 Ang L28.O and K32.CG other bump:2.93679 Ang L28.C and K32.CG other bump:2.76371 Ang N21.OD1 and L23.CD2 other bump:2.69268 Ang Y20.CD2 and L23.CD1 other bump:1.81021 Ang L18.CD1 and Y20.OH other bump:2.32478 Ang L18.CD1 and Y20.CZ other bump:2.52479 Ang L18.CG and Y20.CE1 other bump:2.29571 Ang L18.CD1 and Y20.CE1 other bump:2.88028 Ang K5.CE and V15.C other bump:2.51926 Ang K5.CG and V15.O other bump:2.50886 Ang K5.CD and V15.O other bump:1.69694 Ang K5.CE and V15.O other bump:2.69324 Ang K8.CD and V15.CG2 other bump:1.28631 Ang K8.CE and V15.CG2 other bump:2.07108 Ang K8.NZ and V15.CG2 other bump:2.96426 Ang K8.NZ and V15.CG1 other bump:2.7195 Ang K8.CE and V15.CB other bump:2.87468 Ang K8.NZ and V15.CB other bump:2.15371 Ang V4.CB and K8.NZ other bump:0.972933 Ang V4.CG1 and K8.NZ other bump:2.79897 Ang V4.C and K8.NZ other bump:2.32186 Ang V4.CG1 and K8.CE other bump:2.9784 Ang V4.CG1 and K8.CD T0191 144 :TINGLGMLIYQGAVAFK 1ja9A 228 :YKGMPQEKIDEGLANMN Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 18 residues other bump:2.3226 Ang G13.O and F17.CD1 Number of specific fragments= 7 total=226 Number of alignments=39 # Reading fragments from alignment file # T0191 read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1ja9A/T0191-1ja9A-2track-protein-STR-global-adpstyle5.pw.a2m.gz # 1ja9A read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1ja9A/T0191-1ja9A-2track-protein-STR-global-adpstyle5.pw.a2m.gz # found chain 1ja9A in template set T0191 19 :GRVKDKNIVIYGAG 1ja9A 25 :KPLAGKVALTTGAG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 16 residues T0191 33 :GAARAVAFELAK 1ja9A 40 :GIGRGIAIELGR Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:2.85728 Ang R5.CG and F9.CE1 other bump:2.88741 Ang R5.CZ and F9.CE1 other bump:2.94117 Ang R5.NH1 and F9.CE1 T0191 45 :DNNIIIANRT 1ja9A 53 :GASVVVNYGS Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 12 residues self-bump: 1.3897 Ang R10.CA and R10.CB other bump:3.01155 Ang I5.CD1 and I7.CG2 T0191 55 :VEKAEALAKEIAEKLNKKFGEEVKFSGLDVD 1ja9A 64 :SKAAEEVVAELKKLGAQGVAIQADISKPSEV Fragment has 31 clashes (null) has 31 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 33 residues other bump:3.06391 Ang V24.CG1 and V31.C other bump:2.50817 Ang V24.CG1 and V31.O other bump:2.48554 Ang V24.CG1 and V31.CG1 other bump:2.73549 Ang K25.N and V31.CG1 neighbor-bump: 2.45045 Ang E23.O and V24.CG2 neighbor-bump: 2.92735 Ang E23.C and V24.CG2 other bump:1.37741 Ang A9.CA and K19.NZ other bump:2.79379 Ang A9.CB and K19.NZ other bump:2.24606 Ang A9.O and K19.NZ other bump:1.31781 Ang A9.C and K19.NZ other bump:1.78874 Ang K10.N and K19.NZ other bump:1.65104 Ang L8.C and K19.NZ other bump:1.42613 Ang A9.N and K19.NZ other bump:1.76442 Ang L8.O and K19.NZ other bump:0.935012 Ang A9.CA and K19.CE other bump:2.18335 Ang A9.CB and K19.CE other bump:1.76757 Ang A9.O and K19.CE other bump:1.37167 Ang A9.C and K19.CE other bump:2.60345 Ang K10.N and K19.CE other bump:2.75885 Ang L8.C and K19.CE other bump:2.1597 Ang A9.N and K19.CE other bump:2.91193 Ang I12.CD1 and K19.CD other bump:1.63379 Ang A9.CA and K19.CD other bump:2.45234 Ang A9.CB and K19.CD other bump:2.8436 Ang A9.C and K19.CD other bump:2.96009 Ang L8.C and K19.CD other bump:2.35857 Ang A9.N and K19.CD other bump:2.71931 Ang A9.CA and K19.CG other bump:2.78499 Ang A9.CB and K19.CG other bump:3.12403 Ang I12.CD1 and K19.CB other bump:3.05408 Ang I12.CG2 and N17.C T0191 86 :LDGVDIIINATPIGMYPNIDVE 1ja9A 105 :FGGLDFVMSNSGMEVWCDELEV Fragment has 20 clashes (null) has 20 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 24 residues other bump:2.5102 Ang I20.CA and E23.OE2 other bump:2.42672 Ang P18.O and E23.OE2 other bump:2.59599 Ang N19.C and E23.OE2 other bump:2.10593 Ang I20.CA and E23.OE1 other bump:1.7054 Ang I20.O and E23.OE1 other bump:2.03201 Ang I20.C and E23.OE1 other bump:2.62359 Ang I20.CA and E23.CD other bump:3.04973 Ang I20.C and E23.CD other bump:3.18528 Ang N19.C and E23.CD neighbor-bump: 2.45839 Ang Y17.CA and P18.CD neighbor-bump: 1.76985 Ang Y17.C and P18.CD other bump:2.6268 Ang A11.C and P13.CD neighbor-bump: 2.22047 Ang T12.O and P13.CD other bump:1.94407 Ang A11.O and P13.CD neighbor-bump: 2.02649 Ang T12.CA and P13.CD neighbor-bump: 1.35838 Ang T12.C and P13.CD other bump:3.08644 Ang A11.C and P13.CG neighbor-bump: 2.30673 Ang T12.O and P13.CG other bump:2.14854 Ang A11.O and P13.CG neighbor-bump: 2.22394 Ang T12.C and P13.CG T0191 108 :PIVKAEKLREDMVVMDLIYNPLETVLLKEAKKVNAK 1ja9A 190 :RAFAVDCGAKGVTVNCIAPGGVKTDMFDENSWHYAP Fragment has 37 clashes (null) has 37 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 38 residues other bump:2.20411 Ang L28.CG and K32.NZ other bump:1.15115 Ang L28.CD2 and K32.NZ other bump:0.8332 Ang L28.CG and K32.CE other bump:1.94242 Ang L28.CD1 and K32.CE other bump:2.07149 Ang L28.CB and K32.CE other bump:0.574991 Ang L28.CD2 and K32.CE other bump:2.99298 Ang L28.C and K32.CE other bump:2.04952 Ang L28.CG and K32.CD other bump:2.58221 Ang L28.CD1 and K32.CD other bump:1.41564 Ang L28.CD2 and K32.CD other bump:3.14534 Ang L28.C and K32.CD other bump:2.54923 Ang L28.CG and K32.CG other bump:2.74709 Ang L28.CD1 and K32.CG other bump:2.66821 Ang L28.CD2 and K32.CG other bump:2.27153 Ang L28.O and K32.CG other bump:2.93679 Ang L28.C and K32.CG other bump:2.76371 Ang N21.OD1 and L23.CD2 other bump:2.69268 Ang Y20.CD2 and L23.CD1 other bump:1.81021 Ang L18.CD1 and Y20.OH other bump:2.32478 Ang L18.CD1 and Y20.CZ other bump:2.52479 Ang L18.CG and Y20.CE1 other bump:2.29571 Ang L18.CD1 and Y20.CE1 other bump:2.88028 Ang K5.CE and V15.C other bump:2.51926 Ang K5.CG and V15.O other bump:2.50886 Ang K5.CD and V15.O other bump:1.69694 Ang K5.CE and V15.O other bump:2.69324 Ang K8.CD and V15.CG2 other bump:1.28631 Ang K8.CE and V15.CG2 other bump:2.07108 Ang K8.NZ and V15.CG2 other bump:2.96426 Ang K8.NZ and V15.CG1 other bump:2.7195 Ang K8.CE and V15.CB other bump:2.87468 Ang K8.NZ and V15.CB other bump:2.15371 Ang V4.CB and K8.NZ other bump:0.972933 Ang V4.CG1 and K8.NZ other bump:2.79897 Ang V4.C and K8.NZ other bump:2.32186 Ang V4.CG1 and K8.CE other bump:2.9784 Ang V4.CG1 and K8.CD T0191 144 :TINGLGMLIYQGAVAF 1ja9A 228 :YKGMPQEKIDEGLANM Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 18 residues other bump:2.53218 Ang G13.O and F17.CD2 Number of specific fragments= 7 total=233 Number of alignments=40 # Reading fragments from alignment file # T0191 read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1cydA/T0191-1cydA-2track-protein-STR-local-adpstyle1.pw.a2m.gz # 1cydA read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1cydA/T0191-1cydA-2track-protein-STR-local-adpstyle1.pw.a2m.gz # found chain 1cydA in template set T0191 20 :RVKDKNIVIYGAG 1cydA 4 :NFSGLRALVTGAG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues T0191 33 :GAARAVAFELAK 1cydA 18 :GIGRDTVKALHA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKK 1cydA 31 :GAKVVAVTRTNSDLVSLAKECPGIEPVC Fragment has 28 clashes (null) has 28 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 30 residues other bump:2.35913 Ang V12.N and K29.NZ other bump:2.01342 Ang V12.CA and K29.NZ other bump:1.17289 Ang V12.CB and K29.NZ other bump:1.53911 Ang V12.CG1 and K29.NZ other bump:1.25603 Ang V12.CG2 and K29.NZ other bump:3.06242 Ang T11.C and K29.CE other bump:1.94247 Ang V12.N and K29.CE other bump:1.84487 Ang V12.CA and K29.CE other bump:1.71937 Ang V12.CB and K29.CE other bump:1.3082 Ang V12.CG1 and K29.CE other bump:2.69639 Ang V12.CG2 and K29.CE other bump:2.91086 Ang V12.CB and K29.CD other bump:1.67655 Ang V12.CG1 and K29.CD other bump:2.86538 Ang V12.CG1 and K29.CG other bump:2.48335 Ang I5.CD1 and K25.NZ other bump:2.18248 Ang I7.CG1 and K25.NZ other bump:1.72455 Ang I7.CD1 and K25.NZ other bump:2.2857 Ang I5.CD1 and K25.CE other bump:2.57236 Ang I5.CG1 and K25.CE other bump:2.09268 Ang I7.CG1 and K25.CE other bump:2.12582 Ang I7.CD1 and K25.CE other bump:2.88053 Ang I5.CD1 and K25.CD other bump:3.07312 Ang I5.CG1 and K25.CD other bump:3.15783 Ang I5.CG1 and K25.CG neighbor-bump: 2.28952 Ang A23.O and E24.CG neighbor-bump: 2.81687 Ang A23.C and E24.CG neighbor-bump: 3.05478 Ang E21.C and I22.CG1 other bump:2.79592 Ang I5.CD1 and I7.CD1 T0191 74 :GEEVKFSGLDVD 1cydA 59 :VDLGDWDATEKA Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:3.07981 Ang E4.CA and L10.CD2 other bump:2.63169 Ang E4.OE1 and L10.CD2 other bump:2.78259 Ang E4.CD and L10.CD2 other bump:2.95609 Ang E4.CA and L10.CD1 other bump:2.49321 Ang E4.O and L10.CD1 other bump:2.6863 Ang E3.CD and K6.CE other bump:2.41592 Ang E3.OE1 and K6.CE T0191 86 :LDGVDIIINATPIGMYPNIDVEPIVKAEK 1cydA 74 :IGPVDLLVNNAALVIMQPFLEVTKEAFDR Fragment has 19 clashes (null) has 19 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 31 residues other bump:1.99886 Ang P18.CG and K27.NZ other bump:2.20825 Ang P18.CD and K27.NZ other bump:2.95241 Ang P18.CG and K27.CE other bump:2.3839 Ang P18.CD and K27.CE other bump:2.87469 Ang P18.CG and K27.CD other bump:1.84345 Ang P18.CD and K27.CD other bump:2.9136 Ang P24.CG and K27.CG other bump:2.74651 Ang P18.CD and P24.CD other bump:1.9689 Ang A11.O and P13.CD other bump:2.62767 Ang A11.C and P13.CD neighbor-bump: 2.1246 Ang T12.CA and P13.CD neighbor-bump: 2.20012 Ang T12.O and P13.CD neighbor-bump: 1.41579 Ang T12.C and P13.CD other bump:2.45057 Ang A11.O and P13.CG neighbor-bump: 2.39862 Ang T12.O and P13.CG neighbor-bump: 2.3511 Ang T12.C and P13.CG neighbor-bump: 2.47861 Ang D3.CB and G4.N self-bump: 2.19176 Ang D3.CB and D3.C self-bump: 1.29723 Ang D3.CA and D3.CB Number of specific fragments= 5 total=238 Number of alignments=41 # Reading fragments from alignment file # T0191 read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1cydA/T0191-1cydA-2track-protein-STR-local-adpstyle5.pw.a2m.gz # 1cydA read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1cydA/T0191-1cydA-2track-protein-STR-local-adpstyle5.pw.a2m.gz # found chain 1cydA in template set T0191 20 :RVKDKNIVIYGAG 1cydA 4 :NFSGLRALVTGAG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues T0191 33 :GAARAVAFELAK 1cydA 18 :GIGRDTVKALHA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKK 1cydA 31 :GAKVVAVTRTNSDLVSLAKECPGIEPVC Fragment has 28 clashes (null) has 28 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 30 residues other bump:2.35913 Ang V12.N and K29.NZ other bump:2.01342 Ang V12.CA and K29.NZ other bump:1.17289 Ang V12.CB and K29.NZ other bump:1.53911 Ang V12.CG1 and K29.NZ other bump:1.25603 Ang V12.CG2 and K29.NZ other bump:3.06242 Ang T11.C and K29.CE other bump:1.94247 Ang V12.N and K29.CE other bump:1.84487 Ang V12.CA and K29.CE other bump:1.71937 Ang V12.CB and K29.CE other bump:1.3082 Ang V12.CG1 and K29.CE other bump:2.69639 Ang V12.CG2 and K29.CE other bump:2.91086 Ang V12.CB and K29.CD other bump:1.67655 Ang V12.CG1 and K29.CD other bump:2.86538 Ang V12.CG1 and K29.CG other bump:2.48335 Ang I5.CD1 and K25.NZ other bump:2.18248 Ang I7.CG1 and K25.NZ other bump:1.72455 Ang I7.CD1 and K25.NZ other bump:2.2857 Ang I5.CD1 and K25.CE other bump:2.57236 Ang I5.CG1 and K25.CE other bump:2.09268 Ang I7.CG1 and K25.CE other bump:2.12582 Ang I7.CD1 and K25.CE other bump:2.88053 Ang I5.CD1 and K25.CD other bump:3.07312 Ang I5.CG1 and K25.CD other bump:3.15783 Ang I5.CG1 and K25.CG neighbor-bump: 2.28952 Ang A23.O and E24.CG neighbor-bump: 2.81687 Ang A23.C and E24.CG neighbor-bump: 3.05478 Ang E21.C and I22.CG1 other bump:2.79592 Ang I5.CD1 and I7.CD1 T0191 74 :GEEVKFSGLDVD 1cydA 59 :VDLGDWDATEKA Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:3.07981 Ang E4.CA and L10.CD2 other bump:2.63169 Ang E4.OE1 and L10.CD2 other bump:2.78259 Ang E4.CD and L10.CD2 other bump:2.95609 Ang E4.CA and L10.CD1 other bump:2.49321 Ang E4.O and L10.CD1 other bump:2.6863 Ang E3.CD and K6.CE other bump:2.41592 Ang E3.OE1 and K6.CE T0191 86 :LDGVDIIINATPIGMYPNIDVEPIVKA 1cydA 74 :IGPVDLLVNNAALVIMQPFLEVTKEAF Fragment has 19 clashes (null) has 19 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 29 residues other bump:1.99886 Ang P18.CG and K27.NZ other bump:2.20825 Ang P18.CD and K27.NZ other bump:2.95241 Ang P18.CG and K27.CE other bump:2.3839 Ang P18.CD and K27.CE other bump:2.87469 Ang P18.CG and K27.CD other bump:1.84345 Ang P18.CD and K27.CD other bump:2.9136 Ang P24.CG and K27.CG other bump:2.74651 Ang P18.CD and P24.CD other bump:1.9689 Ang A11.O and P13.CD other bump:2.62767 Ang A11.C and P13.CD neighbor-bump: 2.1246 Ang T12.CA and P13.CD neighbor-bump: 2.20012 Ang T12.O and P13.CD neighbor-bump: 1.41579 Ang T12.C and P13.CD other bump:2.45057 Ang A11.O and P13.CG neighbor-bump: 2.39862 Ang T12.O and P13.CG neighbor-bump: 2.3511 Ang T12.C and P13.CG neighbor-bump: 2.47861 Ang D3.CB and G4.N self-bump: 2.19176 Ang D3.CB and D3.C self-bump: 1.29723 Ang D3.CA and D3.CB Number of specific fragments= 5 total=243 Number of alignments=42 # Reading fragments from alignment file # T0191 read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1h5qA/T0191-1h5qA-2track-protein-STR-global-adpstyle5.pw.a2m.gz # 1h5qA read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1h5qA/T0191-1h5qA-2track-protein-STR-global-adpstyle5.pw.a2m.gz # adding 1h5qA to template set 1h5qA:# found chain 1h5qA in template set T0191 20 :RVKDKNIVIYGAG 1h5qA 8 :SFVNKTIIVTGGN Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues other bump:2.58965 Ang I10.O and A13.CB neighbor-bump: 2.30466 Ang V9.O and I10.CG2 neighbor-bump: 2.77318 Ang V9.C and I10.CG2 T0191 33 :GAARAVAFELAK 1h5qA 22 :GIGLAFTRAVAA Fragment has 8 clashes (null) has 8 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:2.31033 Ang R5.CZ and F9.CZ other bump:1.46751 Ang R5.NH2 and F9.CZ other bump:2.68969 Ang R5.NH2 and F9.CE2 other bump:2.09532 Ang R5.CZ and F9.CE1 other bump:1.68397 Ang R5.NH2 and F9.CE1 other bump:2.1582 Ang R5.NH1 and F9.CE1 other bump:2.9453 Ang R5.CZ and F9.CD1 other bump:2.49192 Ang R5.NH1 and F9.CD1 T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKK 1h5qA 35 :GANVAVIYRSAADAVEVTEKVGKEFGVK Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 30 residues other bump:2.86863 Ang D2.C and K28.NZ other bump:2.1044 Ang N3.N and K28.NZ other bump:2.6962 Ang D2.CA and K28.CE other bump:2.80501 Ang D2.C and K28.CE other bump:2.55067 Ang N3.N and K28.CE neighbor-bump: 2.68647 Ang R10.C and T11.OG1 other bump:2.1118 Ang N3.ND2 and I5.CG2 T0191 73 :FGEEVK 1h5qA 64 :KAYQCD Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 8 residues neighbor-bump: 2.36853 Ang E5.O and V6.CG2 neighbor-bump: 2.77019 Ang E5.C and V6.CG2 other bump:2.85462 Ang F2.CE2 and E4.CG neighbor-bump: 2.83295 Ang F2.CE2 and G3.O T0191 79 :FSGLDVDLDGVDIIINATPIGMYPN 1h5qA 180 :VKGLAAEWASAGIRVNALSPGYVNT Fragment has 50 clashes (null) has 50 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 27 residues other bump:2.47328 Ang I21.CA and Y24.OH other bump:2.22824 Ang I21.CG1 and Y24.OH other bump:2.75136 Ang I21.CB and Y24.OH other bump:2.86454 Ang G22.N and Y24.CZ other bump:2.94988 Ang I21.CA and Y24.CZ other bump:1.27229 Ang I21.CG1 and Y24.CZ other bump:2.3314 Ang I21.CD1 and Y24.CZ other bump:2.50902 Ang I21.CB and Y24.CZ other bump:2.02521 Ang I21.CG1 and Y24.CE2 other bump:2.08839 Ang I21.CD1 and Y24.CE2 other bump:2.21315 Ang G22.N and Y24.CE1 other bump:3.08524 Ang G22.CA and Y24.CE1 other bump:2.90881 Ang G22.C and Y24.CE1 other bump:2.70891 Ang I21.C and Y24.CE1 other bump:2.8371 Ang I21.CA and Y24.CE1 other bump:1.21919 Ang I21.CG1 and Y24.CE1 other bump:2.37218 Ang I21.CD1 and Y24.CE1 other bump:2.47856 Ang G22.O and Y24.CE1 other bump:2.92435 Ang I21.CG2 and Y24.CE1 other bump:2.27546 Ang I21.CB and Y24.CE1 other bump:2.53346 Ang I21.CG1 and Y24.CD2 other bump:1.83669 Ang I21.CD1 and Y24.CD2 other bump:1.95163 Ang I21.CG1 and Y24.CD1 other bump:2.15605 Ang I21.CD1 and Y24.CD1 other bump:2.23891 Ang G22.O and Y24.CD1 other bump:2.51624 Ang I21.CG1 and Y24.CG other bump:1.88406 Ang I21.CD1 and Y24.CG other bump:3.01184 Ang I21.CD1 and Y24.CB neighbor-bump: 2.8212 Ang T19.C and P20.CG other bump:2.49242 Ang F2.CE2 and A18.CB other bump:2.3019 Ang F2.CD2 and A18.CB other bump:2.65384 Ang F2.CE2 and A18.CA other bump:2.80064 Ang F2.CD2 and A18.CA other bump:3.01504 Ang D6.CG and I16.C other bump:2.55395 Ang D6.OD2 and I16.C other bump:2.75715 Ang D6.OD1 and I16.C other bump:2.34105 Ang D6.CG and I16.O other bump:1.49252 Ang D6.OD2 and I16.O other bump:1.68305 Ang D6.CG and I16.CG2 other bump:2.57811 Ang D6.OD2 and I16.CG2 other bump:2.82552 Ang D6.CA and I16.CG2 other bump:2.63249 Ang D6.CB and I16.CG2 other bump:0.877469 Ang D6.OD1 and I16.CG2 other bump:2.7401 Ang D6.N and I16.CG2 other bump:2.79721 Ang D6.CG and I16.CB other bump:1.66769 Ang D6.OD1 and I16.CB other bump:3.05509 Ang D6.CG and I16.CA other bump:2.23659 Ang D6.OD1 and I16.CA other bump:3.00824 Ang D6.CG and I16.N other bump:2.42312 Ang D6.O and D10.CG T0191 105 :DVEPIVKAEKLR 1h5qA 205 :DQTAHMDKKIRD Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues self-bump: 1.33527 Ang P5.N and P5.CD neighbor-bump: 2.73485 Ang E4.CB and P5.CD neighbor-bump: 2.5366 Ang E4.N and P5.CD self-bump: 2.19771 Ang P5.N and P5.CG T0191 123 :DLIYNPLETVLLKEAK 1h5qA 223 :PLNRFAQPEEMTGQAI Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 18 residues other bump:2.46786 Ang L3.O and Y5.CD1 T0191 139 :KVNAKTINGLGML 1h5qA 249 :TGGEYFIDGGQLI Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues other bump:2.54483 Ang N9.ND2 and M13.CG other bump:2.58097 Ang N9.ND2 and M13.CB neighbor-bump: 2.27808 Ang K2.O and V3.CB neighbor-bump: 2.55767 Ang K2.C and V3.CB Number of specific fragments= 8 total=251 Number of alignments=43 # Reading fragments from alignment file # T0191 read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1h5qA/T0191-1h5qA-2track-protein-STR-global-adpstyle1.pw.a2m.gz # 1h5qA read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1h5qA/T0191-1h5qA-2track-protein-STR-global-adpstyle1.pw.a2m.gz # found chain 1h5qA in template set T0191 16 :EEIGRVKDKNIVIYGAG 1h5qA 4 :GFTISFVNKTIIVTGGN Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 19 residues other bump:2.58965 Ang I14.O and A17.CB neighbor-bump: 2.30466 Ang V13.O and I14.CG2 neighbor-bump: 2.77318 Ang V13.C and I14.CG2 T0191 33 :GAARAVAFELAK 1h5qA 22 :GIGLAFTRAVAA Fragment has 8 clashes (null) has 8 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:2.31033 Ang R5.CZ and F9.CZ other bump:1.46751 Ang R5.NH2 and F9.CZ other bump:2.68969 Ang R5.NH2 and F9.CE2 other bump:2.09532 Ang R5.CZ and F9.CE1 other bump:1.68397 Ang R5.NH2 and F9.CE1 other bump:2.1582 Ang R5.NH1 and F9.CE1 other bump:2.9453 Ang R5.CZ and F9.CD1 other bump:2.49192 Ang R5.NH1 and F9.CD1 T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKKFGEEVK 1h5qA 35 :GANVAVIYRSAADAVEVTEKVGKEFGVKTKAYQC Fragment has 28 clashes (null) has 28 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 36 residues other bump:2.74096 Ang A15.CB and E32.OE2 other bump:2.71537 Ang E16.CA and E32.OE1 other bump:2.49632 Ang E16.CB and E32.OE1 other bump:1.47881 Ang E16.CG and E32.OE1 other bump:1.82015 Ang E16.CD and E32.OE1 other bump:2.17843 Ang E16.OE2 and E32.OE1 other bump:2.71967 Ang E16.CG and E32.CD other bump:2.6068 Ang E16.CD and E32.CD other bump:2.55797 Ang E16.OE2 and E32.CD other bump:2.44118 Ang I7.CD1 and F30.CZ other bump:2.86998 Ang A19.CA and F30.CZ other bump:2.30491 Ang A19.CB and F30.CZ other bump:2.43723 Ang I7.CG1 and F30.CZ other bump:2.75498 Ang A19.C and F30.CE2 other bump:2.18076 Ang A19.CA and F30.CE2 other bump:1.40416 Ang A19.CB and F30.CE2 other bump:2.77179 Ang I7.CG2 and F30.CE1 other bump:2.83657 Ang A19.C and F30.CD2 other bump:2.99015 Ang A19.CA and F30.CD2 other bump:2.51462 Ang A19.CB and F30.CD2 other bump:2.87453 Ang A23.CB and F30.CB other bump:2.86863 Ang D2.C and K28.NZ other bump:2.1044 Ang N3.N and K28.NZ other bump:2.6962 Ang D2.CA and K28.CE other bump:2.80501 Ang D2.C and K28.CE other bump:2.55067 Ang N3.N and K28.CE neighbor-bump: 2.68647 Ang R10.C and T11.OG1 other bump:2.1118 Ang N3.ND2 and I5.CG2 T0191 79 :FSGLDVDLDGVDIIINATPIGMY 1h5qA 180 :VKGLAAEWASAGIRVNALSPGYV Fragment has 49 clashes (null) has 49 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 25 residues other bump:1.94881 Ang I21.CG1 and Y24.OH other bump:2.26376 Ang I21.CA and Y24.OH other bump:2.27578 Ang I21.CB and Y24.OH other bump:0.898008 Ang I21.CG1 and Y24.CZ other bump:2.82716 Ang I21.CA and Y24.CZ other bump:2.1282 Ang I21.CB and Y24.CZ other bump:1.89933 Ang I21.CD1 and Y24.CZ other bump:0.663004 Ang I21.CG1 and Y24.CE2 other bump:2.80329 Ang I21.C and Y24.CE2 other bump:2.6666 Ang G22.N and Y24.CE2 other bump:2.82568 Ang G22.O and Y24.CE2 other bump:2.631 Ang I21.CA and Y24.CE2 other bump:1.67287 Ang I21.CB and Y24.CE2 other bump:2.32306 Ang I21.CG2 and Y24.CE2 other bump:1.84214 Ang I21.CD1 and Y24.CE2 other bump:1.99275 Ang I21.CG1 and Y24.CE1 other bump:1.89275 Ang I21.CD1 and Y24.CE1 other bump:1.80133 Ang I21.CG1 and Y24.CD2 other bump:2.54844 Ang G22.O and Y24.CD2 other bump:2.8224 Ang I21.CB and Y24.CD2 other bump:2.86212 Ang I21.CG2 and Y24.CD2 other bump:1.76106 Ang I21.CD1 and Y24.CD2 other bump:2.6 Ang I21.CG1 and Y24.CD1 other bump:1.81319 Ang I21.CD1 and Y24.CD1 other bump:2.55182 Ang I21.CG1 and Y24.CG other bump:1.77171 Ang I21.CD1 and Y24.CG other bump:3.08081 Ang I21.CD1 and Y24.CB neighbor-bump: 2.8212 Ang T19.C and P20.CG other bump:2.49242 Ang F2.CE2 and A18.CB other bump:2.3019 Ang F2.CD2 and A18.CB other bump:2.65384 Ang F2.CE2 and A18.CA other bump:2.80064 Ang F2.CD2 and A18.CA other bump:3.01504 Ang D6.CG and I16.C other bump:2.55395 Ang D6.OD2 and I16.C other bump:2.75715 Ang D6.OD1 and I16.C other bump:2.34105 Ang D6.CG and I16.O other bump:1.49252 Ang D6.OD2 and I16.O other bump:1.68305 Ang D6.CG and I16.CG2 other bump:2.57811 Ang D6.OD2 and I16.CG2 other bump:2.63249 Ang D6.CB and I16.CG2 other bump:2.82552 Ang D6.CA and I16.CG2 other bump:0.877469 Ang D6.OD1 and I16.CG2 other bump:2.7401 Ang D6.N and I16.CG2 other bump:2.79721 Ang D6.CG and I16.CB other bump:1.66769 Ang D6.OD1 and I16.CB other bump:3.05509 Ang D6.CG and I16.CA other bump:2.23659 Ang D6.OD1 and I16.CA other bump:3.00824 Ang D6.CG and I16.N other bump:2.42312 Ang D6.O and D10.CG T0191 103 :NIDVEPIVKAEKLR 1h5qA 203 :NTDQTAHMDKKIRD Fragment has 8 clashes (null) has 8 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 16 residues self-bump: 1.33527 Ang P7.N and P7.CD neighbor-bump: 2.73485 Ang E6.CB and P7.CD neighbor-bump: 2.5366 Ang E6.N and P7.CD self-bump: 2.19771 Ang P7.N and P7.CG other bump:2.24537 Ang N2.OD1 and E6.OE2 other bump:1.87718 Ang N2.OD1 and E6.OE1 other bump:2.49336 Ang N2.CA and E6.OE1 other bump:2.30455 Ang N2.OD1 and E6.CD T0191 117 :EDMVVMDLIYNPLETVLLKEAKKVNAKTINGLGMLIYQGAVA 1h5qA 220 :SNIPLNRFAQPEEMTGQAILLLSDHATYMTGGEYFIDGGQLI Fragment has 28 clashes (null) has 28 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 44 residues other bump:2.6309 Ang Y38.CZ and V42.CB other bump:3.15427 Ang Y38.CD2 and V42.CB other bump:2.69166 Ang Y38.CE2 and V42.CB other bump:2.94895 Ang Y38.CZ and V42.N other bump:2.64612 Ang Y38.CD1 and V42.N other bump:2.25514 Ang Y38.CE1 and V42.N other bump:3.05326 Ang Y38.CE1 and A41.C other bump:2.99236 Ang Y38.CD1 and A41.CA other bump:2.15061 Ang Y38.CD1 and A41.N other bump:2.28683 Ang Y38.CE1 and A41.N other bump:2.73174 Ang Y38.CD1 and G40.C other bump:2.17563 Ang Y38.CE1 and G40.C other bump:3.04487 Ang Y38.CD1 and G40.CA other bump:2.51251 Ang Y38.CE1 and G40.CA other bump:2.85581 Ang Y38.CD1 and G40.N other bump:1.9425 Ang M4.SD and Q39.NE2 other bump:2.52148 Ang M4.CE and Q39.NE2 other bump:2.79889 Ang M4.SD and Q39.CD other bump:2.57852 Ang L18.CD1 and M35.CE other bump:3.0456 Ang L18.CD1 and M35.SD other bump:2.96017 Ang L18.CD2 and M35.CB other bump:2.54805 Ang L19.CD1 and K23.CE other bump:2.83557 Ang L19.CD1 and K23.CD other bump:1.60147 Ang I10.CD1 and E15.OE2 other bump:2.65638 Ang I10.CD1 and E15.CD other bump:3.04107 Ang I10.CG1 and L14.CB other bump:2.44536 Ang M4.SD and D8.O other bump:2.97711 Ang V6.CG1 and D8.OD1 Number of specific fragments= 6 total=257 Number of alignments=44 # Reading fragments from alignment file # T0191 read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1pjcA/T0191-1pjcA-2track-protein-STR-local-adpstyle5.pw.a2m.gz # 1pjcA read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1pjcA/T0191-1pjcA-2track-protein-STR-local-adpstyle5.pw.a2m.gz # adding 1pjcA to template set 1pjcA:# found chain 1pjcA in template set T0191 6 :DGIGARMALEEEIGR 1pjcA 141 :VQFGARFLERQQGGR Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 17 residues neighbor-bump: 2.62306 Ang E13.O and I14.CD1 neighbor-bump: 2.21345 Ang E13.O and I14.CG1 neighbor-bump: 2.63699 Ang E13.C and I14.CG1 neighbor-bump: 1.9745 Ang E13.O and I14.CB neighbor-bump: 2.43438 Ang E13.C and I14.CB T0191 21 :VKDKNIVIYGAGGAARAVAFELAK 1pjcA 165 :VKPGKVVILGGGVVGTEAAKMAVG Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 26 residues other bump:2.70113 Ang I7.CD1 and L23.CD2 other bump:2.51188 Ang I7.CG1 and L23.CD1 other bump:1.10707 Ang I7.CD1 and L23.CD1 other bump:1.96604 Ang I7.CD1 and L23.CG other bump:2.36271 Ang I7.CD1 and L23.CB other bump:1.86201 Ang G11.O and A16.CB other bump:2.86011 Ang G11.C and A16.CB T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLN 1pjcA 190 :GAQVQIFDINVERLSYLETLFGSRVE Fragment has 17 clashes (null) has 17 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:2.82109 Ang I22.CD1 and L26.CD2 other bump:2.87292 Ang I5.CD1 and L26.CD2 other bump:2.54449 Ang I5.CG1 and L26.CD1 other bump:2.47902 Ang I5.CD1 and L26.CD1 other bump:2.67771 Ang I5.CG1 and L26.CG other bump:2.50607 Ang I5.CD1 and L26.CG self-bump: 2.21466 Ang A23.CB and A23.C self-bump: 1.23794 Ang A23.CA and A23.CB other bump:1.89358 Ang V12.CG1 and E16.OE2 other bump:1.30061 Ang V12.O and E16.OE1 other bump:2.01321 Ang V12.C and E16.OE1 other bump:2.34526 Ang E13.CA and E16.OE1 other bump:2.11374 Ang V12.O and E16.CD other bump:2.88633 Ang V12.C and E16.CD other bump:2.89138 Ang V12.CG1 and E16.CD other bump:2.91217 Ang N3.CG and I5.CG2 other bump:1.91995 Ang N3.ND2 and I5.CG2 T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLREDMVVMDLIY 1pjcA 216 :LLYSNSAEIETAVAEADLLIGAVLVPGRRAPILVPASLVEQMRTGSVIVDVAV Fragment has 60 clashes (null) has 60 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 55 residues other bump:2.47383 Ang A23.C and I53.CD1 other bump:1.70319 Ang T24.N and I53.CD1 other bump:2.48239 Ang A23.N and I53.CD1 other bump:2.62884 Ang A23.CA and I53.CD1 other bump:2.78794 Ang T24.CA and I53.CD1 other bump:2.18911 Ang N22.ND2 and I53.CD1 other bump:2.82658 Ang T24.N and I53.CG1 other bump:3.16951 Ang N22.ND2 and I53.CG1 other bump:2.22384 Ang N22.CB and D51.OD2 other bump:2.12652 Ang N22.CG and D51.OD2 other bump:1.83036 Ang N22.OD1 and D51.OD1 other bump:2.52796 Ang N22.CB and D51.CG other bump:2.57643 Ang N22.CG and D51.CG other bump:2.19514 Ang N22.OD1 and D51.CG other bump:3.15042 Ang N22.CB and D51.CA other bump:3.02336 Ang I20.CG1 and V49.CG1 other bump:3.00794 Ang I20.CD1 and V49.CG1 other bump:0.885492 Ang V17.O and M47.CE other bump:2.06576 Ang V17.C and M47.CE other bump:2.08315 Ang V17.O and M47.SD other bump:2.68608 Ang V17.C and M47.SD other bump:2.74619 Ang D18.CA and M47.SD other bump:2.55118 Ang D18.O and M47.SD other bump:2.46645 Ang D18.C and M47.SD other bump:2.58219 Ang L14.O and L43.CD2 other bump:2.16854 Ang D15.OD1 and K42.O other bump:2.74141 Ang L14.CB and K39.NZ other bump:2.81738 Ang D33.OD1 and E35.C other bump:2.45887 Ang L14.CD1 and E35.OE2 neighbor-bump: 2.83758 Ang Y29.CD2 and P30.C neighbor-bump: 1.7655 Ang Y29.CD2 and P30.O neighbor-bump: 2.40903 Ang Y29.CE2 and P30.O other bump:2.79301 Ang I26.CA and Y29.OH other bump:1.40781 Ang I26.CB and Y29.OH other bump:1.87505 Ang I26.CG1 and Y29.OH other bump:2.11198 Ang I26.CG2 and Y29.OH other bump:1.85864 Ang I26.CD1 and Y29.OH other bump:2.96035 Ang I26.CA and Y29.CZ other bump:1.49795 Ang I26.CB and Y29.CZ other bump:1.76954 Ang I26.CG1 and Y29.CZ other bump:1.25798 Ang I26.CG2 and Y29.CZ other bump:1.81553 Ang I26.CD1 and Y29.CZ other bump:2.46327 Ang I26.CB and Y29.CE2 other bump:3.11928 Ang I26.CG1 and Y29.CE2 other bump:1.2137 Ang I26.CG2 and Y29.CE2 other bump:2.08915 Ang I26.CB and Y29.CE1 other bump:1.35619 Ang I26.CG1 and Y29.CE1 other bump:2.12197 Ang I26.CG2 and Y29.CE1 other bump:1.70083 Ang I26.CD1 and Y29.CE1 other bump:2.06228 Ang I26.CG2 and Y29.CD2 other bump:2.68452 Ang I26.CG1 and Y29.CD1 other bump:2.70559 Ang I26.CG2 and Y29.CD1 other bump:2.71812 Ang I26.CG2 and Y29.CG neighbor-bump: 1.80648 Ang T24.C and P25.CD neighbor-bump: 2.44044 Ang T24.CA and P25.CD neighbor-bump: 2.66854 Ang T24.C and P25.CG other bump:2.68906 Ang V17.CG1 and I20.CG2 other bump:2.87441 Ang V17.CG1 and I19.C other bump:2.61781 Ang V17.CG1 and I19.O other bump:2.83154 Ang F7.CD1 and D11.OD2 Number of specific fragments= 4 total=261 Number of alignments=45 # Reading fragments from alignment file # T0191 read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1pjcA/T0191-1pjcA-2track-protein-STR-local-adpstyle1.pw.a2m.gz # 1pjcA read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1pjcA/T0191-1pjcA-2track-protein-STR-local-adpstyle1.pw.a2m.gz # found chain 1pjcA in template set T0191 2 :GYNTDGIGARMALEEEIGR 1pjcA 137 :GRLSVQFGARFLERQQGGR Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 21 residues neighbor-bump: 2.62306 Ang E17.O and I18.CD1 neighbor-bump: 2.21345 Ang E17.O and I18.CG1 neighbor-bump: 2.63699 Ang E17.C and I18.CG1 neighbor-bump: 1.9745 Ang E17.O and I18.CB neighbor-bump: 2.43438 Ang E17.C and I18.CB T0191 21 :VKDKNIVIYGAGGAARAVAFELAK 1pjcA 165 :VKPGKVVILGGGVVGTEAAKMAVG Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 26 residues other bump:2.70113 Ang I7.CD1 and L23.CD2 other bump:2.51188 Ang I7.CG1 and L23.CD1 other bump:1.10707 Ang I7.CD1 and L23.CD1 other bump:1.96604 Ang I7.CD1 and L23.CG other bump:2.36271 Ang I7.CD1 and L23.CB other bump:1.86201 Ang G11.O and A16.CB other bump:2.86011 Ang G11.C and A16.CB T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLN 1pjcA 190 :GAQVQIFDINVERLSYLETLFGSRVE Fragment has 17 clashes (null) has 17 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:2.82109 Ang I22.CD1 and L26.CD2 other bump:2.87292 Ang I5.CD1 and L26.CD2 other bump:2.54449 Ang I5.CG1 and L26.CD1 other bump:2.47902 Ang I5.CD1 and L26.CD1 other bump:2.67771 Ang I5.CG1 and L26.CG other bump:2.50607 Ang I5.CD1 and L26.CG self-bump: 2.21466 Ang A23.CB and A23.C self-bump: 1.23794 Ang A23.CA and A23.CB other bump:1.89358 Ang V12.CG1 and E16.OE2 other bump:1.30061 Ang V12.O and E16.OE1 other bump:2.01321 Ang V12.C and E16.OE1 other bump:2.34526 Ang E13.CA and E16.OE1 other bump:2.11374 Ang V12.O and E16.CD other bump:2.88633 Ang V12.C and E16.CD other bump:2.89138 Ang V12.CG1 and E16.CD other bump:2.91217 Ang N3.CG and I5.CG2 other bump:1.91995 Ang N3.ND2 and I5.CG2 T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLREDMVVMDLIY 1pjcA 216 :LLYSNSAEIETAVAEADLLIGAVLVPGRRAPILVPASLVEQMRTGSVIVDVAV Fragment has 60 clashes (null) has 60 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 55 residues other bump:2.47383 Ang A23.C and I53.CD1 other bump:1.70319 Ang T24.N and I53.CD1 other bump:2.48239 Ang A23.N and I53.CD1 other bump:2.62884 Ang A23.CA and I53.CD1 other bump:2.78794 Ang T24.CA and I53.CD1 other bump:2.18911 Ang N22.ND2 and I53.CD1 other bump:2.82658 Ang T24.N and I53.CG1 other bump:3.16951 Ang N22.ND2 and I53.CG1 other bump:2.22384 Ang N22.CB and D51.OD2 other bump:2.12652 Ang N22.CG and D51.OD2 other bump:1.83036 Ang N22.OD1 and D51.OD1 other bump:2.52796 Ang N22.CB and D51.CG other bump:2.57643 Ang N22.CG and D51.CG other bump:2.19514 Ang N22.OD1 and D51.CG other bump:3.15042 Ang N22.CB and D51.CA other bump:3.02336 Ang I20.CG1 and V49.CG1 other bump:3.00794 Ang I20.CD1 and V49.CG1 other bump:0.885492 Ang V17.O and M47.CE other bump:2.06576 Ang V17.C and M47.CE other bump:2.08315 Ang V17.O and M47.SD other bump:2.68608 Ang V17.C and M47.SD other bump:2.74619 Ang D18.CA and M47.SD other bump:2.55118 Ang D18.O and M47.SD other bump:2.46645 Ang D18.C and M47.SD other bump:2.58219 Ang L14.O and L43.CD2 other bump:2.16854 Ang D15.OD1 and K42.O other bump:2.74141 Ang L14.CB and K39.NZ other bump:2.81738 Ang D33.OD1 and E35.C other bump:2.45887 Ang L14.CD1 and E35.OE2 neighbor-bump: 2.83758 Ang Y29.CD2 and P30.C neighbor-bump: 1.7655 Ang Y29.CD2 and P30.O neighbor-bump: 2.40903 Ang Y29.CE2 and P30.O other bump:2.79301 Ang I26.CA and Y29.OH other bump:1.40781 Ang I26.CB and Y29.OH other bump:1.87505 Ang I26.CG1 and Y29.OH other bump:2.11198 Ang I26.CG2 and Y29.OH other bump:1.85864 Ang I26.CD1 and Y29.OH other bump:2.96035 Ang I26.CA and Y29.CZ other bump:1.49795 Ang I26.CB and Y29.CZ other bump:1.76954 Ang I26.CG1 and Y29.CZ other bump:1.25798 Ang I26.CG2 and Y29.CZ other bump:1.81553 Ang I26.CD1 and Y29.CZ other bump:2.46327 Ang I26.CB and Y29.CE2 other bump:3.11928 Ang I26.CG1 and Y29.CE2 other bump:1.2137 Ang I26.CG2 and Y29.CE2 other bump:2.08915 Ang I26.CB and Y29.CE1 other bump:1.35619 Ang I26.CG1 and Y29.CE1 other bump:2.12197 Ang I26.CG2 and Y29.CE1 other bump:1.70083 Ang I26.CD1 and Y29.CE1 other bump:2.06228 Ang I26.CG2 and Y29.CD2 other bump:2.68452 Ang I26.CG1 and Y29.CD1 other bump:2.70559 Ang I26.CG2 and Y29.CD1 other bump:2.71812 Ang I26.CG2 and Y29.CG neighbor-bump: 1.80648 Ang T24.C and P25.CD neighbor-bump: 2.44044 Ang T24.CA and P25.CD neighbor-bump: 2.66854 Ang T24.C and P25.CG other bump:2.68906 Ang V17.CG1 and I20.CG2 other bump:2.87441 Ang V17.CG1 and I19.C other bump:2.61781 Ang V17.CG1 and I19.O other bump:2.83154 Ang F7.CD1 and D11.OD2 Number of specific fragments= 4 total=265 Number of alignments=46 # Reading fragments from alignment file # T0191 read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1bdb/T0191-1bdb-2track-protein-STR-global-adpstyle1.pw.a2m.gz # 1bdb read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1bdb/T0191-1bdb-2track-protein-STR-global-adpstyle1.pw.a2m.gz # adding 1bdb to template set 1bdb:# found chain 1bdb in template set T0191 20 :RVKDKNIVIYGA 1bdb 2 :KLKGEAVLITGG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues T0191 32 :GGAARAVAFELAK 1bdb 15 :SGLGRALVDRFVA Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues other bump:1.49969 Ang R6.NH2 and F10.CZ other bump:1.97947 Ang R6.NE and F10.CZ other bump:1.65632 Ang R6.CZ and F10.CZ other bump:2.714 Ang R6.NH1 and F10.CZ other bump:2.82765 Ang R6.NH2 and F10.CE2 other bump:2.94798 Ang R6.CZ and F10.CE2 other bump:1.55603 Ang R6.NH2 and F10.CE1 other bump:1.84984 Ang R6.NE and F10.CE1 other bump:1.90974 Ang R6.CZ and F10.CE1 other bump:2.77429 Ang R6.NE and F10.CD1 T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGLDVD 1bdb 29 :GAKVAVLDKSAERLAELETDHGDNVLGIVGDVRSLEDQKQA Fragment has 62 clashes (null) has 62 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 43 residues other bump:2.65269 Ang K29.NZ and D42.C other bump:2.93106 Ang I6.CG2 and D42.OD1 other bump:3.01016 Ang K29.CD and D42.CB other bump:2.70119 Ang K29.CD and D42.CA other bump:2.56885 Ang K29.CE and D42.CA other bump:1.81993 Ang K29.NZ and D42.CA other bump:2.67802 Ang K29.CD and D42.N other bump:2.49683 Ang K29.CE and D42.N other bump:1.38851 Ang K29.NZ and D42.N other bump:2.54355 Ang K29.CE and V41.C other bump:1.20455 Ang K29.NZ and V41.C other bump:1.31441 Ang K29.NZ and V41.O other bump:2.93364 Ang K29.CE and V41.CG1 other bump:3.0607 Ang K29.NZ and V41.CG1 other bump:2.62584 Ang K29.NZ and V41.CA other bump:2.56435 Ang F36.CE2 and D40.OD2 other bump:2.18727 Ang V12.CA and F30.CZ other bump:2.85792 Ang A15.CB and F30.CZ other bump:2.28709 Ang V12.O and F30.CZ other bump:2.53528 Ang V12.C and F30.CZ other bump:1.66025 Ang V12.CA and F30.CE2 other bump:2.87572 Ang V12.CB and F30.CE2 other bump:2.27955 Ang T11.O and F30.CE2 other bump:2.39913 Ang T11.C and F30.CE2 other bump:2.12934 Ang V12.N and F30.CE2 other bump:2.60707 Ang V12.C and F30.CE2 other bump:2.60741 Ang K28.CD and F30.CE1 other bump:2.88057 Ang V12.CG2 and F30.CD2 other bump:2.5567 Ang V12.CA and F30.CD2 other bump:2.99388 Ang T11.C and F30.CD2 other bump:2.63664 Ang V12.N and F30.CD2 other bump:0.956225 Ang A15.C and K28.NZ other bump:1.1812 Ang E16.N and K28.NZ other bump:2.52238 Ang E16.CA and K28.NZ other bump:2.09667 Ang A15.O and K28.NZ other bump:2.03935 Ang A15.CB and K28.NZ other bump:2.21309 Ang A15.N and K28.NZ other bump:1.4992 Ang A15.CA and K28.NZ other bump:1.71042 Ang A15.C and K28.CE other bump:2.64388 Ang E16.N and K28.CE other bump:2.2285 Ang A15.O and K28.CE other bump:1.09417 Ang A15.CB and K28.CE other bump:2.75328 Ang A15.N and K28.CE other bump:1.41703 Ang A15.CA and K28.CE other bump:2.95299 Ang A15.C and K28.CD other bump:1.61509 Ang A15.CB and K28.CD other bump:2.76847 Ang A15.CA and K28.CD other bump:2.43767 Ang A15.CB and K28.CG other bump:2.97481 Ang I22.CB and L26.CD2 other bump:2.2538 Ang I22.CG1 and L26.CD2 other bump:2.81412 Ang I22.CG2 and L26.CD2 other bump:1.23525 Ang I22.CD1 and L26.CD2 other bump:2.06263 Ang I22.CD1 and L26.CD1 other bump:2.81773 Ang I22.CG1 and L26.CG other bump:1.30495 Ang I22.CD1 and L26.CG other bump:2.66684 Ang I22.CG1 and L26.CB other bump:1.68749 Ang I22.CD1 and L26.CB other bump:2.96748 Ang I22.CD1 and L26.CA self-bump: 2.20791 Ang A23.CB and A23.C self-bump: 1.25245 Ang A23.CA and A23.CB other bump:2.63045 Ang I7.CD1 and L18.CD2 other bump:2.63413 Ang T11.OG1 and K14.CE T0191 86 :LDGVDIIINATPIGMYPNIDVE 1bdb 77 :FGKIDTLIPNAGIWDYSTALVD Fragment has 14 clashes (null) has 14 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 24 residues other bump:2.50392 Ang N19.ND2 and E23.CB other bump:3.17081 Ang I20.CG2 and V22.CG1 neighbor-bump: 1.77746 Ang Y17.C and P18.CD neighbor-bump: 2.23231 Ang Y17.O and P18.CD self-bump: 2.20163 Ang P18.CA and P18.CD other bump:2.7074 Ang A11.C and P13.CD other bump:2.04741 Ang A11.O and P13.CD neighbor-bump: 2.09389 Ang T12.CA and P13.CD neighbor-bump: 2.35161 Ang T12.O and P13.CD neighbor-bump: 1.46891 Ang T12.C and P13.CD other bump:3.20288 Ang A11.C and P13.CG other bump:2.33515 Ang A11.O and P13.CG neighbor-bump: 2.53512 Ang T12.O and P13.CG neighbor-bump: 2.34704 Ang T12.C and P13.CG T0191 108 :PIVKAEKLREDMVVMDLI 1bdb 125 :ACLPALVASRGNVIFTIS Fragment has 23 clashes (null) has 23 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 20 residues neighbor-bump: 2.75064 Ang I19.CG2 and G20.N neighbor-bump: 2.00175 Ang L18.O and I19.CG1 neighbor-bump: 2.73931 Ang L18.C and I19.CG1 neighbor-bump: 2.14287 Ang L18.CB and I19.N other bump:2.03237 Ang E7.CB and D12.OD2 other bump:2.2231 Ang E7.CG and D12.OD2 other bump:2.7165 Ang E7.CA and D12.OD1 other bump:1.96485 Ang E7.O and D12.OD1 other bump:2.37077 Ang E7.C and D12.OD1 other bump:2.61177 Ang E7.CB and D12.OD1 other bump:2.72203 Ang E7.CA and D12.CG other bump:3.02856 Ang E7.C and D12.CG other bump:2.36064 Ang E7.CB and D12.CG other bump:2.98786 Ang E7.CG and D12.CG other bump:0.820996 Ang I3.CG2 and E7.OE2 other bump:2.20214 Ang I3.CB and E7.OE2 other bump:2.69549 Ang I3.CG2 and E7.OE1 other bump:1.11394 Ang I3.O and E7.OE1 other bump:1.81293 Ang I3.C and E7.OE1 other bump:1.98379 Ang I3.CG2 and E7.CD other bump:2.13498 Ang I3.O and E7.CD other bump:3.02849 Ang I3.CB and E7.CD other bump:2.75326 Ang I3.C and E7.CD T0191 126 :YNPLETVLLKEAKKV 1bdb 147 :YPNGGGPLYTAAKHA Fragment has 40 clashes (null) has 40 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 17 residues other bump:2.68902 Ang E6.OE2 and K11.C other bump:2.37401 Ang P4.N and K11.NZ other bump:2.31678 Ang E6.O and K11.CE other bump:2.57767 Ang P4.N and K11.CE other bump:2.69815 Ang E6.CG and K11.CG other bump:3.13976 Ang E6.CG and K11.CA other bump:2.59136 Ang E6.CD and K11.CA other bump:1.64133 Ang E6.OE2 and K11.CA other bump:2.58879 Ang E6.CG and K11.N other bump:1.83249 Ang E6.CD and K11.N other bump:1.37594 Ang E6.OE2 and K11.N other bump:3.05818 Ang E6.CG and L10.C other bump:1.74648 Ang E6.CD and L10.C other bump:2.06259 Ang E6.OE1 and L10.C other bump:1.42574 Ang E6.OE2 and L10.C other bump:2.36836 Ang E6.CD and L10.O other bump:1.68342 Ang E6.OE2 and L10.O other bump:2.95955 Ang E6.CG and L10.CD2 other bump:2.44859 Ang E6.CD and L10.CD2 other bump:1.63949 Ang E6.OE1 and L10.CD2 other bump:2.76565 Ang E6.CB and L10.CD2 other bump:2.57946 Ang E6.OE1 and L10.CD1 other bump:2.60962 Ang E6.CD and L10.CG other bump:1.31937 Ang E6.OE1 and L10.CG other bump:2.36797 Ang E6.CD and L10.CB other bump:1.39052 Ang E6.OE1 and L10.CB other bump:2.97623 Ang E6.CB and L10.CB other bump:2.45663 Ang E6.CD and L10.CA other bump:2.01024 Ang E6.OE1 and L10.CA other bump:2.77462 Ang E6.OE2 and L10.CA neighbor-bump: 1.69601 Ang N3.CA and P4.CD neighbor-bump: 2.23457 Ang N3.O and P4.CD neighbor-bump: 1.19544 Ang N3.C and P4.CD self-bump: 1.29213 Ang P4.N and P4.CD neighbor-bump: 1.69322 Ang N3.CB and P4.CD neighbor-bump: 3.05675 Ang N3.CA and P4.CG neighbor-bump: 2.2279 Ang N3.C and P4.CG self-bump: 2.1396 Ang P4.N and P4.CG neighbor-bump: 2.44439 Ang N3.CB and P4.CG neighbor-bump: 2.46246 Ang N3.C and P4.CB T0191 148 :LGMLIYQGAVAFK 1bdb 162 :IVGLVRELAFELA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues Number of specific fragments= 7 total=272 Number of alignments=47 # Reading fragments from alignment file # T0191 read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1bdb/T0191-1bdb-2track-protein-STR-global-adpstyle5.pw.a2m.gz # 1bdb read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1bdb/T0191-1bdb-2track-protein-STR-global-adpstyle5.pw.a2m.gz # found chain 1bdb in template set T0191 20 :RVKDKNIVIYGA 1bdb 2 :KLKGEAVLITGG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues T0191 32 :GGAARAVAFELAK 1bdb 15 :SGLGRALVDRFVA Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues other bump:1.49969 Ang R6.NH2 and F10.CZ other bump:1.97947 Ang R6.NE and F10.CZ other bump:1.65632 Ang R6.CZ and F10.CZ other bump:2.714 Ang R6.NH1 and F10.CZ other bump:2.82765 Ang R6.NH2 and F10.CE2 other bump:2.94798 Ang R6.CZ and F10.CE2 other bump:1.55603 Ang R6.NH2 and F10.CE1 other bump:1.84984 Ang R6.NE and F10.CE1 other bump:1.90974 Ang R6.CZ and F10.CE1 other bump:2.77429 Ang R6.NE and F10.CD1 T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGLDVD 1bdb 29 :GAKVAVLDKSAERLAELETDHGDNVLGIVGDVRSLEDQKQA Fragment has 62 clashes (null) has 62 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 43 residues other bump:2.65269 Ang K29.NZ and D42.C other bump:2.93106 Ang I6.CG2 and D42.OD1 other bump:3.01016 Ang K29.CD and D42.CB other bump:2.70119 Ang K29.CD and D42.CA other bump:2.56885 Ang K29.CE and D42.CA other bump:1.81993 Ang K29.NZ and D42.CA other bump:2.67802 Ang K29.CD and D42.N other bump:2.49683 Ang K29.CE and D42.N other bump:1.38851 Ang K29.NZ and D42.N other bump:2.54355 Ang K29.CE and V41.C other bump:1.20455 Ang K29.NZ and V41.C other bump:1.31441 Ang K29.NZ and V41.O other bump:2.93364 Ang K29.CE and V41.CG1 other bump:3.0607 Ang K29.NZ and V41.CG1 other bump:2.62584 Ang K29.NZ and V41.CA other bump:2.56435 Ang F36.CE2 and D40.OD2 other bump:2.18727 Ang V12.CA and F30.CZ other bump:2.85792 Ang A15.CB and F30.CZ other bump:2.28709 Ang V12.O and F30.CZ other bump:2.53528 Ang V12.C and F30.CZ other bump:1.66025 Ang V12.CA and F30.CE2 other bump:2.87572 Ang V12.CB and F30.CE2 other bump:2.27955 Ang T11.O and F30.CE2 other bump:2.39913 Ang T11.C and F30.CE2 other bump:2.12934 Ang V12.N and F30.CE2 other bump:2.60707 Ang V12.C and F30.CE2 other bump:2.60741 Ang K28.CD and F30.CE1 other bump:2.88057 Ang V12.CG2 and F30.CD2 other bump:2.5567 Ang V12.CA and F30.CD2 other bump:2.99388 Ang T11.C and F30.CD2 other bump:2.63664 Ang V12.N and F30.CD2 other bump:0.956225 Ang A15.C and K28.NZ other bump:1.1812 Ang E16.N and K28.NZ other bump:2.52238 Ang E16.CA and K28.NZ other bump:2.09667 Ang A15.O and K28.NZ other bump:2.03935 Ang A15.CB and K28.NZ other bump:2.21309 Ang A15.N and K28.NZ other bump:1.4992 Ang A15.CA and K28.NZ other bump:1.71042 Ang A15.C and K28.CE other bump:2.64388 Ang E16.N and K28.CE other bump:2.2285 Ang A15.O and K28.CE other bump:1.09417 Ang A15.CB and K28.CE other bump:2.75328 Ang A15.N and K28.CE other bump:1.41703 Ang A15.CA and K28.CE other bump:2.95299 Ang A15.C and K28.CD other bump:1.61509 Ang A15.CB and K28.CD other bump:2.76847 Ang A15.CA and K28.CD other bump:2.43767 Ang A15.CB and K28.CG other bump:2.97481 Ang I22.CB and L26.CD2 other bump:2.2538 Ang I22.CG1 and L26.CD2 other bump:2.81412 Ang I22.CG2 and L26.CD2 other bump:1.23525 Ang I22.CD1 and L26.CD2 other bump:2.06263 Ang I22.CD1 and L26.CD1 other bump:2.81773 Ang I22.CG1 and L26.CG other bump:1.30495 Ang I22.CD1 and L26.CG other bump:2.66684 Ang I22.CG1 and L26.CB other bump:1.68749 Ang I22.CD1 and L26.CB other bump:2.96748 Ang I22.CD1 and L26.CA self-bump: 2.20791 Ang A23.CB and A23.C self-bump: 1.25245 Ang A23.CA and A23.CB other bump:2.63045 Ang I7.CD1 and L18.CD2 other bump:2.63413 Ang T11.OG1 and K14.CE T0191 86 :LDGVDIIINATPIGMYPNIDVE 1bdb 77 :FGKIDTLIPNAGIWDYSTALVD Fragment has 14 clashes (null) has 14 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 24 residues other bump:2.50392 Ang N19.ND2 and E23.CB other bump:3.17081 Ang I20.CG2 and V22.CG1 neighbor-bump: 1.77746 Ang Y17.C and P18.CD neighbor-bump: 2.23231 Ang Y17.O and P18.CD self-bump: 2.20163 Ang P18.CA and P18.CD other bump:2.7074 Ang A11.C and P13.CD other bump:2.04741 Ang A11.O and P13.CD neighbor-bump: 2.09389 Ang T12.CA and P13.CD neighbor-bump: 2.35161 Ang T12.O and P13.CD neighbor-bump: 1.46891 Ang T12.C and P13.CD other bump:3.20288 Ang A11.C and P13.CG other bump:2.33515 Ang A11.O and P13.CG neighbor-bump: 2.53512 Ang T12.O and P13.CG neighbor-bump: 2.34704 Ang T12.C and P13.CG T0191 108 :PIVKAEKLREDMVVMDLI 1bdb 125 :ACLPALVASRGNVIFTIS Fragment has 23 clashes (null) has 23 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 20 residues neighbor-bump: 2.75064 Ang I19.CG2 and G20.N neighbor-bump: 2.00175 Ang L18.O and I19.CG1 neighbor-bump: 2.73931 Ang L18.C and I19.CG1 neighbor-bump: 2.14287 Ang L18.CB and I19.N other bump:2.03237 Ang E7.CB and D12.OD2 other bump:2.2231 Ang E7.CG and D12.OD2 other bump:2.7165 Ang E7.CA and D12.OD1 other bump:1.96485 Ang E7.O and D12.OD1 other bump:2.37077 Ang E7.C and D12.OD1 other bump:2.61177 Ang E7.CB and D12.OD1 other bump:2.72203 Ang E7.CA and D12.CG other bump:3.02856 Ang E7.C and D12.CG other bump:2.36064 Ang E7.CB and D12.CG other bump:2.98786 Ang E7.CG and D12.CG other bump:0.820996 Ang I3.CG2 and E7.OE2 other bump:2.20214 Ang I3.CB and E7.OE2 other bump:2.69549 Ang I3.CG2 and E7.OE1 other bump:1.11394 Ang I3.O and E7.OE1 other bump:1.81293 Ang I3.C and E7.OE1 other bump:1.98379 Ang I3.CG2 and E7.CD other bump:2.13498 Ang I3.O and E7.CD other bump:3.02849 Ang I3.CB and E7.CD other bump:2.75326 Ang I3.C and E7.CD T0191 126 :YNPLETVLLKEAKKV 1bdb 147 :YPNGGGPLYTAAKHA Fragment has 40 clashes (null) has 40 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 17 residues other bump:2.68902 Ang E6.OE2 and K11.C other bump:2.37401 Ang P4.N and K11.NZ other bump:2.31678 Ang E6.O and K11.CE other bump:2.57767 Ang P4.N and K11.CE other bump:2.69815 Ang E6.CG and K11.CG other bump:3.13976 Ang E6.CG and K11.CA other bump:2.59136 Ang E6.CD and K11.CA other bump:1.64133 Ang E6.OE2 and K11.CA other bump:2.58879 Ang E6.CG and K11.N other bump:1.83249 Ang E6.CD and K11.N other bump:1.37594 Ang E6.OE2 and K11.N other bump:3.05818 Ang E6.CG and L10.C other bump:1.74648 Ang E6.CD and L10.C other bump:2.06259 Ang E6.OE1 and L10.C other bump:1.42574 Ang E6.OE2 and L10.C other bump:2.36836 Ang E6.CD and L10.O other bump:1.68342 Ang E6.OE2 and L10.O other bump:2.95955 Ang E6.CG and L10.CD2 other bump:2.44859 Ang E6.CD and L10.CD2 other bump:1.63949 Ang E6.OE1 and L10.CD2 other bump:2.76565 Ang E6.CB and L10.CD2 other bump:2.57946 Ang E6.OE1 and L10.CD1 other bump:2.60962 Ang E6.CD and L10.CG other bump:1.31937 Ang E6.OE1 and L10.CG other bump:2.36797 Ang E6.CD and L10.CB other bump:1.39052 Ang E6.OE1 and L10.CB other bump:2.97623 Ang E6.CB and L10.CB other bump:2.45663 Ang E6.CD and L10.CA other bump:2.01024 Ang E6.OE1 and L10.CA other bump:2.77462 Ang E6.OE2 and L10.CA neighbor-bump: 1.69601 Ang N3.CA and P4.CD neighbor-bump: 2.23457 Ang N3.O and P4.CD neighbor-bump: 1.19544 Ang N3.C and P4.CD self-bump: 1.29213 Ang P4.N and P4.CD neighbor-bump: 1.69322 Ang N3.CB and P4.CD neighbor-bump: 3.05675 Ang N3.CA and P4.CG neighbor-bump: 2.2279 Ang N3.C and P4.CG self-bump: 2.1396 Ang P4.N and P4.CG neighbor-bump: 2.44439 Ang N3.CB and P4.CG neighbor-bump: 2.46246 Ang N3.C and P4.CB T0191 148 :LGMLIYQGAVAF 1bdb 162 :IVGLVRELAFEL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues Number of specific fragments= 7 total=279 Number of alignments=48 # Reading fragments from alignment file # T0191 read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1hu4A/T0191-1hu4A-2track-protein-STR-local-adpstyle1.pw.a2m.gz # 1hu4A read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1hu4A/T0191-1hu4A-2track-protein-STR-local-adpstyle1.pw.a2m.gz # found chain 1hu4A in template set T0191 21 :VKDKNIVIYGAG 1hu4A 2 :SNTRVALVTGAN Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues neighbor-bump: 2.87181 Ang G1.C and V2.CG2 neighbor-bump: 2.44137 Ang G1.O and V2.CG2 T0191 33 :GAARAVAFELAK 1hu4A 15 :GIGFAIVRDLCR Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:2.35528 Ang F9.CE2 and K13.NZ other bump:2.48416 Ang F9.CZ and K13.NZ other bump:2.29426 Ang F9.CE2 and K13.CE other bump:2.18466 Ang F9.CZ and K13.CE other bump:3.11099 Ang F9.CE2 and K13.CD T0191 45 :DN 1hu4A 28 :FA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues T0191 47 :NIIIANRTVEKAEALAKEIAEKLNKKFGEEVK 1hu4A 31 :DVVLTARDVARGQAAVKQLQAEGLSPRFHQLD Fragment has 30 clashes (null) has 30 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 34 residues neighbor-bump: 2.154 Ang E31.O and V32.CG2 neighbor-bump: 2.74154 Ang E31.C and V32.CG2 other bump:1.85153 Ang F28.CE1 and E30.OE1 other bump:2.98508 Ang F28.CD1 and E30.OE1 other bump:2.03752 Ang F28.CZ and E30.OE1 other bump:2.31172 Ang F28.CE1 and E30.CD other bump:2.88502 Ang F28.CZ and E30.CD other bump:2.26847 Ang F28.CE1 and E30.CG neighbor-bump: 2.54246 Ang G29.O and E30.CG other bump:2.85479 Ang I3.CD1 and K27.CE other bump:2.82376 Ang I5.CG2 and K27.CD other bump:3.11969 Ang I3.CG1 and K27.CG other bump:2.2927 Ang E19.CB and E22.OE2 other bump:2.15613 Ang E19.CG and E22.OE2 other bump:1.37051 Ang E19.O and E22.OE2 other bump:1.58114 Ang E19.C and E22.OE2 other bump:1.72968 Ang E19.CA and E22.OE2 other bump:1.99289 Ang E19.O and E22.OE1 other bump:1.79408 Ang E19.C and E22.OE1 other bump:1.62173 Ang K18.O and E22.OE1 other bump:2.31065 Ang K18.C and E22.OE1 other bump:1.98957 Ang E19.CA and E22.OE1 other bump:1.24318 Ang E19.O and E22.CD other bump:1.6891 Ang E19.C and E22.CD other bump:2.05254 Ang E19.CA and E22.CD other bump:2.93174 Ang I20.N and E22.CD other bump:2.08363 Ang E19.O and E22.CG other bump:3.05102 Ang E19.C and E22.CG other bump:3.26185 Ang V10.CG1 and E14.CD other bump:3.14222 Ang N7.CB and A13.CB T0191 79 :FSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEK 1hu4A 73 :CDFLRKEYGGLDVLVNNAAIAFQLDNPTPFHIQAEL Fragment has 22 clashes (null) has 22 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 38 residues other bump:2.46235 Ang V29.CG1 and K34.CE other bump:2.41837 Ang V29.O and K34.CE other bump:3.20339 Ang V29.CG1 and K34.CD other bump:2.20349 Ang M23.SD and K34.CG other bump:2.48033 Ang M23.CE and K34.CG other bump:2.86322 Ang V29.CG1 and K34.CG other bump:2.58831 Ang M23.SD and K34.CB other bump:2.83805 Ang M23.SD and K34.CA self-bump: 1.39816 Ang P31.CA and P31.CB other bump:3.21928 Ang M23.SD and V29.CG1 other bump:1.60456 Ang M23.CE and V29.CG1 other bump:2.7358 Ang M23.CE and V29.CB other bump:2.18883 Ang A18.O and P20.CD neighbor-bump: 2.00267 Ang T19.CA and P20.CD neighbor-bump: 2.08181 Ang T19.O and P20.CD neighbor-bump: 1.27164 Ang T19.C and P20.CD other bump:2.77933 Ang A18.C and P20.CD other bump:2.28601 Ang A18.O and P20.CG neighbor-bump: 2.11586 Ang T19.O and P20.CG neighbor-bump: 2.15184 Ang T19.C and P20.CG other bump:3.24322 Ang A18.C and P20.CG other bump:3.0354 Ang L5.CD1 and V12.CG2 Number of specific fragments= 5 total=284 Number of alignments=49 # Reading fragments from alignment file # T0191 read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1hu4A/T0191-1hu4A-2track-protein-STR-local-adpstyle5.pw.a2m.gz # 1hu4A read from /projects/compbio/experiments/casp5/t0191/t0191-101-260/1hu4A/T0191-1hu4A-2track-protein-STR-local-adpstyle5.pw.a2m.gz # found chain 1hu4A in template set T0191 21 :VKDKNIVIYGAG 1hu4A 2 :SNTRVALVTGAN Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues neighbor-bump: 2.87181 Ang G1.C and V2.CG2 neighbor-bump: 2.44137 Ang G1.O and V2.CG2 T0191 33 :GAARAVAFELAK 1hu4A 15 :GIGFAIVRDLCR Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:2.35528 Ang F9.CE2 and K13.NZ other bump:2.48416 Ang F9.CZ and K13.NZ other bump:2.29426 Ang F9.CE2 and K13.CE other bump:2.18466 Ang F9.CZ and K13.CE other bump:3.11099 Ang F9.CE2 and K13.CD T0191 45 :DN 1hu4A 28 :FA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues T0191 47 :NIIIANRTVEKAEALAKEIAEKLNKKFGEEVK 1hu4A 31 :DVVLTARDVARGQAAVKQLQAEGLSPRFHQLD Fragment has 30 clashes (null) has 30 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 34 residues neighbor-bump: 2.154 Ang E31.O and V32.CG2 neighbor-bump: 2.74154 Ang E31.C and V32.CG2 other bump:1.85153 Ang F28.CE1 and E30.OE1 other bump:2.98508 Ang F28.CD1 and E30.OE1 other bump:2.03752 Ang F28.CZ and E30.OE1 other bump:2.31172 Ang F28.CE1 and E30.CD other bump:2.88502 Ang F28.CZ and E30.CD other bump:2.26847 Ang F28.CE1 and E30.CG neighbor-bump: 2.54246 Ang G29.O and E30.CG other bump:2.85479 Ang I3.CD1 and K27.CE other bump:2.82376 Ang I5.CG2 and K27.CD other bump:3.11969 Ang I3.CG1 and K27.CG other bump:2.2927 Ang E19.CB and E22.OE2 other bump:2.15613 Ang E19.CG and E22.OE2 other bump:1.37051 Ang E19.O and E22.OE2 other bump:1.58114 Ang E19.C and E22.OE2 other bump:1.72968 Ang E19.CA and E22.OE2 other bump:1.99289 Ang E19.O and E22.OE1 other bump:1.79408 Ang E19.C and E22.OE1 other bump:1.62173 Ang K18.O and E22.OE1 other bump:2.31065 Ang K18.C and E22.OE1 other bump:1.98957 Ang E19.CA and E22.OE1 other bump:1.24318 Ang E19.O and E22.CD other bump:1.6891 Ang E19.C and E22.CD other bump:2.05254 Ang E19.CA and E22.CD other bump:2.93174 Ang I20.N and E22.CD other bump:2.08363 Ang E19.O and E22.CG other bump:3.05102 Ang E19.C and E22.CG other bump:3.26185 Ang V10.CG1 and E14.CD other bump:3.14222 Ang N7.CB and A13.CB T0191 86 :LDGVDIIINATPIGMYPNIDVEP 1hu4A 80 :YGGLDVLVNNAAIAFQLDNPTPF Fragment has 13 clashes (null) has 13 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 25 residues self-bump: 1.39817 Ang P24.CA and P24.CB other bump:3.21928 Ang M16.SD and V22.CG1 other bump:1.60456 Ang M16.CE and V22.CG1 other bump:2.7358 Ang M16.CE and V22.CB other bump:2.18883 Ang A11.O and P13.CD neighbor-bump: 2.00267 Ang T12.CA and P13.CD neighbor-bump: 2.08181 Ang T12.O and P13.CD neighbor-bump: 1.27164 Ang T12.C and P13.CD other bump:2.77933 Ang A11.C and P13.CD other bump:2.28601 Ang A11.O and P13.CG neighbor-bump: 2.11586 Ang T12.O and P13.CG neighbor-bump: 2.15184 Ang T12.C and P13.CG other bump:3.24322 Ang A11.C and P13.CG Number of specific fragments= 5 total=289 Number of alignments=50 # command:# Reading fragments from alignment file # T0191 read from T0191.t2k-2track-undertaker.a2m # 1a7aA read from T0191.t2k-2track-undertaker.a2m # adding 1a7aA to template set 1a7aA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # found chain 1a7aA in template set T0191 6 :DGIGARMALEEE 1a7aA 195 :CRESLIDGIKRA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues T0191 18 :IGRVKDKNIVIYGAGGAARAVAFELAK 1a7aA 208 :DVMIAGKVAVVAGYGDVGKGCAQALRG Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 29 residues other bump:2.57539 Ang I10.CG2 and L26.CD1 other bump:2.05412 Ang G14.O and A19.CB other bump:2.73638 Ang A15.CA and A19.CB other bump:2.71403 Ang G14.C and A19.CB other bump:3.01851 Ang A15.N and A19.CB other bump:2.77217 Ang R4.NH1 and K6.C other bump:2.14247 Ang R4.NH1 and K6.O T0191 45 :DNNIIIANRTVEKAEALAKEI 1a7aA 236 :GARVIITEIDPINALQAAMEG Fragment has 17 clashes (null) has 17 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 23 residues neighbor-bump: 2.689 Ang E21.C and I22.CG1 neighbor-bump: 1.86004 Ang E21.O and I22.CB neighbor-bump: 2.32464 Ang E21.C and I22.CB other bump:2.58405 Ang E16.CD and K20.NZ other bump:2.10083 Ang E16.OE2 and K20.NZ other bump:1.84439 Ang E16.CD and K20.CE other bump:2.28534 Ang E16.OE1 and K20.CE other bump:1.03831 Ang E16.OE2 and K20.CE other bump:2.62204 Ang E16.CD and K20.CD other bump:2.56684 Ang E16.OE1 and K20.CD other bump:2.32722 Ang E16.OE2 and K20.CD other bump:2.61592 Ang I7.CD1 and L18.CD2 other bump:2.75976 Ang I7.CB and L18.CD1 other bump:1.88858 Ang I7.CG2 and L18.CD1 other bump:2.88235 Ang I7.CD1 and L18.CD1 other bump:2.70813 Ang N9.ND2 and T11.C other bump:1.92313 Ang N9.ND2 and T11.O T0191 74 :GEE 1a7aA 257 :YEV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 5 residues T0191 80 :SGLDVDLDGVDIIINATPIGMYP 1a7aA 260 :TTMDEACQEGNIFVTTTGCIDII Fragment has 30 clashes (null) has 30 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 25 residues neighbor-bump: 2.11533 Ang Y23.C and P24.CD neighbor-bump: 2.64239 Ang Y23.CB and P24.CD neighbor-bump: 2.85496 Ang Y23.C and P24.CG other bump:2.98311 Ang L4.CD2 and Y23.C other bump:1.87431 Ang L4.CD2 and Y23.O other bump:2.29347 Ang I20.CB and Y23.OH other bump:2.5385 Ang I20.CG1 and Y23.OH other bump:1.48248 Ang T18.CG2 and Y23.OH other bump:2.85361 Ang I20.CB and Y23.CZ other bump:2.66719 Ang T18.CB and Y23.CZ other bump:1.7331 Ang T18.CG2 and Y23.CZ other bump:1.82887 Ang I20.O and Y23.CE2 other bump:2.91126 Ang I20.CB and Y23.CE2 other bump:3.06683 Ang I20.CA and Y23.CE2 other bump:2.51594 Ang I20.C and Y23.CE2 other bump:2.50027 Ang T18.CG2 and Y23.CE2 other bump:3.09307 Ang I20.N and Y23.CE2 other bump:2.89586 Ang T18.CB and Y23.CE1 other bump:2.49799 Ang T18.CG2 and Y23.CE1 other bump:2.63964 Ang T18.OG1 and Y23.CE1 other bump:2.25685 Ang I20.O and Y23.CD2 neighbor-bump: 2.60213 Ang I20.CG2 and G21.N neighbor-bump: 2.37248 Ang T18.CA and P19.CD neighbor-bump: 1.9482 Ang T18.C and P19.CD self-bump: 1.39653 Ang P19.N and P19.CD neighbor-bump: 2.66144 Ang T18.CG2 and P19.N other bump:3.06565 Ang V11.CG1 and I14.CG1 other bump:2.6482 Ang V11.CG1 and I13.C other bump:1.99947 Ang V11.CG1 and I13.O other bump:2.50152 Ang L4.O and L8.CG T0191 108 :PIVKAEKLREDMVVMDLIYNPLETVL 1a7aA 283 :LGRHFEQMKDDAIVCNIGHFDVEIDV Fragment has 13 clashes (null) has 13 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:1.75069 Ang I19.CB and E24.OE2 other bump:1.01512 Ang I19.CG1 and E24.OE2 other bump:2.36942 Ang I19.CG2 and E24.OE2 other bump:0.852174 Ang I19.CD1 and E24.OE2 other bump:2.50116 Ang I19.CG1 and E24.OE1 other bump:1.49005 Ang I19.CD1 and E24.OE1 other bump:3.00264 Ang I19.CB and E24.CD other bump:1.97692 Ang I19.CG1 and E24.CD other bump:0.496084 Ang I19.CD1 and E24.CD other bump:1.8344 Ang I19.CD1 and E24.CG other bump:2.76423 Ang I19.CD1 and E24.CB other bump:2.6854 Ang V4.CG1 and K8.NZ other bump:3.06704 Ang P2.CD and K5.CD Number of specific fragments= 6 total=295 Number of alignments=51 # 1b3rA read from T0191.t2k-2track-undertaker.a2m # adding 1b3rA to template set 1b3rA:# found chain 1b3rA in template set T0191 7 :GIGARMALEEE 1b3rA 195 :RESLIDGIKRA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 13 residues T0191 18 :IGRVKDKNIVIYGAGGAARAVAFELAK 1b3rA 207 :DVMIAGKVAVVAGYGDVGKGCAQALRG Fragment has 12 clashes (null) has 12 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 29 residues other bump:2.89749 Ang F24.CE2 and K28.NZ other bump:2.71009 Ang F24.CD2 and K28.CE other bump:2.73079 Ang F24.CE2 and K28.CE other bump:2.49732 Ang F24.CE2 and K28.CD other bump:2.00156 Ang I10.CD1 and L26.CD2 other bump:2.7551 Ang I10.CG2 and L26.CD1 other bump:2.91077 Ang I10.CD1 and L26.CB other bump:2.78701 Ang I12.CD1 and A19.O other bump:2.45081 Ang G14.O and A19.CB other bump:2.76562 Ang G14.C and A19.CB other bump:2.88665 Ang A15.N and A19.CB other bump:2.71553 Ang A15.CA and A19.CB T0191 45 :DNNIIIANRTVEKAEALAKEI 1b3rA 235 :GARVIITEIDPINALQAAMEG Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 23 residues neighbor-bump: 2.63811 Ang E21.C and I22.CG1 neighbor-bump: 2.31123 Ang E21.C and I22.CB neighbor-bump: 1.79119 Ang E21.O and I22.CB other bump:2.93646 Ang I7.CB and L18.CD1 other bump:2.12619 Ang I7.CG2 and L18.CD1 other bump:2.73885 Ang N9.ND2 and T11.C other bump:1.89951 Ang N9.ND2 and T11.O T0191 74 :GEEVK 1b3rA 256 :YEVTT Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 7 residues T0191 82 :LDVDLDGVDIIINATPIGMYP 1b3rA 261 :MDEACKEGNIFVTTTGCVDII Fragment has 43 clashes (null) has 43 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 23 residues neighbor-bump: 2.7778 Ang Y21.CB and P22.CD other bump:2.2384 Ang L2.CD2 and Y21.O other bump:1.33557 Ang I18.CG2 and Y21.OH other bump:2.59686 Ang T16.CB and Y21.OH other bump:1.16906 Ang T16.CG2 and Y21.OH other bump:1.8786 Ang I18.CB and Y21.OH other bump:0.958789 Ang I18.CG2 and Y21.CZ other bump:2.379 Ang T16.CB and Y21.CZ other bump:2.91067 Ang T16.OG1 and Y21.CZ other bump:1.53103 Ang T16.CG2 and Y21.CZ other bump:2.40457 Ang I18.CB and Y21.CZ other bump:2.51487 Ang I18.C and Y21.CE2 other bump:1.45664 Ang I18.CG2 and Y21.CE2 other bump:2.97643 Ang I18.N and Y21.CE2 other bump:2.86817 Ang I18.CA and Y21.CE2 other bump:2.15027 Ang I18.O and Y21.CE2 other bump:2.90651 Ang T16.CB and Y21.CE2 other bump:2.44069 Ang T16.CG2 and Y21.CE2 other bump:2.56148 Ang I18.CB and Y21.CE2 other bump:2.16241 Ang I18.CG2 and Y21.CE1 other bump:2.71902 Ang T16.CB and Y21.CE1 other bump:2.50071 Ang T16.OG1 and Y21.CE1 other bump:2.32296 Ang T16.CG2 and Y21.CE1 other bump:2.66798 Ang I18.CG2 and Y21.CD2 other bump:2.50033 Ang I18.O and Y21.CD2 other bump:3.01055 Ang T16.OG1 and Y21.CD1 other bump:2.0284 Ang T16.CG2 and I18.CG2 other bump:2.81105 Ang T16.CG2 and I18.CB other bump:2.48049 Ang A15.O and P17.CD other bump:2.74579 Ang A15.C and P17.CD neighbor-bump: 2.43749 Ang T16.N and P17.CD neighbor-bump: 1.78827 Ang T16.CA and P17.CD neighbor-bump: 1.59744 Ang T16.O and P17.CD neighbor-bump: 0.834702 Ang T16.C and P17.CD neighbor-bump: 2.88703 Ang T16.CA and P17.CG neighbor-bump: 0.910262 Ang T16.O and P17.CG neighbor-bump: 1.58334 Ang T16.C and P17.CG neighbor-bump: 2.17854 Ang T16.O and P17.CB neighbor-bump: 2.48788 Ang T16.C and P17.CB other bump:2.99771 Ang V9.CB and I12.CD1 other bump:2.78579 Ang V9.CG1 and I12.CD1 other bump:2.87767 Ang V9.CG1 and I11.C other bump:2.00965 Ang V9.CG1 and I11.O T0191 108 :PIVKAEKLREDMVVMDLIYNPLETVL 1b3rA 282 :LGRHFEQMKDDAIVCNIGHFDVEIDV Fragment has 27 clashes (null) has 27 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:2.68056 Ang I19.CB and E24.OE2 other bump:2.40389 Ang Y20.CE2 and L23.CD2 neighbor-bump: 2.39518 Ang N21.CB and P22.CD neighbor-bump: 2.39045 Ang N21.CG and P22.CD neighbor-bump: 2.10128 Ang N21.OD1 and P22.CD neighbor-bump: 1.82335 Ang N21.CA and P22.CD neighbor-bump: 2.10825 Ang N21.O and P22.CD neighbor-bump: 1.13512 Ang N21.C and P22.CD self-bump: 1.25774 Ang P22.N and P22.CD neighbor-bump: 2.72232 Ang N21.CG and P22.CG neighbor-bump: 2.20976 Ang N21.OD1 and P22.CG neighbor-bump: 2.45011 Ang N21.C and P22.CG self-bump: 2.15023 Ang P22.N and P22.CG self-bump: 1.38316 Ang I19.CA and I19.CB other bump:2.11512 Ang L9.CA and M13.CE other bump:2.61285 Ang L9.C and M13.CE other bump:0.802406 Ang L9.CB and M13.CE other bump:1.86396 Ang L9.CG and M13.CE other bump:2.49803 Ang L9.CD1 and M13.CE other bump:2.59581 Ang L9.CD2 and M13.CE other bump:2.66656 Ang L9.CA and M13.SD other bump:2.84555 Ang R10.N and M13.SD other bump:2.19357 Ang L9.CB and M13.SD other bump:2.54293 Ang L9.CG and M13.SD other bump:2.07663 Ang L9.CD2 and M13.SD other bump:2.86913 Ang V4.C and K8.NZ other bump:2.87268 Ang V4.CG1 and K8.NZ Number of specific fragments= 6 total=301 Number of alignments=52 # 1bdb read from T0191.t2k-2track-undertaker.a2m # found chain 1bdb in template set T0191 20 :RVKDKNIVIYGA 1bdb 2 :KLKGEAVLITGG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues T0191 32 :GGAARAVAFELAK 1bdb 15 :SGLGRALVDRFVA Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues other bump:1.49969 Ang R6.NH2 and F10.CZ other bump:1.97947 Ang R6.NE and F10.CZ other bump:1.65632 Ang R6.CZ and F10.CZ other bump:2.714 Ang R6.NH1 and F10.CZ other bump:2.82765 Ang R6.NH2 and F10.CE2 other bump:2.94798 Ang R6.CZ and F10.CE2 other bump:1.55603 Ang R6.NH2 and F10.CE1 other bump:1.84984 Ang R6.NE and F10.CE1 other bump:1.90974 Ang R6.CZ and F10.CE1 other bump:2.77429 Ang R6.NE and F10.CD1 T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGLDVD 1bdb 29 :GAKVAVLDKSAERLAELETDHGDNVLGIVGDVRSLEDQKQA Fragment has 62 clashes (null) has 62 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 43 residues other bump:2.65269 Ang K29.NZ and D42.C other bump:2.93106 Ang I6.CG2 and D42.OD1 other bump:3.01016 Ang K29.CD and D42.CB other bump:2.70119 Ang K29.CD and D42.CA other bump:2.56885 Ang K29.CE and D42.CA other bump:1.81993 Ang K29.NZ and D42.CA other bump:2.67802 Ang K29.CD and D42.N other bump:2.49683 Ang K29.CE and D42.N other bump:1.38851 Ang K29.NZ and D42.N other bump:2.54355 Ang K29.CE and V41.C other bump:1.20455 Ang K29.NZ and V41.C other bump:1.31441 Ang K29.NZ and V41.O other bump:2.93364 Ang K29.CE and V41.CG1 other bump:3.0607 Ang K29.NZ and V41.CG1 other bump:2.62584 Ang K29.NZ and V41.CA other bump:2.56435 Ang F36.CE2 and D40.OD2 other bump:2.18727 Ang V12.CA and F30.CZ other bump:2.85792 Ang A15.CB and F30.CZ other bump:2.28709 Ang V12.O and F30.CZ other bump:2.53528 Ang V12.C and F30.CZ other bump:1.66025 Ang V12.CA and F30.CE2 other bump:2.87572 Ang V12.CB and F30.CE2 other bump:2.27955 Ang T11.O and F30.CE2 other bump:2.39913 Ang T11.C and F30.CE2 other bump:2.12934 Ang V12.N and F30.CE2 other bump:2.60707 Ang V12.C and F30.CE2 other bump:2.60741 Ang K28.CD and F30.CE1 other bump:2.88057 Ang V12.CG2 and F30.CD2 other bump:2.5567 Ang V12.CA and F30.CD2 other bump:2.99388 Ang T11.C and F30.CD2 other bump:2.63664 Ang V12.N and F30.CD2 other bump:0.956225 Ang A15.C and K28.NZ other bump:1.1812 Ang E16.N and K28.NZ other bump:2.52238 Ang E16.CA and K28.NZ other bump:2.09667 Ang A15.O and K28.NZ other bump:2.03935 Ang A15.CB and K28.NZ other bump:2.21309 Ang A15.N and K28.NZ other bump:1.4992 Ang A15.CA and K28.NZ other bump:1.71042 Ang A15.C and K28.CE other bump:2.64388 Ang E16.N and K28.CE other bump:2.2285 Ang A15.O and K28.CE other bump:1.09417 Ang A15.CB and K28.CE other bump:2.75328 Ang A15.N and K28.CE other bump:1.41703 Ang A15.CA and K28.CE other bump:2.95299 Ang A15.C and K28.CD other bump:1.61509 Ang A15.CB and K28.CD other bump:2.76847 Ang A15.CA and K28.CD other bump:2.43767 Ang A15.CB and K28.CG other bump:2.97481 Ang I22.CB and L26.CD2 other bump:2.2538 Ang I22.CG1 and L26.CD2 other bump:2.81412 Ang I22.CG2 and L26.CD2 other bump:1.23525 Ang I22.CD1 and L26.CD2 other bump:2.06263 Ang I22.CD1 and L26.CD1 other bump:2.81773 Ang I22.CG1 and L26.CG other bump:1.30495 Ang I22.CD1 and L26.CG other bump:2.66684 Ang I22.CG1 and L26.CB other bump:1.68749 Ang I22.CD1 and L26.CB other bump:2.96748 Ang I22.CD1 and L26.CA self-bump: 2.20791 Ang A23.CB and A23.C self-bump: 1.25245 Ang A23.CA and A23.CB other bump:2.63045 Ang I7.CD1 and L18.CD2 other bump:2.63413 Ang T11.OG1 and K14.CE T0191 86 :LDGVDIIINATPIGMYPNIDVE 1bdb 77 :FGKIDTLIPNAGIWDYSTALVD Fragment has 14 clashes (null) has 14 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 24 residues other bump:2.50392 Ang N19.ND2 and E23.CB other bump:3.17081 Ang I20.CG2 and V22.CG1 neighbor-bump: 1.77746 Ang Y17.C and P18.CD neighbor-bump: 2.23231 Ang Y17.O and P18.CD self-bump: 2.20163 Ang P18.CA and P18.CD other bump:2.7074 Ang A11.C and P13.CD other bump:2.04741 Ang A11.O and P13.CD neighbor-bump: 2.09389 Ang T12.CA and P13.CD neighbor-bump: 2.35161 Ang T12.O and P13.CD neighbor-bump: 1.46891 Ang T12.C and P13.CD other bump:3.20288 Ang A11.C and P13.CG other bump:2.33515 Ang A11.O and P13.CG neighbor-bump: 2.53512 Ang T12.O and P13.CG neighbor-bump: 2.34704 Ang T12.C and P13.CG Number of specific fragments= 4 total=305 Number of alignments=53 # 1bg6 read from T0191.t2k-2track-undertaker.a2m # adding 1bg6 to template set 1bg6:# found chain 1bg6 in template set T0191 24 :KNIVIYGAGGAARAVAFELAK 1bg6 5 :KTYAVLGLGNGGHAFAAYLAL Fragment has 19 clashes (null) has 19 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 23 residues other bump:0.794572 Ang F18.CE2 and K22.NZ other bump:2.01111 Ang F18.CD2 and K22.NZ other bump:1.82107 Ang F18.CZ and K22.NZ other bump:1.27691 Ang F18.CE2 and K22.CE other bump:1.9321 Ang F18.CD2 and K22.CE other bump:2.7288 Ang F18.CE1 and K22.CE other bump:1.86722 Ang F18.CZ and K22.CE other bump:2.78508 Ang F18.CG and K22.CE other bump:2.28059 Ang F18.CE2 and K22.CD other bump:2.40772 Ang F18.CE1 and K22.CD other bump:1.76281 Ang F18.CZ and K22.CD other bump:2.90018 Ang I4.CD1 and L20.CD2 other bump:2.63129 Ang I6.CD1 and A17.CB other bump:2.98926 Ang I6.CD1 and A17.CA other bump:1.7595 Ang G8.O and A13.CB other bump:2.66027 Ang G8.C and A13.CB other bump:3.11525 Ang A9.N and A13.CB other bump:2.83334 Ang A9.CA and A13.CB other bump:3.15836 Ang G10.N and A13.CB T0191 45 :DNNIIIANRTVEKAEALAKEIA 1bg6 27 :GQSVLAWDIDAQRIKEIQDRGA Fragment has 14 clashes (null) has 14 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 24 residues neighbor-bump: 2.54586 Ang E21.C and I22.CB other bump:2.78802 Ang V12.CB and E16.OE2 other bump:1.72542 Ang V12.CG1 and E16.OE2 other bump:2.07444 Ang V12.O and E16.OE2 other bump:2.534 Ang V12.C and E16.OE2 other bump:2.1684 Ang E13.N and E16.OE1 other bump:2.24315 Ang E13.CA and E16.OE1 other bump:2.55628 Ang E13.C and E16.OE1 other bump:0.857445 Ang V12.O and E16.OE1 other bump:1.62632 Ang V12.C and E16.OE1 other bump:3.31908 Ang V12.CA and E16.CD other bump:2.7802 Ang V12.CG1 and E16.CD other bump:1.48205 Ang V12.O and E16.CD other bump:2.37032 Ang V12.C and E16.CD T0191 74 :GEEVK 1bg6 49 :IIAEG Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 7 residues neighbor-bump: 2.54335 Ang V5.C and K6.CB neighbor-bump: 2.05029 Ang V5.O and K6.CB T0191 79 :FSGLDVDLDGVDIIINATPIGMYP 1bg6 66 :TSDIGLAVKDADVILIVVPAIHHA Fragment has 45 clashes (null) has 45 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 26 residues other bump:1.74419 Ang I21.CD1 and Y24.OH other bump:2.87277 Ang I21.CA and Y24.CZ other bump:3.19889 Ang I21.CG1 and Y24.CZ other bump:2.17974 Ang I21.CD1 and Y24.CZ other bump:2.58752 Ang I21.CG2 and Y24.CE1 other bump:2.88205 Ang I21.N and Y24.CE1 other bump:1.9128 Ang I21.CA and Y24.CE1 other bump:2.36901 Ang I21.CB and Y24.CE1 other bump:2.66169 Ang I21.CG1 and Y24.CE1 other bump:2.19361 Ang I21.CD1 and Y24.CE1 other bump:2.95662 Ang I21.C and Y24.CE1 other bump:2.82063 Ang I21.CG2 and Y24.CD1 other bump:2.47912 Ang I21.CA and Y24.CD1 other bump:2.36754 Ang I21.O and Y24.CD1 other bump:2.77481 Ang I21.C and Y24.CD1 other bump:2.91559 Ang V12.CG1 and I14.C other bump:2.27239 Ang V12.CG1 and I14.O other bump:2.47994 Ang D8.O and V12.CG2 other bump:2.37581 Ang F2.CE2 and D8.OD2 other bump:2.74371 Ang F2.CD1 and D8.OD2 other bump:0.386563 Ang F2.CE1 and D8.OD1 other bump:2.07786 Ang F2.CE2 and D8.OD1 other bump:1.23 Ang F2.CZ and D8.OD1 other bump:1.26786 Ang F2.CD1 and D8.OD1 other bump:2.4012 Ang F2.CD2 and D8.OD1 other bump:2.11604 Ang F2.CG and D8.OD1 other bump:1.28427 Ang F2.CE1 and D8.CG other bump:1.90292 Ang F2.CE2 and D8.CG other bump:0.938993 Ang F2.CZ and D8.CG other bump:2.27423 Ang F2.CD1 and D8.CG other bump:2.67247 Ang F2.CD2 and D8.CG other bump:2.82664 Ang F2.CG and D8.CG other bump:2.32319 Ang F2.CE1 and D8.CB other bump:2.55063 Ang F2.CE2 and D8.CB other bump:1.46516 Ang F2.CZ and D8.CB other bump:2.66328 Ang F2.CE1 and D8.CA other bump:2.97997 Ang F2.CE2 and D8.CA other bump:1.93969 Ang F2.CZ and D8.CA other bump:2.48538 Ang F2.CE2 and D8.N other bump:2.12711 Ang F2.CZ and D8.N other bump:3.21294 Ang F2.CZ and V7.C other bump:3.00558 Ang F2.CE2 and G4.C other bump:3.02596 Ang F2.CD2 and G4.C other bump:1.93091 Ang F2.CE2 and G4.O other bump:2.22323 Ang F2.CD2 and G4.O T0191 105 :DVEPIVKAEKLREDMVVMDLIYNPLETVLLKEAKKVNAKT 1bg6 90 :SIAANIASYISEGQLIILNPGATGGALEFRKILRENGAPE Fragment has 93 clashes (null) has 93 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 42 residues other bump:2.56098 Ang L12.CD2 and K40.NZ other bump:2.77611 Ang R13.N and K40.CD other bump:3.28161 Ang L12.CA and K40.CD other bump:2.0615 Ang K8.NZ and N38.N other bump:2.73384 Ang K8.CD and V37.C other bump:2.61 Ang K8.CE and V37.C other bump:1.68931 Ang K8.NZ and V37.C other bump:2.69581 Ang K8.CD and V37.O other bump:2.87272 Ang K8.CD and V37.CG2 other bump:2.78006 Ang K8.CE and V37.CG2 other bump:2.18026 Ang K8.CG and V37.CG1 other bump:2.63892 Ang K8.CB and V37.CG1 other bump:1.03854 Ang K8.CD and V37.CG1 other bump:2.31486 Ang K8.CE and V37.CG1 other bump:3.01501 Ang K8.NZ and V37.CG1 other bump:2.96695 Ang K8.CG and V37.CB other bump:1.48767 Ang K8.CD and V37.CB other bump:1.45849 Ang K8.CE and V37.CB other bump:1.90116 Ang K8.NZ and V37.CB other bump:2.52182 Ang K8.CD and V37.CA other bump:2.19326 Ang K8.CE and V37.CA other bump:1.20902 Ang K8.NZ and V37.CA other bump:2.33048 Ang K8.CE and V37.N other bump:1.13572 Ang K8.NZ and V37.N other bump:2.38247 Ang K8.NZ and K36.C other bump:2.25702 Ang K32.CD and K36.NZ other bump:1.7995 Ang K32.CE and K36.NZ other bump:2.33772 Ang K32.NZ and K36.NZ other bump:2.92011 Ang K32.CE and K36.CE other bump:2.8445 Ang K8.CE and A34.C other bump:2.28658 Ang K8.CE and A34.O other bump:2.9122 Ang E4.CD and L30.C other bump:2.4066 Ang E4.OE1 and L30.C other bump:2.17948 Ang E4.OE1 and L30.O other bump:2.78245 Ang E4.CD and L30.CD2 other bump:2.62911 Ang E4.OE2 and L30.CD2 other bump:2.76852 Ang E4.CG and L30.CD2 other bump:2.22097 Ang E4.CD and L30.CD1 other bump:1.6122 Ang E4.OE2 and L30.CD1 other bump:2.30242 Ang M19.CE and L30.CD1 other bump:2.20714 Ang E4.CG and L30.CD1 other bump:2.05317 Ang E4.CD and L30.CG other bump:1.39712 Ang E4.OE2 and L30.CG other bump:2.355 Ang M19.CE and L30.CG other bump:2.51027 Ang E4.CG and L30.CG other bump:2.4633 Ang E4.CD and L30.CB other bump:1.54084 Ang E4.OE2 and L30.CB other bump:2.52939 Ang M19.CE and L30.CB other bump:2.09626 Ang E4.CD and L30.CA other bump:1.79168 Ang E4.OE2 and L30.CA other bump:2.0293 Ang E4.OE1 and L30.CA other bump:2.66508 Ang I22.CD1 and E27.CG other bump:2.92124 Ang I22.CD1 and E27.CB other bump:3.0126 Ang I22.CD1 and E27.CA other bump:2.77263 Ang I22.CG1 and E27.N other bump:2.11834 Ang I22.CD1 and E27.N other bump:3.10267 Ang I22.CG1 and L26.C other bump:1.95345 Ang I22.O and L26.CD1 other bump:2.2009 Ang I22.CA and L26.CD1 other bump:1.95083 Ang I22.C and L26.CD1 other bump:2.878 Ang Y23.N and L26.CD1 other bump:1.77056 Ang I22.O and L26.CG other bump:2.99634 Ang I22.CA and L26.CG other bump:2.54618 Ang I22.C and L26.CG other bump:3.09549 Ang I22.CB and L26.CB other bump:2.22786 Ang I22.CG1 and L26.CB other bump:2.41064 Ang I22.O and L26.CB other bump:2.90946 Ang I22.CA and L26.CB other bump:3.01599 Ang I22.C and L26.CB other bump:2.64076 Ang I22.CG1 and L26.CA other bump:2.70691 Ang I22.CG1 and L26.N neighbor-bump: 2.39707 Ang N24.CA and P25.CD self-bump: 2.17407 Ang P25.CA and P25.CD neighbor-bump: 1.46226 Ang N24.O and P25.CD neighbor-bump: 1.20619 Ang N24.C and P25.CD neighbor-bump: 2.57132 Ang N24.C and P25.CG neighbor-bump: 2.42423 Ang Y23.CB and N24.N self-bump: 2.10379 Ang Y23.CB and Y23.C self-bump: 1.18102 Ang Y23.CA and Y23.CB neighbor-bump: 2.42171 Ang L21.CB and I22.N self-bump: 2.16444 Ang L21.CB and L21.C other bump:1.77133 Ang M19.O and L21.CD2 other bump:2.70398 Ang M19.C and L21.CD2 neighbor-bump: 2.75763 Ang D20.CA and L21.CD2 neighbor-bump: 3.11233 Ang D20.CA and L21.CG self-bump: 1.22282 Ang L21.CA and L21.CB neighbor-bump: 2.78822 Ang D20.CA and L21.CA other bump:2.5787 Ang K11.NZ and V17.CG1 neighbor-bump: 2.44586 Ang R13.O and E14.CG self-bump: 1.4061 Ang E10.CA and E10.C other bump:1.64297 Ang G1.O and P5.CD other bump:2.82384 Ang G1.C and P5.CD other bump:2.28926 Ang G1.O and P5.CG Number of specific fragments= 5 total=310 Number of alignments=54 # 1bw9A read from T0191.t2k-2track-undertaker.a2m # adding 1bw9A to template set 1bw9A:Skipped atom 69, because occupancy 0.5 <= existing 0.500001 Skipped atom 71, because occupancy 0.5 <= existing 0.500001 Skipped atom 73, because occupancy 0.5 <= existing 0.500001 Skipped atom 75, because occupancy 0.5 <= existing 0.500001 Skipped atom 402, because occupancy 0.5 <= existing 0.500001 Skipped atom 404, because occupancy 0.5 <= existing 0.500001 Skipped atom 406, because occupancy 0.5 <= existing 0.500001 Skipped atom 412, because occupancy 0.5 <= existing 0.500001 Skipped atom 414, because occupancy 0.5 <= existing 0.500001 Skipped atom 416, because occupancy 0.5 <= existing 0.500001 Skipped atom 418, because occupancy 0.5 <= existing 0.500001 Skipped atom 545, because occupancy 0.5 <= existing 0.500001 Skipped atom 547, because occupancy 0.5 <= existing 0.500001 Skipped atom 549, because occupancy 0.5 <= existing 0.500001 Skipped atom 551, because occupancy 0.5 <= existing 0.500001 Skipped atom 652, because occupancy 0.5 <= existing 0.500001 Skipped atom 654, because occupancy 0.5 <= existing 0.500001 Skipped atom 668, because occupancy 0.5 <= existing 0.500001 Skipped atom 670, because occupancy 0.5 <= existing 0.500001 Skipped atom 672, because occupancy 0.5 <= existing 0.500001 Skipped atom 674, because occupancy 0.5 <= existing 0.500001 Skipped atom 830, because occupancy 0.5 <= existing 0.500001 Skipped atom 832, because occupancy 0.5 <= existing 0.500001 Skipped atom 932, because occupancy 0.5 <= existing 0.500001 Skipped atom 934, because occupancy 0.5 <= existing 0.500001 Skipped atom 1892, because occupancy 0.5 <= existing 0.500001 Skipped atom 1894, because occupancy 0.5 <= existing 0.500001 Skipped atom 1896, because occupancy 0.5 <= existing 0.500001 Skipped atom 1898, because occupancy 0.5 <= existing 0.500001 # found chain 1bw9A in template set T0191 5 :TDGIGARMALEEE 1bw9A 152 :TTAVGVFEAMKAT Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues T0191 18 :IGRVKDKNIVIYGAGGAARAVAFELAK 1bw9A 170 :LGSLDGLTVLVQGLGAVGGSLASLAAE Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 29 residues other bump:1.82547 Ang I10.CD1 and L26.CD1 other bump:3.07444 Ang I10.CD1 and L26.CB other bump:2.72481 Ang I12.CD1 and A23.CB other bump:1.69409 Ang G14.O and A19.CB other bump:2.74742 Ang G14.C and A19.CB other bump:3.26207 Ang A15.CA and A19.CB T0191 45 :DNNIIIANRTVEKAEALAKE 1bw9A 198 :GAQLLVADTDTERVAHAVAL Fragment has 16 clashes (null) has 16 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 22 residues other bump:3.04194 Ang I7.CD1 and L18.CD2 other bump:2.43045 Ang I7.CG2 and L18.CD1 other bump:2.48019 Ang I7.CD1 and L18.CD1 other bump:2.76129 Ang I7.CD1 and L18.CG other bump:2.54723 Ang I7.CD1 and L18.CB other bump:2.18995 Ang V12.CG1 and E16.OE2 other bump:2.41887 Ang V12.O and E16.OE2 other bump:1.21692 Ang V12.O and E16.OE1 other bump:2.06335 Ang V12.C and E16.OE1 other bump:2.66772 Ang E13.CA and E16.OE1 other bump:3.12385 Ang V12.CG1 and E16.CD other bump:2.00097 Ang V12.O and E16.CD other bump:2.9208 Ang V12.C and E16.CD other bump:2.32377 Ang T11.CG2 and K14.CD other bump:2.62372 Ang T11.CG2 and K14.CG other bump:2.50496 Ang N9.OD1 and T11.CG2 T0191 66 :A 1bw9A 218 :G Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 3 residues T0191 74 :GEEVKFSGLD 1bw9A 219 :HTAVALEDVL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 12 residues T0191 86 :LDGVDIIINATPIGMY 1bw9A 229 :STPCDVFAPCAMGGVI Fragment has 15 clashes (null) has 15 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 18 residues other bump:2.34279 Ang N10.CG and Y17.OH other bump:1.31511 Ang N10.OD1 and Y17.OH other bump:3.06811 Ang N10.CG and Y17.CZ other bump:1.85117 Ang N10.OD1 and Y17.CZ other bump:2.21761 Ang N10.OD1 and Y17.CE2 other bump:2.64744 Ang N10.ND2 and M16.CE other bump:2.82746 Ang N10.CB and M16.SD neighbor-bump: 2.49463 Ang I14.CG2 and G15.N neighbor-bump: 2.63697 Ang T12.CG2 and P13.CD neighbor-bump: 2.52958 Ang T12.CB and P13.CD neighbor-bump: 2.68196 Ang T12.CG2 and P13.N self-bump: 1.26266 Ang T12.CA and T12.CB other bump:2.98822 Ang I7.CD1 and I9.CG1 other bump:2.82231 Ang V5.CG1 and I7.C other bump:2.48209 Ang V5.CG1 and I7.O T0191 108 :PIVKAEKLREDMVVMDLIYNPLETVLLKEAKKVNAKTINGL 1bw9A 245 :TTEVARTLDCSVVAGAANNVIADEAASDILHARGILYAPDF Fragment has 35 clashes (null) has 35 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 43 residues other bump:2.40009 Ang V15.CG2 and I39.CD1 other bump:2.80154 Ang V15.CG2 and I39.CG1 other bump:2.94731 Ang M13.SD and K37.O other bump:2.01295 Ang I3.N and L27.CD2 other bump:1.94105 Ang I3.CA and L27.CD2 other bump:1.62059 Ang P2.O and L27.CD2 other bump:1.86865 Ang P2.C and L27.CD2 other bump:3.2448 Ang P2.CA and L27.CD2 other bump:2.63232 Ang I3.C and L27.CD2 other bump:3.11966 Ang A6.CB and L27.CD2 other bump:2.60863 Ang I3.N and L27.CD1 other bump:1.81929 Ang G1.O and L27.CD1 other bump:2.67395 Ang P2.O and L27.CD1 other bump:2.08888 Ang P2.C and L27.CD1 other bump:2.4535 Ang G1.C and L27.CD1 other bump:2.60077 Ang P2.N and L27.CD1 other bump:2.102 Ang P2.CA and L27.CD1 other bump:2.34317 Ang I3.N and L27.CG other bump:2.76198 Ang I3.CA and L27.CG other bump:2.31565 Ang P2.C and L27.CG other bump:3.14625 Ang P2.CA and L27.CG other bump:2.46252 Ang I3.CD1 and L27.N other bump:2.96713 Ang I3.CD1 and V26.C other bump:3.12815 Ang I3.CD1 and V26.CG1 other bump:2.63014 Ang I3.CD1 and V26.CB other bump:2.48255 Ang L18.CB and N21.OD1 neighbor-bump: 2.98529 Ang I19.CG2 and Y20.CE2 neighbor-bump: 2.47955 Ang I19.CG2 and Y20.CD2 other bump:2.39833 Ang M16.CE and L18.CD1 neighbor-bump: 2.47136 Ang V14.O and V15.CG2 neighbor-bump: 2.90985 Ang V14.C and V15.CG2 other bump:3.04889 Ang M13.SD and V15.CG2 other bump:2.76084 Ang P2.CD and K5.CD other bump:3.00072 Ang P2.CD and K5.CG other bump:3.00083 Ang P2.CD and K5.CB Number of specific fragments= 7 total=317 Number of alignments=55 # 1c1dA read from T0191.t2k-2track-undertaker.a2m # adding 1c1dA to template set 1c1dA:Skipped atom 28, because occupancy 0.5 <= existing 0.500001 Skipped atom 30, because occupancy 0.5 <= existing 0.500001 Skipped atom 537, because occupancy 0.5 <= existing 0.500001 Skipped atom 539, because occupancy 0.5 <= existing 0.500001 Skipped atom 912, because occupancy 0.5 <= existing 0.500001 Skipped atom 914, because occupancy 0.5 <= existing 0.500001 Skipped atom 1772, because occupancy 0.5 <= existing 0.500001 Skipped atom 1774, because occupancy 0.5 <= existing 0.500001 Skipped atom 1776, because occupancy 0.5 <= existing 0.500001 Skipped atom 1778, because occupancy 0.5 <= existing 0.500001 Skipped atom 1780, because occupancy 0.5 <= existing 0.500001 Skipped atom 2511, because occupancy 0.5 <= existing 0.500001 Skipped atom 2513, because occupancy 0.5 <= existing 0.500001 Skipped atom 2515, because occupancy 0.5 <= existing 0.500001 Skipped atom 2517, because occupancy 0.5 <= existing 0.500001 Skipped atom 2519, because occupancy 0.5 <= existing 0.500001 # found chain 1c1dA in template set T0191 5 :TDGIGARMALEEE 1c1dA 152 :TTAVGVFEAMKAT Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues T0191 18 :IGRVKDKNIVIYGAGGAARAVAFELAK 1c1dA 170 :LGSLDGLTVLVQGLGAVGGSLASLAAE Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 29 residues other bump:1.81831 Ang I10.CD1 and L26.CD1 other bump:3.04511 Ang I10.CD1 and L26.CB other bump:2.69677 Ang I12.CD1 and A23.CB other bump:2.7895 Ang G14.C and A19.CB other bump:1.68413 Ang G14.O and A19.CB other bump:3.27925 Ang A15.CA and A19.CB T0191 45 :DNNIIIANRTVEKAEALAKE 1c1dA 198 :GAQLLVADTDTERVAHAVAL Fragment has 13 clashes (null) has 13 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 22 residues other bump:2.56553 Ang I7.CG2 and L18.CD1 other bump:2.54684 Ang I7.CD1 and L18.CD1 other bump:2.61635 Ang I7.CD1 and L18.CB other bump:2.00904 Ang V12.CG1 and E16.OE2 other bump:2.33144 Ang V12.O and E16.OE2 other bump:1.06669 Ang V12.O and E16.OE1 other bump:1.88772 Ang V12.C and E16.OE1 other bump:2.49062 Ang E13.CA and E16.OE1 other bump:2.94807 Ang V12.CG1 and E16.CD other bump:1.84575 Ang V12.O and E16.CD other bump:2.75493 Ang V12.C and E16.CD other bump:2.45936 Ang N9.ND2 and T11.CG2 other bump:3.15805 Ang I5.CG2 and I7.CG1 T0191 66 :A 1c1dA 218 :G Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 3 residues T0191 74 :GEEVKFSGLD 1c1dA 219 :HTAVALEDVL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 12 residues T0191 86 :LDGVDIIINATPIGMY 1c1dA 229 :STPCDVFAPCAMGGVI Fragment has 16 clashes (null) has 16 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 18 residues other bump:2.49863 Ang N10.CG and Y17.OH other bump:1.46184 Ang N10.OD1 and Y17.OH other bump:1.94761 Ang N10.OD1 and Y17.CZ other bump:2.25108 Ang N10.OD1 and Y17.CE2 other bump:2.91896 Ang N10.CG and M16.CE other bump:2.54243 Ang N10.ND2 and M16.CE other bump:2.77909 Ang N10.CB and M16.SD neighbor-bump: 2.41187 Ang I14.CG2 and G15.N neighbor-bump: 2.39672 Ang T12.CB and P13.CD neighbor-bump: 2.3025 Ang T12.CG2 and P13.CD neighbor-bump: 3.00111 Ang T12.CG2 and P13.CG neighbor-bump: 2.69483 Ang T12.CG2 and P13.N self-bump: 1.2692 Ang T12.CA and T12.CB other bump:2.91428 Ang I7.CD1 and I9.CG1 other bump:2.87393 Ang V5.CG1 and I7.C other bump:2.58859 Ang V5.CG1 and I7.O T0191 108 :PIVKAEKLREDMVVMDLIYNPLETVLLKEAKKVNAKTINGL 1c1dA 245 :TTEVARTLDCSVVAGAANNVIADEAASDILHARGILYAPDF Fragment has 32 clashes (null) has 32 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 43 residues other bump:2.18274 Ang V15.CG2 and I39.CD1 other bump:2.68271 Ang V15.CG2 and I39.CG1 other bump:2.82904 Ang M13.SD and K37.O other bump:1.94873 Ang I3.N and L27.CD2 other bump:1.70537 Ang P2.O and L27.CD2 other bump:1.88053 Ang P2.C and L27.CD2 other bump:3.27425 Ang P2.CA and L27.CD2 other bump:1.8406 Ang I3.CA and L27.CD2 other bump:2.61713 Ang I3.C and L27.CD2 other bump:3.12969 Ang A6.CB and L27.CD2 other bump:2.53974 Ang I3.N and L27.CD1 other bump:1.98556 Ang G1.O and L27.CD1 other bump:2.10731 Ang P2.C and L27.CD1 other bump:2.5973 Ang G1.C and L27.CD1 other bump:2.70086 Ang P2.N and L27.CD1 other bump:2.12451 Ang P2.CA and L27.CD1 other bump:2.30858 Ang I3.N and L27.CG other bump:2.36176 Ang P2.C and L27.CG other bump:3.19759 Ang P2.CA and L27.CG other bump:2.69758 Ang I3.CA and L27.CG other bump:3.11602 Ang I3.CD1 and L27.CA other bump:2.2933 Ang I3.CD1 and L27.N other bump:2.81201 Ang I3.CD1 and V26.C other bump:3.09661 Ang I3.CD1 and V26.CG1 other bump:2.61507 Ang I3.CD1 and V26.CB other bump:3.06129 Ang I3.CD1 and V26.CA other bump:2.59036 Ang L18.CB and N21.OD1 neighbor-bump: 2.91388 Ang I19.CG2 and Y20.CE2 neighbor-bump: 2.52935 Ang I19.CG2 and Y20.CD2 other bump:2.81943 Ang P2.CD and K5.CD other bump:3.06732 Ang P2.CD and K5.CG other bump:3.05318 Ang P2.CD and K5.CB Number of specific fragments= 7 total=324 Number of alignments=56 # 1ceqA read from T0191.t2k-2track-undertaker.a2m # adding 1ceqA to template set 1ceqA:# found chain 1ceqA in template set T0191 23 :DKNIVIYGAGGAARAVAFELAK 1ceqA 20 :KAKIVLVGSGMIGGVMATLIVQ Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 24 residues other bump:2.647 Ang G9.O and A14.CB other bump:3.05072 Ang A10.CA and A14.CB T0191 45 :DN 1ceqA 44 :NL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues T0191 47 :NIIIAN 1ceqA 47 :DVVLFD Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 8 residues T0191 53 :RTVEKAEALAKEIAEKLNKKFGEEVKFSGLDV 1ceqA 56 :KNMPHGKALDTSHTNVMAYSNCKVSGSNTYDD Fragment has 46 clashes (null) has 46 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 34 residues other bump:3.1142 Ang F28.CD2 and V33.CG1 other bump:0.969239 Ang A7.N and K27.NZ other bump:2.70477 Ang A7.CB and K27.NZ other bump:1.66921 Ang K6.C and K27.NZ other bump:2.39718 Ang K6.CA and K27.NZ other bump:2.04405 Ang A7.CA and K27.NZ other bump:2.58143 Ang K6.CB and K27.NZ other bump:1.04059 Ang A7.N and K27.CE other bump:2.01079 Ang K6.N and K27.CE other bump:0.69179 Ang K6.C and K27.CE other bump:2.99061 Ang A7.C and K27.CE other bump:2.58413 Ang E5.C and K27.CE other bump:1.51747 Ang K6.CA and K27.CE other bump:2.36336 Ang A7.CA and K27.CE other bump:2.58046 Ang K6.CB and K27.CE other bump:1.84153 Ang K6.O and K27.CE other bump:2.45208 Ang A7.N and K27.CD other bump:0.991707 Ang K6.N and K27.CD other bump:1.72877 Ang K6.C and K27.CD other bump:2.46587 Ang E5.O and K27.CD other bump:2.03177 Ang E5.C and K27.CD other bump:0.469482 Ang K6.CA and K27.CD other bump:1.77447 Ang K6.CB and K27.CD other bump:2.7118 Ang K6.CG and K27.CD other bump:3.13304 Ang E5.CA and K27.CG other bump:1.6645 Ang K6.N and K27.CG other bump:2.68487 Ang K6.C and K27.CG other bump:1.60688 Ang E5.O and K27.CG other bump:1.72289 Ang E5.C and K27.CG other bump:1.67629 Ang K6.CA and K27.CG other bump:2.97259 Ang K6.CB and K27.CG other bump:2.49786 Ang K6.N and K27.CB other bump:2.77075 Ang E5.C and K27.CB other bump:2.56706 Ang K6.CA and K27.CB other bump:2.8886 Ang K6.CG and K27.CB other bump:2.59733 Ang K12.CD and E25.OE2 other bump:1.90796 Ang K12.CE and E25.OE2 other bump:2.68535 Ang K12.CB and E25.OE2 other bump:2.79623 Ang K12.CA and E25.OE1 other bump:2.07514 Ang K12.CB and E25.OE1 other bump:2.66584 Ang K12.C and E25.OE1 other bump:3.08936 Ang K12.CE and E25.CD other bump:2.7066 Ang K12.CB and E25.CD other bump:2.33646 Ang E16.OE2 and G23.C other bump:1.44984 Ang E16.OE2 and G23.O other bump:2.67658 Ang E16.CD and G23.O T0191 86 :LDGVDIIINATPI 1ceqA 88 :LAGSDVVIVTAGF Fragment has 16 clashes (null) has 16 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues neighbor-bump: 1.58404 Ang T12.O and P13.CD neighbor-bump: 0.873831 Ang T12.C and P13.CD other bump:2.27913 Ang A11.O and P13.CD other bump:2.6509 Ang A11.C and P13.CD neighbor-bump: 2.5343 Ang T12.N and P13.CD neighbor-bump: 1.87888 Ang T12.CA and P13.CD neighbor-bump: 2.1083 Ang T12.O and P13.CG neighbor-bump: 2.1705 Ang T12.C and P13.CG neighbor-bump: 2.28509 Ang T12.O and P13.CB neighbor-bump: 2.56907 Ang T12.C and P13.CB other bump:2.41697 Ang V5.CG1 and I8.CG2 other bump:3.1201 Ang V5.CG1 and I7.C other bump:2.62376 Ang V5.CG1 and I7.O other bump:2.46544 Ang L2.O and V5.CG2 other bump:3.19557 Ang L2.CA and V5.CG2 other bump:3.09122 Ang L2.C and V5.CG2 T0191 111 :KAEK 1ceqA 109 :RDDL Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 6 residues other bump:1.67005 Ang G1.C and E4.OE1 other bump:1.05408 Ang G1.O and E4.OE1 other bump:2.87643 Ang G1.C and E4.CD other bump:2.23517 Ang G1.O and E4.CD Number of specific fragments= 6 total=330 Number of alignments=57 # 1cydA read from T0191.t2k-2track-undertaker.a2m # found chain 1cydA in template set T0191 20 :RVKDKNIVIYGAG 1cydA 4 :NFSGLRALVTGAG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues T0191 33 :GAARAVAFELAK 1cydA 18 :GIGRDTVKALHA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKK 1cydA 31 :GAKVVAVTRTNSDLVSLAKECPGIEPVC Fragment has 28 clashes (null) has 28 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 30 residues other bump:2.35913 Ang V12.N and K29.NZ other bump:2.01342 Ang V12.CA and K29.NZ other bump:1.17289 Ang V12.CB and K29.NZ other bump:1.53911 Ang V12.CG1 and K29.NZ other bump:1.25603 Ang V12.CG2 and K29.NZ other bump:3.06242 Ang T11.C and K29.CE other bump:1.94247 Ang V12.N and K29.CE other bump:1.84487 Ang V12.CA and K29.CE other bump:1.71937 Ang V12.CB and K29.CE other bump:1.3082 Ang V12.CG1 and K29.CE other bump:2.69639 Ang V12.CG2 and K29.CE other bump:2.91086 Ang V12.CB and K29.CD other bump:1.67655 Ang V12.CG1 and K29.CD other bump:2.86538 Ang V12.CG1 and K29.CG other bump:2.48335 Ang I5.CD1 and K25.NZ other bump:2.18248 Ang I7.CG1 and K25.NZ other bump:1.72455 Ang I7.CD1 and K25.NZ other bump:2.2857 Ang I5.CD1 and K25.CE other bump:2.57236 Ang I5.CG1 and K25.CE other bump:2.09268 Ang I7.CG1 and K25.CE other bump:2.12582 Ang I7.CD1 and K25.CE other bump:2.88053 Ang I5.CD1 and K25.CD other bump:3.07312 Ang I5.CG1 and K25.CD other bump:3.15783 Ang I5.CG1 and K25.CG neighbor-bump: 2.28952 Ang A23.O and E24.CG neighbor-bump: 2.81687 Ang A23.C and E24.CG neighbor-bump: 3.05478 Ang E21.C and I22.CG1 other bump:2.79592 Ang I5.CD1 and I7.CD1 T0191 74 :GEEVKFSGLDVD 1cydA 59 :VDLGDWDATEKA Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:3.07981 Ang E4.CA and L10.CD2 other bump:2.63169 Ang E4.OE1 and L10.CD2 other bump:2.78259 Ang E4.CD and L10.CD2 other bump:2.95609 Ang E4.CA and L10.CD1 other bump:2.49321 Ang E4.O and L10.CD1 other bump:2.6863 Ang E3.CD and K6.CE other bump:2.41592 Ang E3.OE1 and K6.CE T0191 86 :LDGVDIIINATPIGMYPNIDVEPIVKA 1cydA 74 :IGPVDLLVNNAALVIMQPFLEVTKEAF Fragment has 19 clashes (null) has 19 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 29 residues other bump:1.99886 Ang P18.CG and K27.NZ other bump:2.20825 Ang P18.CD and K27.NZ other bump:2.95241 Ang P18.CG and K27.CE other bump:2.3839 Ang P18.CD and K27.CE other bump:2.87469 Ang P18.CG and K27.CD other bump:1.84345 Ang P18.CD and K27.CD other bump:2.9136 Ang P24.CG and K27.CG other bump:2.74651 Ang P18.CD and P24.CD other bump:1.9689 Ang A11.O and P13.CD other bump:2.62767 Ang A11.C and P13.CD neighbor-bump: 2.1246 Ang T12.CA and P13.CD neighbor-bump: 2.20012 Ang T12.O and P13.CD neighbor-bump: 1.41579 Ang T12.C and P13.CD other bump:2.45057 Ang A11.O and P13.CG neighbor-bump: 2.39862 Ang T12.O and P13.CG neighbor-bump: 2.3511 Ang T12.C and P13.CG neighbor-bump: 2.47861 Ang D3.CB and G4.N self-bump: 2.19176 Ang D3.CB and D3.C self-bump: 1.29723 Ang D3.CA and D3.CB Number of specific fragments= 5 total=335 Number of alignments=58 # 1d4fA read from T0191.t2k-2track-undertaker.a2m # adding 1d4fA to template set 1d4fA:# found chain 1d4fA in template set T0191 7 :GIGARMALEEE 1d4fA 195 :RESLIDGIKRA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 13 residues T0191 18 :IGRVKDKNIVIYGAGGAARAVAFELAK 1d4fA 207 :DVMIAGKVAVVAGYGDVGKGCAQALRG Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 29 residues other bump:3.15477 Ang K6.CG and G29.CA other bump:2.82094 Ang I10.CD1 and L26.CD2 other bump:2.44765 Ang I10.CG2 and L26.CD1 other bump:2.70246 Ang I10.CD1 and L26.CB other bump:3.18301 Ang A15.N and A19.CB other bump:2.7732 Ang A15.CA and A19.CB other bump:3.19177 Ang G16.N and A19.CB other bump:2.05235 Ang G14.O and A19.CB other bump:2.85688 Ang G14.C and A19.CB other bump:2.08664 Ang R4.NH1 and K6.O T0191 45 :DNNIIIANRTVEKAEALAKEI 1d4fA 235 :GARVIITEIEPINALQAAMEG Fragment has 9 clashes (null) has 9 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 23 residues neighbor-bump: 2.80266 Ang E21.C and I22.CG1 neighbor-bump: 2.4251 Ang E21.C and I22.CB neighbor-bump: 1.94772 Ang E21.O and I22.CB other bump:2.77735 Ang E16.CG and K20.CE other bump:2.99125 Ang I7.CD1 and L18.CD2 other bump:2.57121 Ang I7.CB and L18.CD1 other bump:2.68421 Ang I7.CG1 and L18.CD1 other bump:2.0646 Ang I7.CG2 and L18.CD1 other bump:2.88691 Ang T11.OG1 and K14.CD T0191 74 :GEEVK 1d4fA 256 :YEVTT Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 7 residues T0191 82 :LDVDLDGVDIIINATPIGMYP 1d4fA 261 :MDEACKEGNIFVTTTGCVDII Fragment has 31 clashes (null) has 31 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 23 residues neighbor-bump: 2.50164 Ang Y21.CB and P22.CD neighbor-bump: 2.01689 Ang Y21.C and P22.CD other bump:3.12637 Ang L2.CD2 and Y21.C other bump:2.00016 Ang L2.CD2 and Y21.O other bump:1.3454 Ang T16.CG2 and Y21.OH other bump:2.0536 Ang T16.CB and Y21.OH other bump:1.79354 Ang T16.CG2 and Y21.CZ other bump:3.13063 Ang T16.CA and Y21.CZ other bump:2.68122 Ang T16.OG1 and Y21.CZ other bump:1.81265 Ang T16.CB and Y21.CZ other bump:2.70588 Ang T16.CB and Y21.CE2 other bump:3.087 Ang I18.N and Y21.CE2 other bump:2.12276 Ang I18.O and Y21.CE2 other bump:3.05952 Ang I18.C and Y21.CE2 other bump:1.9438 Ang T16.CG2 and Y21.CE1 other bump:2.09738 Ang T16.OG1 and Y21.CE1 other bump:2.02892 Ang T16.CB and Y21.CE1 other bump:2.50543 Ang N14.ND2 and Y21.CD2 other bump:2.50564 Ang I18.O and Y21.CD2 other bump:2.55514 Ang T16.OG1 and Y21.CD1 other bump:3.00218 Ang T16.CB and Y21.CD1 other bump:2.18611 Ang N14.ND2 and Y21.CG other bump:3.08548 Ang N14.CG and Y21.CG other bump:2.06754 Ang N14.ND2 and Y21.CB neighbor-bump: 2.73341 Ang I18.CG2 and G19.N neighbor-bump: 2.32285 Ang T16.CA and P17.CD neighbor-bump: 1.966 Ang T16.C and P17.CD self-bump: 1.32665 Ang P17.N and P17.CD self-bump: 2.17331 Ang P17.N and P17.CG other bump:3.00686 Ang V9.CG1 and I12.CG1 other bump:2.92388 Ang L2.CD1 and L6.CD2 T0191 108 :PIVKAEKLREDMVVMDLIYNPLET 1d4fA 282 :LGRHFEQMKDDAIVCNIGHFDVEI Fragment has 9 clashes (null) has 9 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 26 residues other bump:2.73313 Ang D17.OD2 and E24.CG other bump:2.68075 Ang D17.OD2 and E24.CB neighbor-bump: 3.04322 Ang I19.CG2 and Y20.CA neighbor-bump: 1.7957 Ang I19.CG2 and Y20.N self-bump: 2.32632 Ang I19.CG2 and I19.C self-bump: 1.27932 Ang I19.CA and I19.CB other bump:2.98986 Ang L9.CD2 and M13.CE other bump:1.65496 Ang V4.O and K8.NZ other bump:2.71724 Ang V4.C and K8.NZ T0191 133 :LLKE 1d4fA 306 :DVKW Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 6 residues Number of specific fragments= 7 total=342 Number of alignments=59 # 1dxy read from T0191.t2k-2track-undertaker.a2m # adding 1dxy to template set 1dxy:Skipped atom 413, because occupancy 0.5 <= existing 0.500001 Skipped atom 415, because occupancy 0.5 <= existing 0.500001 Skipped atom 1210, because occupancy 0.5 <= existing 0.500001 Skipped atom 1212, because occupancy 0.5 <= existing 0.500001 Skipped atom 1214, because occupancy 0.5 <= existing 0.500001 Skipped atom 1216, because occupancy 0.5 <= existing 0.500001 Skipped atom 1218, because occupancy 0.5 <= existing 0.500001 Skipped atom 1220, because occupancy 0.5 <= existing 0.500001 # found chain 1dxy in template set T0191 17 :EIGRVKDKNIVIYGAGGAARAVAFELAK 1dxy 139 :IGKELGQQTVGVMGTGHIGQVAIKLFKG Fragment has 8 clashes (null) has 8 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 30 residues other bump:2.35535 Ang I11.CD1 and L27.CD2 other bump:3.11056 Ang V23.CG1 and L27.CD2 other bump:2.69677 Ang I11.CD1 and L27.CD1 other bump:2.1036 Ang I11.CD1 and L27.CG other bump:2.55523 Ang I11.CD1 and L27.CB other bump:3.1086 Ang A16.CA and A20.CB other bump:1.785 Ang G15.O and A20.CB other bump:2.79705 Ang G15.C and A20.CB T0191 45 :DNNIIIANRT 1dxy 168 :GAKVIAYDPY Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 12 residues other bump:2.44469 Ang N3.ND2 and I5.CG2 T0191 68 :KLNKKFGEEVKFSGLDV 1dxy 180 :KGDHPDFDYVSLEDLFK Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 19 residues other bump:2.89414 Ang F13.CE2 and D17.OD1 other bump:2.79851 Ang N4.ND2 and K6.CD other bump:2.63091 Ang N4.OD1 and K6.CD neighbor-bump: 2.30891 Ang L3.CB and N4.N self-bump: 2.17941 Ang L3.CB and L3.C self-bump: 1.31218 Ang L3.CA and L3.CB T0191 88 :GVD 1dxy 197 :QSD Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 5 residues T0191 92 :IINATPIGMYPNIDVEPIVKAEKLREDMVVMDLIYNPLETVL 1dxy 200 :VIDLHVPGIEQNTHIINEAAFNLMKPGAIVINTARPNLIDTQ Fragment has 56 clashes (null) has 56 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 44 residues other bump:2.43888 Ang D15.CG and T41.OG1 other bump:2.43481 Ang D15.OD1 and T41.OG1 other bump:2.74182 Ang V31.CG1 and E40.OE2 other bump:2.6215 Ang I35.CG1 and L39.CD1 other bump:2.56238 Ang I35.CD1 and L39.CD1 other bump:3.1587 Ang I14.CB and P38.C other bump:2.20134 Ang I14.CG1 and P38.C other bump:2.44969 Ang I14.CD1 and P38.C other bump:3.1283 Ang I14.CG2 and P38.C other bump:2.27823 Ang I14.CB and P38.O other bump:1.95875 Ang I14.CG1 and P38.O other bump:2.60413 Ang I14.CD1 and P38.O other bump:1.98185 Ang I14.CG2 and P38.O neighbor-bump: 2.0011 Ang N37.C and P38.CD self-bump: 1.29512 Ang P38.N and P38.CD neighbor-bump: 2.37046 Ang N37.N and P38.CD neighbor-bump: 2.36152 Ang N37.CA and P38.CD neighbor-bump: 1.97674 Ang N37.ND2 and P38.CD self-bump: 2.15843 Ang P38.N and P38.CG other bump:2.59753 Ang I14.CD1 and P38.CG neighbor-bump: 2.32994 Ang N37.ND2 and P38.CG other bump:2.32 Ang I14.CG1 and P38.CB other bump:1.19405 Ang I14.CD1 and P38.CB other bump:2.59614 Ang I14.CG1 and P38.CA other bump:1.85842 Ang I14.CD1 and P38.CA neighbor-bump: 2.38505 Ang I35.CG1 and Y36.N other bump:2.69611 Ang P7.C and I35.CD1 other bump:1.63428 Ang P7.O and I35.CD1 other bump:2.95009 Ang T6.CA and I35.CG2 self-bump: 1.39387 Ang I35.CA and I35.CB other bump:3.0114 Ang E17.OE2 and V31.CG1 other bump:2.39848 Ang L25.CA and M29.CE other bump:2.59064 Ang L25.C and M29.CE other bump:1.33025 Ang L25.CB and M29.CE other bump:2.29102 Ang L25.CG and M29.CE other bump:2.92429 Ang L25.CD2 and M29.CE other bump:2.71333 Ang R26.N and M29.SD other bump:2.69635 Ang L25.CA and M29.SD other bump:2.16439 Ang L25.CB and M29.SD other bump:2.33954 Ang L25.CG and M29.SD other bump:1.91048 Ang E17.CD and K21.NZ other bump:1.53353 Ang E17.OE1 and K21.NZ other bump:2.13313 Ang E17.CG and K21.NZ other bump:2.31497 Ang E17.OE1 and K21.CE other bump:2.60013 Ang E17.CG and K21.CE other bump:3.03277 Ang E17.CB and K21.CD other bump:2.71912 Ang E17.CG and K21.CD other bump:3.05331 Ang E17.CA and K21.CD other bump:2.2003 Ang V16.O and P18.CD other bump:2.58152 Ang V16.C and P18.CD neighbor-bump: 3.11576 Ang I14.CG2 and D15.CG neighbor-bump: 3.13266 Ang I14.CG2 and D15.CA neighbor-bump: 2.0031 Ang I14.CG2 and D15.N self-bump: 2.38698 Ang I14.CG2 and I14.C self-bump: 1.32148 Ang I14.CA and I14.CB neighbor-bump: 2.24617 Ang T6.N and P7.CD Number of specific fragments= 5 total=347 Number of alignments=60 # 1edoA read from T0191.t2k-2track-undertaker.a2m # adding 1edoA to template set 1edoA:# found chain 1edoA in template set T0191 24 :KNIVIYGAG 1edoA 18 :PVVVVTGAS Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues T0191 33 :GAARAVAFELAK 1edoA 28 :GIGKAIALSLGK Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:2.85177 Ang R5.NH1 and F9.CE1 T0191 45 :DNNIII 1edoA 41 :GCKVLV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 8 residues T0191 51 :ANRTVEKAEALAKEIAEKLNKKFGEEVKFSGLDVD 1edoA 48 :YARSAKAAEEVSKQIEAYGGQAITFGGDVSKEADV Fragment has 53 clashes (null) has 53 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 37 residues other bump:3.0866 Ang V28.CG2 and V35.C other bump:2.96087 Ang V28.CA and V35.CG1 other bump:2.21892 Ang V28.CB and V35.CG1 other bump:3.07913 Ang V28.C and V35.CG1 other bump:0.777416 Ang V28.CG2 and V35.CG1 other bump:2.86424 Ang K29.N and V35.CG1 other bump:3.09745 Ang V28.CG1 and V35.CG1 other bump:2.12838 Ang V28.CG2 and V35.CB other bump:2.85766 Ang V28.CG2 and V35.CA other bump:2.22555 Ang K29.CE and S31.OG other bump:2.30235 Ang V6.CG1 and E27.OE1 other bump:1.51354 Ang A13.N and K23.NZ other bump:1.31621 Ang A13.CA and K23.NZ other bump:2.70516 Ang A13.CB and K23.NZ other bump:2.15551 Ang A13.O and K23.NZ other bump:1.19559 Ang A13.C and K23.NZ other bump:1.75642 Ang K14.N and K23.NZ other bump:1.81268 Ang L12.O and K23.NZ other bump:1.77245 Ang L12.C and K23.NZ other bump:2.33803 Ang A13.N and K23.CE other bump:1.04969 Ang A13.CA and K23.CE other bump:2.14816 Ang A13.CB and K23.CE other bump:1.52031 Ang A13.O and K23.CE other bump:1.17922 Ang A13.C and K23.CE other bump:2.47301 Ang K14.N and K23.CE other bump:2.94985 Ang L12.C and K23.CE other bump:2.49967 Ang A13.N and K23.CD other bump:1.54649 Ang A13.CA and K23.CD other bump:2.23438 Ang A13.CB and K23.CD other bump:2.64455 Ang A13.C and K23.CD other bump:3.18954 Ang L12.C and K23.CD other bump:2.74454 Ang A13.CA and K23.CG other bump:2.6642 Ang A13.CB and K23.CG other bump:2.76393 Ang I16.CG2 and N21.CB other bump:2.6072 Ang E15.CB and E18.OE2 other bump:2.11322 Ang E15.CA and E18.OE2 other bump:2.64944 Ang E15.C and E18.OE2 other bump:1.80411 Ang K14.O and E18.OE1 other bump:2.3355 Ang K14.C and E18.OE1 other bump:1.9837 Ang E15.CA and E18.OE1 other bump:2.37468 Ang E15.C and E18.OE1 other bump:2.26389 Ang E15.CA and E18.CD other bump:2.22141 Ang E15.O and E18.CD other bump:2.5507 Ang E15.C and E18.CD other bump:2.3273 Ang V6.O and E10.OE2 other bump:1.22741 Ang V6.O and E10.OE1 other bump:2.48923 Ang E7.CA and E10.OE1 other bump:2.09272 Ang V6.C and E10.OE1 other bump:1.94364 Ang V6.O and E10.CD other bump:2.84525 Ang V6.C and E10.CD neighbor-bump: 2.83923 Ang N3.OD1 and R4.CA neighbor-bump: 1.86555 Ang N3.OD1 and R4.N self-bump: 1.35628 Ang N3.CA and N3.CB T0191 86 :LDGVDIIINATPIGMYPNID 1edoA 93 :WGTIDVVVNNAGITRDTLLI Fragment has 14 clashes (null) has 14 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 22 residues neighbor-bump: 2.23538 Ang Y17.O and P18.CD neighbor-bump: 1.5168 Ang Y17.C and P18.CD other bump:2.46704 Ang M16.O and P18.CD neighbor-bump: 2.33526 Ang Y17.CA and P18.CD neighbor-bump: 2.75662 Ang Y17.C and P18.CG neighbor-bump: 2.09453 Ang T12.CA and P13.CD other bump:1.89402 Ang A11.O and P13.CD other bump:2.59859 Ang A11.C and P13.CD neighbor-bump: 2.16241 Ang T12.O and P13.CD neighbor-bump: 1.35871 Ang T12.C and P13.CD other bump:2.21814 Ang A11.O and P13.CG other bump:3.14245 Ang A11.C and P13.CG neighbor-bump: 2.22669 Ang T12.O and P13.CG neighbor-bump: 2.22461 Ang T12.C and P13.CG Number of specific fragments= 5 total=352 Number of alignments=61 # 1ff9A read from T0191.t2k-2track-undertaker.a2m # found chain 1ff9A in template set T0191 23 :DKNIVIYGAGGAARAVAFELAK 1ff9A 3 :TKSVLMLGSGFVTRPTLDVLTD Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 24 residues other bump:2.47698 Ang I5.CD1 and L21.CD1 other bump:2.82716 Ang R15.CG and F19.CZ other bump:2.38157 Ang R15.NE and F19.CZ other bump:2.87952 Ang R15.CG and F19.CE2 other bump:2.99735 Ang R15.CD and F19.CE2 other bump:2.27429 Ang R15.NE and F19.CE2 other bump:3.12943 Ang R15.CZ and F19.CE2 other bump:2.44894 Ang V6.CG1 and Y8.OH other bump:2.57918 Ang V6.CG1 and Y8.CZ other bump:2.81169 Ang V6.CG1 and Y8.CE1 T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKK 1ff9A 26 :GIKVTVACRTLESAKKLSAGVQHSTPIS Fragment has 33 clashes (null) has 33 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 30 residues other bump:3.08149 Ang T11.C and K29.CD other bump:2.61092 Ang R10.O and K29.CD other bump:2.96438 Ang T11.CA and K29.CD other bump:2.72308 Ang V12.N and K29.CD other bump:2.85131 Ang V12.N and K29.CG other bump:2.1743 Ang V12.CG2 and K29.CG other bump:2.31532 Ang I7.CG1 and N27.OD1 other bump:2.59361 Ang I7.CD1 and N27.OD1 other bump:2.4925 Ang A19.CB and N27.OD1 other bump:2.5622 Ang A19.CB and N27.ND2 other bump:2.84903 Ang A19.CB and N27.CG other bump:2.50901 Ang A15.O and N27.CG other bump:2.93406 Ang A15.C and N27.CG other bump:2.70886 Ang I7.CB and K25.NZ other bump:1.44641 Ang I7.CG1 and K25.NZ other bump:1.84148 Ang I7.CD1 and K25.NZ other bump:2.44083 Ang A19.CB and K25.NZ other bump:2.59486 Ang I7.CG1 and K25.CE other bump:1.96902 Ang I7.CD1 and K25.CE other bump:2.3557 Ang A19.CA and K25.CE other bump:1.50683 Ang A19.CB and K25.CE other bump:2.579 Ang A19.CA and K25.CD other bump:1.92171 Ang A19.CB and K25.CD other bump:2.50739 Ang E16.O and K20.CG other bump:2.94247 Ang I7.CD1 and A19.CB other bump:2.39144 Ang N9.ND2 and K14.NZ other bump:2.20145 Ang N9.ND2 and K14.CE other bump:1.44098 Ang N9.ND2 and K14.CD other bump:2.27746 Ang N9.CG and K14.CD other bump:2.57192 Ang N9.OD1 and K14.CD other bump:2.17406 Ang N9.ND2 and K14.CG other bump:2.75282 Ang N9.CG and K14.CG other bump:2.80008 Ang N9.CG and K14.CB T0191 74 :GEEVKFSGLDVDLDGVDIIINAT 1ff9A 54 :LDVNDDAALDAEVAKHDLVISLI Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 25 residues other bump:2.58717 Ang V17.CG1 and I19.O neighbor-bump: 2.44145 Ang D18.O and I19.CG2 other bump:2.8004 Ang V17.CG1 and I19.N other bump:2.75038 Ang E4.OE1 and L10.CD1 T0191 101 :YP 1ff9A 81 :HA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues T0191 108 :PIVKAEKLREDMVVMDLIYNPLETVLLKEAKKVNAKTINGLG 1ff9A 83 :TVIKSAIRQKKHVVTTSYVSPAMMELDQAAKDAGITVMNEIG Fragment has 34 clashes (null) has 34 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 44 residues other bump:3.03577 Ang M16.SD and N40.OD1 other bump:2.11026 Ang Y20.CD1 and N40.ND2 other bump:0.90171 Ang Y20.CE1 and N40.ND2 other bump:3.1025 Ang Y20.CE2 and N40.ND2 other bump:1.83973 Ang Y20.CZ and N40.ND2 other bump:2.3193 Ang Y20.OH and N40.ND2 other bump:2.66217 Ang Y20.CD1 and N40.CG other bump:1.70604 Ang Y20.CE1 and N40.CG other bump:2.6386 Ang Y20.OH and N40.CG other bump:3.03911 Ang Y20.CD1 and N40.CB other bump:2.28734 Ang Y20.CE1 and N40.CB other bump:2.93095 Ang Y20.CE2 and N40.CB other bump:2.21507 Ang Y20.CZ and N40.CB other bump:2.55247 Ang Y20.OH and N40.CB other bump:2.91574 Ang Y20.CZ and N40.CA other bump:2.51191 Ang Y20.OH and N40.CA other bump:2.70621 Ang Y20.CZ and N40.N other bump:1.65958 Ang Y20.OH and N40.N other bump:2.63681 Ang Y20.OH and I39.C other bump:2.6489 Ang K8.NZ and L27.CD2 other bump:2.87968 Ang K8.NZ and L27.CD1 other bump:2.30564 Ang K8.NZ and L27.CG other bump:2.76483 Ang K8.CE and L27.CB other bump:1.42576 Ang K8.NZ and L27.CB other bump:2.4554 Ang K8.NZ and L27.CA other bump:2.54715 Ang P22.O and V26.CG2 other bump:2.88229 Ang M16.CE and L18.CD1 other bump:2.76847 Ang E7.CG and V14.CG2 other bump:2.39354 Ang I3.O and E7.OE2 other bump:0.955899 Ang I3.O and E7.OE1 other bump:1.85571 Ang I3.C and E7.OE1 other bump:2.57732 Ang V4.CA and E7.OE1 other bump:1.86853 Ang I3.O and E7.CD other bump:2.75978 Ang I3.C and E7.CD Number of specific fragments= 5 total=357 Number of alignments=62 # 1fmcA read from T0191.t2k-2track-undertaker.a2m # found chain 1fmcA in template set T0191 18 :IGRVKDKNIVIYGAG 1fmcA 6 :NLRLDGKCAIITGAG Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 17 residues other bump:2.64343 Ang R4.NE and K6.CE T0191 33 :GAARAVAFELAK 1fmcA 22 :GIGKEIAITFAT Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:3.07616 Ang R5.CG and F9.CZ other bump:2.16023 Ang R5.NH1 and F9.CE1 T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGLDVD 1fmcA 35 :GASVVVSDINADAANHVVDEIQQLGGQAFACRCDITSEQEL Fragment has 43 clashes (null) has 43 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 43 residues other bump:2.97946 Ang V34.CG1 and V41.CG1 other bump:2.88234 Ang K35.N and V41.CG1 other bump:2.33425 Ang R10.NH2 and K35.NZ other bump:2.75278 Ang R10.NE and K35.NZ other bump:2.46903 Ang R10.CZ and K35.NZ other bump:3.08942 Ang R10.CZ and K35.CD other bump:2.95333 Ang R10.CG and K35.CG other bump:2.89546 Ang E32.CG and V34.CG2 other bump:2.95631 Ang E32.CD and V34.CG2 other bump:2.52883 Ang E32.OE1 and V34.CG2 other bump:2.86069 Ang V12.CG1 and E33.OE2 other bump:2.61053 Ang V12.CA and E33.OE1 other bump:2.12323 Ang V12.CB and E33.OE1 other bump:1.46015 Ang V12.CG1 and E33.OE1 other bump:2.53367 Ang V12.CG2 and E33.OE1 other bump:1.97801 Ang V12.CG1 and E33.CD other bump:2.64474 Ang V12.CG1 and E33.CG other bump:2.71105 Ang V12.CG1 and E33.CB other bump:1.97712 Ang A19.CA and K29.NZ other bump:2.04116 Ang A19.C and K29.NZ other bump:1.21907 Ang L18.O and K29.NZ other bump:1.90229 Ang L18.C and K29.NZ other bump:2.2055 Ang A19.N and K29.NZ other bump:2.78468 Ang I22.CB and K29.CE other bump:1.88544 Ang A19.CA and K29.CE other bump:1.93764 Ang A19.O and K29.CE other bump:2.1214 Ang A19.C and K29.CE other bump:2.39855 Ang A19.CA and K29.CD other bump:3.07583 Ang A19.CB and K29.CD other bump:3.22948 Ang A19.CA and K29.CG other bump:2.40177 Ang N4.CG and K28.CD other bump:2.4606 Ang N4.ND2 and K28.CD other bump:2.51844 Ang N4.OD1 and K28.CD other bump:2.58373 Ang N4.OD1 and K28.CB other bump:2.74316 Ang K25.CB and N27.ND2 other bump:3.03038 Ang I22.CG2 and N27.CG other bump:2.24775 Ang I22.CG2 and N27.CB other bump:2.72754 Ang I5.CD1 and I22.CD1 other bump:3.0841 Ang I7.CD1 and L18.CB other bump:2.37256 Ang N9.CG and T11.OG1 other bump:1.43799 Ang N9.OD1 and T11.OG1 other bump:2.57783 Ang N9.OD1 and T11.CB other bump:2.93639 Ang I5.CD1 and I7.CG2 T0191 86 :LDGVDIIINATPIGMYPNIDVEP 1fmcA 86 :LGKVDILVNNAGGGGPKPFDMPM Fragment has 16 clashes (null) has 16 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 25 residues other bump:2.34456 Ang N19.O and V22.CG2 neighbor-bump: 2.55885 Ang G15.O and M16.CG neighbor-bump: 2.03735 Ang G15.O and M16.CB neighbor-bump: 2.51066 Ang G15.C and M16.CB neighbor-bump: 2.44956 Ang P13.C and I14.CG2 neighbor-bump: 1.51342 Ang P13.O and I14.CG2 neighbor-bump: 2.20267 Ang T12.O and P13.CD neighbor-bump: 2.49281 Ang T12.N and P13.CD other bump:1.94137 Ang A11.O and P13.CD other bump:2.4874 Ang A11.C and P13.CD neighbor-bump: 1.87871 Ang T12.CA and P13.CD neighbor-bump: 1.3343 Ang T12.C and P13.CD other bump:2.07084 Ang A11.O and P13.CG other bump:2.9735 Ang A11.C and P13.CG neighbor-bump: 2.35092 Ang T12.C and P13.CG self-bump: 1.36654 Ang D3.CA and D3.CB Number of specific fragments= 4 total=361 Number of alignments=63 # 1g0oA read from T0191.t2k-2track-undertaker.a2m # found chain 1g0oA in template set T0191 18 :IGRVKDKNIVIYGAG 1g0oA 24 :SASLEGKVALVTGAG Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 17 residues other bump:2.89438 Ang I12.CG1 and A15.CB other bump:3.00792 Ang I12.CD1 and A15.CB T0191 33 :GAARAVAFELAK 1g0oA 40 :GIGREMAMELGR Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:2.55297 Ang R5.NE and F9.CZ other bump:2.70148 Ang R5.NE and F9.CE2 T0191 45 :DNNIIIANRT 1g0oA 53 :GCKVIVNYAN Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 12 residues other bump:2.89591 Ang N3.CG and I5.CG2 other bump:1.87682 Ang N3.OD1 and I5.CG2 neighbor-bump: 2.64326 Ang N3.CG and N4.O T0191 55 :VEKAEALAKEIAEKLNKKFGEEVK 1g0oA 64 :TESAEEVVAAIKKNGSDAACVKAN Fragment has 27 clashes (null) has 27 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 26 residues neighbor-bump: 2.53664 Ang E23.O and V24.CG2 neighbor-bump: 2.91904 Ang E23.C and V24.CG2 other bump:3.0445 Ang K18.CG and F20.CE2 other bump:2.88373 Ang K18.CD and F20.CE2 other bump:1.76238 Ang L8.O and K19.NZ other bump:1.72085 Ang A9.O and K19.NZ other bump:1.24139 Ang A9.C and K19.NZ other bump:1.78859 Ang K10.N and K19.NZ other bump:2.68903 Ang K10.CA and K19.NZ other bump:2.72142 Ang K10.C and K19.NZ other bump:2.18664 Ang L8.C and K19.NZ other bump:2.27884 Ang A9.N and K19.NZ other bump:1.99971 Ang A9.CA and K19.NZ other bump:0.892189 Ang A9.O and K19.CE other bump:1.13665 Ang A9.C and K19.CE other bump:2.42999 Ang K10.N and K19.CE other bump:2.80158 Ang A9.N and K19.CE other bump:1.7045 Ang A9.CA and K19.CE other bump:2.85676 Ang A9.CB and K19.CE other bump:2.37089 Ang A9.O and K19.CD other bump:2.31453 Ang A9.C and K19.CD other bump:3.11559 Ang L8.C and K19.CD other bump:2.61941 Ang A9.N and K19.CD other bump:1.6005 Ang A9.CA and K19.CD other bump:2.60367 Ang A9.CB and K19.CD other bump:2.60469 Ang A9.CA and K19.CG other bump:2.76879 Ang A9.CB and K19.CG T0191 79 :FSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEK 1g0oA 98 :FEEAVKIFGKLDIVCSNSGVVSFGHVKDVTPEEFDR Fragment has 35 clashes (null) has 35 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 38 residues other bump:2.37608 Ang I27.N and E30.OE2 other bump:2.51178 Ang I27.CA and E30.OE2 other bump:2.35461 Ang P25.O and E30.OE2 other bump:2.34704 Ang N26.O and E30.OE2 other bump:2.32965 Ang N26.C and E30.OE2 other bump:2.13596 Ang I27.CA and E30.OE1 other bump:1.73857 Ang I27.O and E30.OE1 other bump:2.05527 Ang I27.C and E30.OE1 other bump:2.63719 Ang I27.CA and E30.CD other bump:2.56776 Ang N26.O and E30.CD other bump:3.01843 Ang N26.C and E30.CD other bump:3.03773 Ang I27.C and E30.CD other bump:1.93716 Ang N26.CG and D28.OD1 other bump:1.04739 Ang N26.OD1 and D28.OD1 other bump:2.52507 Ang N26.CB and D28.OD1 other bump:3.08343 Ang N26.CG and D28.CG other bump:2.05097 Ang N26.OD1 and D28.CG neighbor-bump: 2.14723 Ang Y24.CA and P25.CD neighbor-bump: 1.17253 Ang Y24.C and P25.CD neighbor-bump: 2.67401 Ang Y24.N and P25.CD neighbor-bump: 1.71695 Ang Y24.O and P25.CD neighbor-bump: 2.42334 Ang Y24.C and P25.CG neighbor-bump: 2.30052 Ang Y24.O and P25.CG neighbor-bump: 2.66074 Ang Y24.C and P25.CB other bump:2.00428 Ang A18.O and P20.CD other bump:2.67516 Ang A18.C and P20.CD neighbor-bump: 2.23067 Ang T19.O and P20.CD neighbor-bump: 1.39114 Ang T19.C and P20.CD neighbor-bump: 2.05447 Ang T19.CA and P20.CD other bump:2.1161 Ang A18.O and P20.CG other bump:3.10166 Ang A18.C and P20.CG neighbor-bump: 2.26627 Ang T19.O and P20.CG neighbor-bump: 2.21941 Ang T19.C and P20.CG other bump:2.53114 Ang D6.OD1 and V12.CG2 self-bump: 1.37974 Ang D8.CA and D8.CB Number of specific fragments= 5 total=366 Number of alignments=64 # 1gcoA read from T0191.t2k-2track-undertaker.a2m # found chain 1gcoA in template set T0191 18 :IGRVKDKNIVIYGAG 1gcoA 2 :YKDLEGKVVVITGSS Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 17 residues T0191 33 :GAARAVAFELAK 1gcoA 18 :GLGKSMAIRFAT Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:2.87008 Ang R5.CZ and F9.CE1 other bump:3.00356 Ang R5.NH1 and F9.CE1 T0191 45 :DNNIIIANRT 1gcoA 31 :KAKVVVNYRS Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 12 residues T0191 55 :VEKAEALAKEIAEKLNKKFGEEVK 1gcoA 42 :EDEANSVLEEIKKVGGEAIAVKGD Fragment has 13 clashes (null) has 13 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 26 residues neighbor-bump: 2.01798 Ang E23.O and V24.CG2 neighbor-bump: 2.6733 Ang E23.C and V24.CG2 other bump:2.65146 Ang F20.CD1 and E22.OE1 other bump:1.88263 Ang F20.CE1 and E22.OE1 other bump:2.362 Ang I12.CD1 and K19.CD other bump:2.4516 Ang I12.CG2 and N17.CB other bump:1.84065 Ang V2.CG1 and E6.OE2 other bump:1.35685 Ang V2.O and E6.OE1 other bump:2.11145 Ang V2.C and E6.OE1 other bump:2.53126 Ang E3.CA and E6.OE1 other bump:2.18372 Ang V2.O and E6.CD other bump:2.89094 Ang V2.CG1 and E6.CD other bump:2.94427 Ang V2.C and E6.CD T0191 79 :FSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEK 1gcoA 76 :VQSAIKEFGKLDVMINNAGLENPVSSHEMSLSDWNK Fragment has 20 clashes (null) has 20 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 38 residues other bump:2.86835 Ang M23.SD and K34.NZ other bump:1.67756 Ang M23.CE and K34.NZ other bump:2.46613 Ang M23.CE and K34.CE other bump:2.84546 Ang M23.CE and K34.CD other bump:2.54557 Ang M23.CE and K34.CG other bump:2.13072 Ang E30.OE1 and K34.CB other bump:3.1597 Ang E30.CD and K34.CB other bump:2.37172 Ang P25.CG and E30.OE2 other bump:2.32049 Ang N26.OD1 and D28.OD1 neighbor-bump: 1.84247 Ang Y24.C and P25.CD other bump:2.04431 Ang A18.O and P20.CD other bump:2.68745 Ang A18.C and P20.CD neighbor-bump: 2.0173 Ang T19.CA and P20.CD neighbor-bump: 1.34732 Ang T19.C and P20.CD neighbor-bump: 2.17567 Ang T19.O and P20.CD other bump:2.25246 Ang A18.O and P20.CG other bump:3.14177 Ang A18.C and P20.CG neighbor-bump: 2.21059 Ang T19.C and P20.CG neighbor-bump: 2.24062 Ang T19.O and P20.CG other bump:3.08723 Ang F2.CE2 and V12.CG1 Number of specific fragments= 5 total=371 Number of alignments=65 # 1gegA read from T0191.t2k-2track-undertaker.a2m # found chain 1gegA in template set T0191 24 :KNIVIYGAG 1gegA 3 :KVALVTGAG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues T0191 33 :GAARAVAFELAK 1gegA 13 :GIGKAIALRLVK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGLDVD 1gegA 26 :GFAVAIADYNDATAKAVASEINQAGGHAVAVKVDVSDRDQV Fragment has 32 clashes (null) has 32 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 43 residues other bump:2.61574 Ang V34.CG2 and V41.CG1 other bump:2.09426 Ang V12.CG1 and E33.OE2 other bump:2.9359 Ang V12.CG1 and E33.CD other bump:1.10458 Ang L18.O and K29.NZ other bump:2.92713 Ang I22.CG1 and K29.NZ other bump:2.43746 Ang A19.N and K29.NZ other bump:2.30579 Ang A19.CA and K29.NZ other bump:2.13947 Ang A19.C and K29.NZ other bump:1.97321 Ang L18.C and K29.NZ other bump:2.51833 Ang I22.CB and K29.CE other bump:2.97804 Ang I22.CG1 and K29.CE other bump:2.01908 Ang A19.CA and K29.CE other bump:1.64907 Ang A19.O and K29.CE other bump:1.91244 Ang A19.C and K29.CE other bump:3.07408 Ang L18.C and K29.CE other bump:3.23272 Ang I22.CG1 and K29.CD other bump:2.81068 Ang I22.CD1 and K29.CD other bump:2.93745 Ang A19.N and K29.CD other bump:2.03154 Ang A19.CA and K29.CD other bump:2.84717 Ang A19.C and K29.CD other bump:2.89385 Ang A19.CB and K29.CD other bump:2.80244 Ang A19.CA and K29.CG other bump:2.92437 Ang A19.CB and K29.CG other bump:2.87953 Ang N4.CG and K28.CD other bump:2.56843 Ang N4.ND2 and K28.CD other bump:2.69794 Ang N4.OD1 and K28.CB other bump:2.78354 Ang I22.CG2 and N27.ND2 other bump:2.83123 Ang I22.CG2 and N27.CG other bump:2.55965 Ang I22.CG2 and N27.CB other bump:2.12886 Ang N9.CG and T11.OG1 other bump:1.26249 Ang N9.OD1 and T11.OG1 other bump:2.40651 Ang N9.OD1 and T11.CB T0191 86 :LDGVDIIINATPIGMYPNIDVEPIVKAEK 1gegA 77 :LGGFDVIVNNAGVAPSTPIESITPEIVDK Fragment has 26 clashes (null) has 26 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 31 residues other bump:1.89471 Ang I25.CG1 and E29.OE2 other bump:2.18272 Ang I25.CD1 and E29.OE2 other bump:2.42293 Ang I25.O and E29.OE2 other bump:2.78434 Ang V26.CA and E29.OE1 other bump:0.976067 Ang I25.O and E29.OE1 other bump:1.92808 Ang I25.C and E29.OE1 other bump:2.95778 Ang I25.CG1 and E29.CD other bump:1.88106 Ang I25.O and E29.CD other bump:2.81622 Ang I25.C and E29.CD other bump:2.63461 Ang M16.SD and K27.NZ other bump:1.56368 Ang M16.CE and K27.NZ other bump:2.88386 Ang M16.CE and K27.CE other bump:2.92791 Ang P24.CG and K27.CD other bump:2.6561 Ang P24.CD and K27.CD other bump:2.95736 Ang P24.CG and K27.CG neighbor-bump: 1.99253 Ang Y17.C and P18.CD neighbor-bump: 2.49673 Ang Y17.C and P18.CG other bump:2.01595 Ang A11.O and P13.CD other bump:2.66032 Ang A11.C and P13.CD neighbor-bump: 2.15168 Ang T12.O and P13.CD neighbor-bump: 2.00296 Ang T12.CA and P13.CD neighbor-bump: 1.32553 Ang T12.C and P13.CD other bump:2.23158 Ang A11.O and P13.CG other bump:3.13336 Ang A11.C and P13.CG neighbor-bump: 2.2263 Ang T12.O and P13.CG neighbor-bump: 2.20272 Ang T12.C and P13.CG Number of specific fragments= 4 total=375 Number of alignments=66 # 1gpjA read from T0191.t2k-2track-undertaker.a2m # found chain 1gpjA in template set T0191 1 :IGYNTDGIGARMALEEEIGRVKDKNIVIYGAGGAARAVAFELAK 1gpjA 145 :EGAVSIGSAAVELAERELGSLHDKTVLVVGAGEMGKTVAKSLVD Fragment has 76 clashes (null) has 76 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 45 residues other bump:2.32562 Ang L14.CD1 and L42.CD2 other bump:2.26175 Ang R11.NH1 and E41.C other bump:2.70446 Ang R11.CD and E41.O other bump:2.20049 Ang R11.NH1 and E41.O other bump:1.16878 Ang A37.O and E41.OE1 other bump:2.12325 Ang A37.C and E41.OE1 other bump:2.71002 Ang V38.CA and E41.OE1 other bump:3.06491 Ang G7.CA and E41.CD other bump:2.03305 Ang A37.O and E41.CD other bump:2.97567 Ang A37.C and E41.CD other bump:3.08232 Ang G7.CA and E41.CG other bump:3.24563 Ang G7.C and E41.CG other bump:2.83406 Ang R11.CZ and E41.CB other bump:1.98869 Ang R11.NH1 and E41.CB other bump:1.91041 Ang R11.NH1 and E41.CA other bump:2.71694 Ang Y3.CB and M12.SD other bump:1.83398 Ang I8.CD1 and R11.NH2 other bump:2.88577 Ang Y3.CG and G9.CA other bump:2.27855 Ang Y3.CD2 and G9.CA other bump:2.62641 Ang Y3.CE2 and G9.CA other bump:2.16413 Ang Y3.CG and G9.N other bump:1.652 Ang Y3.CD2 and G9.N other bump:2.49919 Ang Y3.CD1 and G9.N other bump:2.44228 Ang Y3.CE1 and G9.N other bump:1.55884 Ang Y3.CE2 and G9.N other bump:2.00811 Ang Y3.CZ and G9.N other bump:2.1123 Ang Y3.CG and I8.C other bump:2.42046 Ang Y3.CD2 and I8.C other bump:3.29349 Ang Y3.CB and I8.C other bump:1.75321 Ang Y3.CD1 and I8.C other bump:1.78431 Ang Y3.CE1 and I8.C other bump:2.44556 Ang Y3.CE2 and I8.C other bump:2.14011 Ang Y3.CZ and I8.C other bump:2.61852 Ang Y3.CG and I8.O other bump:2.31189 Ang Y3.CD1 and I8.O other bump:3.14929 Ang Y3.CA and I8.CG2 other bump:2.30031 Ang Y3.CG and I8.CG2 other bump:2.78818 Ang Y3.CB and I8.CG2 other bump:1.35201 Ang Y3.CD1 and I8.CG2 other bump:2.34648 Ang Y3.CE1 and I8.CG2 other bump:2.74217 Ang Y3.CD1 and I8.CG1 other bump:2.23779 Ang Y3.CE1 and I8.CG1 other bump:2.40368 Ang Y3.CG and I8.CB other bump:3.10444 Ang Y3.CD2 and I8.CB other bump:1.23883 Ang Y3.CD1 and I8.CB other bump:1.12483 Ang Y3.CE1 and I8.CB other bump:3.069 Ang Y3.CE2 and I8.CB other bump:2.26274 Ang Y3.CZ and I8.CB other bump:2.71932 Ang Y3.CG and I8.CA other bump:3.12305 Ang Y3.CD2 and I8.CA other bump:2.512 Ang Y3.OH and I8.CA other bump:1.62932 Ang Y3.CD1 and I8.CA other bump:0.665591 Ang Y3.CE1 and I8.CA other bump:2.75622 Ang Y3.CE2 and I8.CA other bump:1.68541 Ang Y3.CZ and I8.CA other bump:1.15168 Ang Y3.OH and I8.N other bump:2.83655 Ang Y3.CD1 and I8.N other bump:1.48594 Ang Y3.CE1 and I8.N other bump:2.57477 Ang Y3.CE2 and I8.N other bump:1.20467 Ang Y3.CZ and I8.N other bump:1.5461 Ang Y3.OH and G7.C other bump:2.68496 Ang Y3.CE1 and G7.C other bump:3.2778 Ang Y3.CE2 and G7.C other bump:2.19595 Ang Y3.CZ and G7.C other bump:1.81848 Ang Y3.OH and G7.CA other bump:3.05225 Ang Y3.CZ and G7.CA other bump:1.8189 Ang Y3.OH and G7.N other bump:2.96188 Ang Y3.CZ and G7.N other bump:2.54751 Ang Y3.OH and D6.C other bump:3.11491 Ang Y3.CE2 and D6.C other bump:3.21493 Ang Y3.CZ and D6.C other bump:2.49392 Ang Y3.CE2 and T5.C other bump:3.13648 Ang Y3.CZ and T5.C other bump:2.21115 Ang Y3.CD2 and T5.O other bump:1.32678 Ang Y3.CE2 and T5.O other bump:2.27616 Ang Y3.CZ and T5.O T0191 45 :DN 1gpjA 190 :GV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues T0191 47 :NIIIANRTVEKAEALAKEIA 1gpjA 193 :AVLVANRTYERAVELARDLG Fragment has 19 clashes (null) has 19 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 22 residues other bump:3.28619 Ang I3.CG1 and G22.CA neighbor-bump: 2.2506 Ang I20.O and A21.CB neighbor-bump: 2.53375 Ang I20.C and A21.CB other bump:1.44539 Ang I3.CD1 and I20.CG2 other bump:2.89365 Ang I3.CG1 and I20.CG2 other bump:2.80691 Ang I3.CD1 and I20.CB other bump:2.49571 Ang I5.CD1 and A17.CB other bump:2.9766 Ang I5.CG1 and A17.CB other bump:2.28293 Ang I5.CD1 and A17.CA other bump:1.97413 Ang I5.CD1 and A17.N other bump:2.87382 Ang I5.CD1 and L16.C other bump:2.00721 Ang V10.CG1 and E14.OE2 other bump:2.40763 Ang E11.CA and E14.OE1 other bump:1.64561 Ang V10.O and E14.OE1 other bump:2.29284 Ang V10.C and E14.OE1 other bump:2.41272 Ang V10.O and E14.CD other bump:2.99826 Ang V10.CG1 and E14.CD other bump:3.1113 Ang V10.C and E14.CD other bump:2.66759 Ang I5.CD1 and A13.O T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLR 1gpjA 213 :GEAVRFDELVDHLARSDVVVSATAAPHPVIHVDDVREALRKRD Fragment has 44 clashes (null) has 44 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 45 residues other bump:2.86372 Ang D15.CG and L43.CD2 other bump:2.2607 Ang D15.OD2 and L43.CD2 other bump:2.76557 Ang D15.C and L43.CD1 other bump:1.73614 Ang D15.O and L43.CD1 other bump:2.79188 Ang D15.OD1 and L43.CD1 other bump:2.34312 Ang D15.CG and L43.CG other bump:2.41345 Ang D15.OD2 and L43.CG other bump:2.13139 Ang D15.OD1 and L43.CG other bump:1.94768 Ang D15.OD1 and K39.O other bump:0.500343 Ang L14.O and K39.NZ other bump:2.52873 Ang L14.CA and K39.NZ other bump:1.14865 Ang L14.C and K39.NZ other bump:2.20145 Ang D15.CA and K39.NZ other bump:2.34434 Ang D15.C and K39.NZ other bump:1.87788 Ang D15.N and K39.NZ other bump:2.89342 Ang D13.C and K39.CE other bump:2.22774 Ang L14.N and K39.CE other bump:1.51092 Ang L14.O and K39.CE other bump:1.18933 Ang L14.CA and K39.CE other bump:2.11486 Ang L14.CB and K39.CE other bump:0.373084 Ang L14.C and K39.CE other bump:2.63342 Ang D15.CA and K39.CE other bump:1.44807 Ang D15.N and K39.CE other bump:3.02821 Ang L14.CG and K39.CD other bump:2.51902 Ang L14.O and K39.CD other bump:1.94455 Ang L14.CA and K39.CD other bump:1.51814 Ang L14.CB and K39.CD other bump:1.75693 Ang L14.C and K39.CD other bump:3.0843 Ang D15.CA and K39.CD other bump:2.10043 Ang D15.N and K39.CD other bump:2.9058 Ang L14.CB and K39.CG other bump:2.58549 Ang L14.C and K39.CG other bump:2.49827 Ang D15.CA and K39.CG other bump:2.11939 Ang D15.N and K39.CG other bump:3.04697 Ang D15.CB and K39.CG other bump:1.67603 Ang I32.O and P36.CD other bump:2.89863 Ang I32.C and P36.CD other bump:3.08794 Ang D33.C and P36.CD other bump:2.47197 Ang I32.O and P36.CG self-bump: 1.39825 Ang D33.CA and D33.CB other bump:2.45711 Ang D13.O and V17.CG2 other bump:2.68119 Ang V5.CG2 and D13.OD2 other bump:2.80762 Ang G9.C and D13.OD1 other bump:2.0717 Ang G9.O and D13.OD1 T0191 117 :EDMVVMDLIYNPLETVLLKEAKKVNAKTINGLGMLIYQGAVAF 1gpjA 258 :SPILIIDIANPRDVEEGVENIEDVEVRTIDDLRVIARENLERR Fragment has 22 clashes (null) has 22 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 45 residues other bump:2.83524 Ang M7.SD and L33.CD1 other bump:2.96977 Ang K20.CG and A27.CB neighbor-bump: 2.17254 Ang V17.O and L18.CB neighbor-bump: 2.59256 Ang V17.C and L18.CB other bump:1.52281 Ang V6.CG2 and E15.OE2 other bump:2.68992 Ang V6.CB and E15.OE2 other bump:2.32514 Ang V6.CG2 and E15.CD other bump:2.77381 Ang I10.CG1 and L14.CD2 other bump:1.65862 Ang I10.CD1 and L14.CD2 other bump:2.57874 Ang I10.CG2 and L14.CD1 other bump:2.87153 Ang I10.CB and L14.CG other bump:2.00364 Ang I10.CG1 and L14.CG other bump:2.74877 Ang I10.CG2 and L14.CG other bump:1.505 Ang I10.CD1 and L14.CG other bump:2.79244 Ang I10.CG1 and L14.CB other bump:2.19287 Ang I10.CD1 and L14.CB other bump:3.09048 Ang I10.CG1 and L14.CA other bump:2.23387 Ang I10.CD1 and L14.CA other bump:2.55671 Ang I10.CG1 and L14.N other bump:2.30715 Ang I10.CD1 and L14.N other bump:2.96953 Ang I10.CD1 and P13.C other bump:2.76002 Ang M7.CE and L9.CD1 Number of specific fragments= 5 total=380 Number of alignments=67 # 1gtmA read from T0191.t2k-2track-undertaker.a2m # adding 1gtmA to template set 1gtmA:# found chain 1gtmA in template set T0191 6 :DGIGARMALEEEIGR 1gtmA 194 :ASYTIREAAKVLGWD Fragment has 9 clashes (null) has 9 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 17 residues self-bump: 1.39857 Ang R16.CA and R16.CB neighbor-bump: 2.8031 Ang E13.C and I14.CG1 neighbor-bump: 1.9373 Ang E13.O and I14.CB neighbor-bump: 2.40991 Ang E13.C and I14.CB other bump:2.14958 Ang M8.C and E12.OE1 other bump:1.24375 Ang M8.O and E12.OE1 other bump:3.12863 Ang M8.C and E12.CD other bump:2.19727 Ang M8.O and E12.CD neighbor-bump: 2.77071 Ang R7.NE and M8.CE T0191 21 :VKDKNIVIYGAGGAARAVAFELAK 1gtmA 210 :LKGKTIAIQGYGNAGYYLAKIMSE Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 26 residues other bump:2.67664 Ang I7.CD1 and L23.CD1 other bump:2.98367 Ang A12.CA and A16.CB other bump:2.74713 Ang G11.C and A16.CB other bump:3.13448 Ang A12.N and A16.CB other bump:2.14955 Ang G11.O and A16.CB T0191 45 :DNNIIIAN 1gtmA 236 :GMKVVAVS Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 10 residues neighbor-bump: 3.03969 Ang I6.C and I7.CG1 T0191 53 :RTVEKAEALAKEIAEKLNKKFGEEVKFSGLD 1gtmA 255 :LNADEVLKWKNEHGSVKDFPGATNITNEELL Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 33 residues other bump:2.96846 Ang L18.CD1 and E25.OE2 other bump:2.65044 Ang L18.CD1 and E25.CG neighbor-bump: 2.2079 Ang N19.O and K20.C neighbor-bump: 2.5999 Ang N19.C and K20.C self-bump: 1.31458 Ang L18.CA and L18.CB neighbor-bump: 2.31007 Ang K17.N and L18.N neighbor-bump: 2.22401 Ang I14.O and A15.CB neighbor-bump: 2.47032 Ang I14.C and A15.CB other bump:2.31857 Ang L10.CD2 and I14.CD1 other bump:3.25283 Ang A9.C and K12.N T0191 86 :LDGVDIIINATPIGMYP 1gtmA 286 :ELEVDVLAPAAIEEVIT Fragment has 16 clashes (null) has 16 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 19 residues neighbor-bump: 2.46022 Ang Y17.CA and P18.CD neighbor-bump: 2.13854 Ang Y17.C and P18.CD other bump:1.63312 Ang N10.CG and Y17.OH other bump:1.81837 Ang N10.ND2 and Y17.OH other bump:1.21508 Ang N10.OD1 and Y17.OH other bump:2.30173 Ang N10.CG and Y17.CZ other bump:2.8889 Ang N10.ND2 and Y17.CZ other bump:1.36985 Ang N10.OD1 and Y17.CZ other bump:2.95912 Ang N10.CB and Y17.CE2 other bump:2.33519 Ang N10.CG and Y17.CE2 other bump:1.56367 Ang N10.OD1 and Y17.CE2 other bump:2.7022 Ang N10.OD1 and Y17.CE1 neighbor-bump: 2.2689 Ang T12.CB and P13.CD neighbor-bump: 2.37973 Ang T12.CG2 and P13.CD neighbor-bump: 2.91312 Ang T12.CG2 and P13.CG self-bump: 1.37969 Ang T12.CA and T12.CB T0191 110 :VKAEKLREDMVVMDLIYNPLETVLLKEAKKVNAKTINGL 1gtmA 303 :KKNADNIKAKIVAEVANGPVTPEADEILFEKGILQIPDF Fragment has 28 clashes (null) has 28 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 41 residues other bump:2.65672 Ang R8.NH2 and A34.CB other bump:2.53201 Ang E28.O and V32.CG2 other bump:2.88664 Ang R8.NH2 and A29.CB other bump:2.81385 Ang E5.CG and E28.CB other bump:2.11139 Ang E5.CD and E28.CB other bump:1.81762 Ang E5.OE1 and E28.CB other bump:3.10772 Ang E5.CD and E28.CA other bump:2.90797 Ang E5.OE1 and E28.CA other bump:2.68039 Ang E5.CD and L25.C other bump:1.8072 Ang E5.OE2 and L25.C other bump:2.1998 Ang E5.CD and L25.O other bump:1.00666 Ang E5.OE2 and L25.O other bump:3.21363 Ang E5.CA and L25.CD2 other bump:1.67804 Ang G1.O and L25.CD2 other bump:1.85703 Ang G1.C and L25.CD2 other bump:2.4475 Ang E5.CB and L25.CD2 other bump:2.73379 Ang V2.N and L25.CD2 other bump:2.80692 Ang G1.C and L25.CD1 other bump:2.42744 Ang G1.C and L25.CG other bump:3.01604 Ang V2.N and L25.CG other bump:2.66688 Ang E5.CD and L25.CA other bump:2.39949 Ang E5.OE2 and L25.CA other bump:2.95207 Ang E5.OE1 and L25.CA other bump:2.7739 Ang I17.CG2 and P20.CG other bump:3.22464 Ang R8.CD and V13.CG2 other bump:3.04149 Ang R8.NE and V13.CG2 other bump:2.59808 Ang R8.CZ and V13.CG2 other bump:2.19465 Ang R8.NH1 and V13.CG2 Number of specific fragments= 6 total=386 Number of alignments=68 # 1guzA read from T0191.t2k-2track-undertaker.a2m # adding 1guzA to template set 1guzA:# found chain 1guzA in template set T0191 25 :NIVIYGAGGAARAVAFELAK 1guzA 2 :KITVIGAGNVGATTAFRLAE Fragment has 8 clashes (null) has 8 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 22 residues other bump:2.21065 Ang F17.CD2 and K21.NZ other bump:2.27475 Ang F17.CE2 and K21.NZ other bump:3.02883 Ang F17.CZ and K21.NZ other bump:2.64833 Ang I5.CD1 and A16.CB other bump:3.07093 Ang I5.CD1 and A16.CA other bump:2.65957 Ang I5.CD1 and A12.O other bump:1.84245 Ang G7.O and A12.CB other bump:2.92512 Ang G7.C and A12.CB T0191 45 :DN 1guzA 23 :QL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues T0191 47 :NIIIANRT 1guzA 27 :ELVLLDVV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 10 residues T0191 55 :VEKAEALAKEIAEKLNKKFGEEVKFSGLDV 1guzA 37 :IPQGKALDMYESGPVGLFDTKVTGSNDYAD Fragment has 54 clashes (null) has 54 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 32 residues other bump:3.05751 Ang F26.CD2 and V31.CG1 other bump:0.673563 Ang E6.N and K25.NZ other bump:1.96178 Ang E6.CA and K25.NZ other bump:2.68116 Ang E6.C and K25.NZ other bump:2.4148 Ang A5.N and K25.NZ other bump:2.13536 Ang A5.CA and K25.NZ other bump:1.31285 Ang A5.C and K25.NZ other bump:1.89655 Ang E6.N and K25.CE other bump:2.27038 Ang E6.CA and K25.CE other bump:2.18552 Ang E3.O and K25.CE other bump:2.96494 Ang E3.C and K25.CE other bump:2.1877 Ang E6.C and K25.CE other bump:1.55535 Ang A7.N and K25.CE other bump:2.79849 Ang A7.CA and K25.CE other bump:2.96585 Ang K4.C and K25.CE other bump:2.51075 Ang A5.C and K25.CE other bump:2.95314 Ang E3.CA and K25.CD other bump:0.917436 Ang E3.O and K25.CD other bump:1.66816 Ang E3.C and K25.CD other bump:2.693 Ang A7.N and K25.CD other bump:2.3217 Ang K4.N and K25.CD other bump:2.56908 Ang K4.O and K25.CD other bump:2.26892 Ang K4.C and K25.CD other bump:2.8175 Ang A5.N and K25.CD other bump:2.51825 Ang K4.CA and K25.CD other bump:1.0537 Ang E3.O and K25.CG other bump:2.15115 Ang E3.C and K25.CG other bump:3.0242 Ang A7.N and K25.CG other bump:3.19447 Ang A7.CA and K25.CG other bump:2.24634 Ang A7.CB and K25.CG other bump:2.96719 Ang K4.N and K25.CG other bump:3.12685 Ang K4.CA and K25.CG other bump:1.9254 Ang E3.O and K25.CB other bump:2.24344 Ang E3.C and K25.CB other bump:2.54964 Ang K4.N and K25.CB other bump:2.63642 Ang K4.CA and K25.CB other bump:2.44223 Ang K10.CD and E23.OE2 other bump:2.15803 Ang K10.CB and E23.OE1 other bump:3.08628 Ang K10.CD and E23.CD other bump:2.16246 Ang E14.OE2 and F20.C other bump:2.52373 Ang E14.CD and F20.CA other bump:1.46809 Ang E14.OE2 and F20.CA other bump:3.14829 Ang E14.CD and F20.N other bump:2.11857 Ang E14.OE2 and F20.N other bump:2.66625 Ang E14.CG and K19.C other bump:2.94763 Ang E14.CD and K19.C other bump:2.28341 Ang E14.OE2 and K19.C other bump:1.44454 Ang E14.CG and K19.O other bump:2.09664 Ang E14.CD and K19.O other bump:1.95264 Ang E14.OE2 and K19.O other bump:2.71643 Ang E14.CB and K19.O other bump:2.29015 Ang E14.CA and N17.OD1 other bump:2.74169 Ang E14.C and N17.OD1 other bump:3.08264 Ang A9.C and I12.CG1 T0191 86 :LDGVDIIINATPIGMYPNIDVE 1guzA 67 :TANSDIVIITAGLPRKPGMTRE Fragment has 21 clashes (null) has 21 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 24 residues other bump:2.62528 Ang M16.CE and I20.CG2 neighbor-bump: 2.17665 Ang G15.O and M16.CG neighbor-bump: 2.85371 Ang P13.C and I14.CG1 neighbor-bump: 2.41524 Ang P13.CB and I14.N other bump:2.81394 Ang A11.C and P13.CD neighbor-bump: 2.41315 Ang T12.N and P13.CD neighbor-bump: 1.81229 Ang T12.O and P13.CD neighbor-bump: 0.781192 Ang T12.C and P13.CD self-bump: 1.32868 Ang P13.N and P13.CD neighbor-bump: 1.46411 Ang T12.CA and P13.CD neighbor-bump: 2.79884 Ang T12.CB and P13.CD other bump:2.97176 Ang A11.C and P13.CG neighbor-bump: 2.91332 Ang T12.N and P13.CG neighbor-bump: 1.16588 Ang T12.O and P13.CG neighbor-bump: 1.45897 Ang T12.C and P13.CG self-bump: 2.15362 Ang P13.N and P13.CG neighbor-bump: 2.58266 Ang T12.CA and P13.CG neighbor-bump: 2.27296 Ang T12.O and P13.CB neighbor-bump: 2.40303 Ang T12.C and P13.CB other bump:2.42683 Ang V5.CG1 and I7.O other bump:2.46845 Ang L2.O and V5.CG2 T0191 108 :PIVKAEKLREDMVVMDLIYNPLETVLLKEAKK 1guzA 101 :VTDNIMKHSKNPIIIVVSNPLDIMTHVAWVRS Fragment has 13 clashes (null) has 13 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 34 residues other bump:2.61869 Ang V15.CG1 and K33.NZ other bump:2.14286 Ang V15.CG1 and K33.CE other bump:2.74856 Ang D17.OD2 and T25.C other bump:2.98961 Ang D17.CG and T25.CG2 other bump:2.94255 Ang D17.OD1 and T25.CG2 other bump:2.31081 Ang D17.OD2 and T25.CG2 other bump:2.27694 Ang I19.CG2 and T25.CG2 other bump:2.26454 Ang M13.CE and V15.CG1 other bump:2.5672 Ang I3.CA and E7.OE2 other bump:0.612007 Ang I3.O and E7.OE2 other bump:1.69835 Ang I3.C and E7.OE2 other bump:1.87031 Ang I3.O and E7.CD other bump:2.89053 Ang I3.C and E7.CD Number of specific fragments= 6 total=392 Number of alignments=69 # 1hu4A read from T0191.t2k-2track-undertaker.a2m # found chain 1hu4A in template set T0191 21 :VKDKNIVIYGAG 1hu4A 2 :SNTRVALVTGAN Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues neighbor-bump: 2.87181 Ang G1.C and V2.CG2 neighbor-bump: 2.44137 Ang G1.O and V2.CG2 T0191 33 :GAARAVAFELAK 1hu4A 15 :GIGFAIVRDLCR Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:2.35528 Ang F9.CE2 and K13.NZ other bump:2.48416 Ang F9.CZ and K13.NZ other bump:2.29426 Ang F9.CE2 and K13.CE other bump:2.18466 Ang F9.CZ and K13.CE other bump:3.11099 Ang F9.CE2 and K13.CD T0191 45 :DN 1hu4A 28 :FA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues T0191 47 :NIIIANRTVEKAEALAKEIAEKLNKKFGEEVK 1hu4A 31 :DVVLTARDVARGQAAVKQLQAEGLSPRFHQLD Fragment has 30 clashes (null) has 30 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 34 residues neighbor-bump: 2.154 Ang E31.O and V32.CG2 neighbor-bump: 2.74154 Ang E31.C and V32.CG2 other bump:1.85153 Ang F28.CE1 and E30.OE1 other bump:2.98508 Ang F28.CD1 and E30.OE1 other bump:2.03752 Ang F28.CZ and E30.OE1 other bump:2.31172 Ang F28.CE1 and E30.CD other bump:2.88502 Ang F28.CZ and E30.CD other bump:2.26847 Ang F28.CE1 and E30.CG neighbor-bump: 2.54246 Ang G29.O and E30.CG other bump:2.85479 Ang I3.CD1 and K27.CE other bump:2.82376 Ang I5.CG2 and K27.CD other bump:3.11969 Ang I3.CG1 and K27.CG other bump:2.2927 Ang E19.CB and E22.OE2 other bump:2.15613 Ang E19.CG and E22.OE2 other bump:1.37051 Ang E19.O and E22.OE2 other bump:1.58114 Ang E19.C and E22.OE2 other bump:1.72968 Ang E19.CA and E22.OE2 other bump:1.99289 Ang E19.O and E22.OE1 other bump:1.79408 Ang E19.C and E22.OE1 other bump:1.62173 Ang K18.O and E22.OE1 other bump:2.31065 Ang K18.C and E22.OE1 other bump:1.98957 Ang E19.CA and E22.OE1 other bump:1.24318 Ang E19.O and E22.CD other bump:1.6891 Ang E19.C and E22.CD other bump:2.05254 Ang E19.CA and E22.CD other bump:2.93174 Ang I20.N and E22.CD other bump:2.08363 Ang E19.O and E22.CG other bump:3.05102 Ang E19.C and E22.CG other bump:3.26185 Ang V10.CG1 and E14.CD other bump:3.14222 Ang N7.CB and A13.CB T0191 86 :LDGVDIIINATPIGMYPNIDVEP 1hu4A 80 :YGGLDVLVNNAAIAFQLDNPTPF Fragment has 13 clashes (null) has 13 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 25 residues self-bump: 1.39817 Ang P24.CA and P24.CB other bump:3.21928 Ang M16.SD and V22.CG1 other bump:1.60456 Ang M16.CE and V22.CG1 other bump:2.7358 Ang M16.CE and V22.CB other bump:2.18883 Ang A11.O and P13.CD neighbor-bump: 2.00267 Ang T12.CA and P13.CD neighbor-bump: 2.08181 Ang T12.O and P13.CD neighbor-bump: 1.27164 Ang T12.C and P13.CD other bump:2.77933 Ang A11.C and P13.CD other bump:2.28601 Ang A11.O and P13.CG neighbor-bump: 2.11586 Ang T12.O and P13.CG neighbor-bump: 2.15184 Ang T12.C and P13.CG other bump:3.24322 Ang A11.C and P13.CG Number of specific fragments= 5 total=397 Number of alignments=70 # 1hwxA read from T0191.t2k-2track-undertaker.a2m # adding 1hwxA to template set 1hwxA:# found chain 1hwxA in template set T0191 9 :GARMALEEEIGRVKDKNIVIYGAGGAARAVAFELAK 1hwxA 230 :ASYMSILGMTPGFGDKTFAVQGFGNVGLHSMRYLHR Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 38 residues other bump:1.84015 Ang G23.O and A28.CB other bump:2.9095 Ang G23.C and A28.CB other bump:2.27286 Ang I11.O and K17.NZ neighbor-bump: 2.13316 Ang G12.O and R13.CG T0191 45 :DN 1hwxA 267 :GA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues T0191 47 :NIIIAN 1hwxA 270 :CVAVGE Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 8 residues other bump:3.04824 Ang N2.OD1 and I5.CG2 T0191 53 :RTVEKAEALAKEIAEKLNKKFGEEVKFSGLD 1hwxA 286 :IDPKELEDFKLQHGTILGFPKAKIYEGSILE Fragment has 32 clashes (null) has 32 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 33 residues neighbor-bump: 2.24185 Ang F28.CB and S29.N self-bump: 2.21804 Ang F28.CB and F28.C other bump:2.57873 Ang V26.CG1 and F28.CZ other bump:3.02396 Ang V26.C and F28.CE1 other bump:2.80609 Ang V26.CA and F28.CE1 other bump:2.58361 Ang V26.CB and F28.CE1 other bump:1.58907 Ang V26.CG1 and F28.CE1 other bump:2.51572 Ang V26.C and F28.CD1 neighbor-bump: 2.86621 Ang K27.N and F28.CD1 other bump:2.86653 Ang V26.CA and F28.CD1 other bump:2.60141 Ang V26.CB and F28.CD1 other bump:1.53892 Ang V26.CG1 and F28.CD1 other bump:2.51147 Ang V26.CG1 and F28.CG other bump:2.9481 Ang K6.CE and F22.CZ other bump:1.94214 Ang K6.NZ and F22.CZ other bump:2.3517 Ang K6.NZ and F22.CE2 other bump:2.79644 Ang K6.NZ and F22.CE1 self-bump: 1.39098 Ang K21.CA and K21.CB other bump:2.71378 Ang L10.CA and K20.NZ other bump:2.05981 Ang L10.CB and K20.NZ other bump:2.35987 Ang L10.CG and K20.NZ other bump:2.07117 Ang L10.CD1 and K20.NZ other bump:2.55886 Ang L10.C and K20.NZ other bump:2.24084 Ang A11.N and K20.NZ other bump:2.58628 Ang L10.CD1 and K20.CE other bump:2.8745 Ang L10.CD1 and K20.CD other bump:2.9516 Ang L10.CG and K20.CG other bump:2.32205 Ang L10.CD1 and K20.CG neighbor-bump: 2.6018 Ang I14.C and A15.CB other bump:2.44137 Ang L10.CD2 and I14.CD1 neighbor-bump: 2.85988 Ang E13.C and I14.CG1 other bump:2.71633 Ang A9.O and E13.CB T0191 87 :DGVDIIINATPIGMYPNID 1hwxA 317 :VDCDILIPAASEKQLTKSN Fragment has 11 clashes (null) has 11 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 21 residues other bump:2.46268 Ang P17.CD and D20.OD1 other bump:3.06945 Ang P17.CD and D20.CG neighbor-bump: 2.7916 Ang N18.ND2 and I19.CG1 other bump:2.82051 Ang I7.CG1 and Y16.OH other bump:1.56105 Ang I7.CD1 and Y16.OH other bump:2.62329 Ang I7.CD1 and Y16.CZ other bump:3.27015 Ang P12.CD and M15.SD neighbor-bump: 2.34262 Ang T11.CB and P12.CD neighbor-bump: 2.45765 Ang T11.CG2 and P12.CD self-bump: 1.3764 Ang T11.CA and T11.CB other bump:2.70884 Ang V4.CG1 and I6.O T0191 113 :EKLREDMVVMDLIYNPLETVLLKEAKKVNAKTINGLG 1hwxA 336 :APRVKAKIIAEGANGPTTPQADKIFLERNIMVIPDLY Fragment has 30 clashes (null) has 30 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 39 residues other bump:2.92251 Ang E2.CD and A26.N other bump:2.33768 Ang E2.OE2 and A26.N other bump:3.13172 Ang E2.CD and E25.C other bump:2.44218 Ang E2.OE1 and E25.CG other bump:2.9693 Ang E2.CG and E25.CG other bump:2.82264 Ang E2.CD and E25.CG other bump:1.23174 Ang E2.OE1 and E25.CB other bump:2.74669 Ang E2.CG and E25.CB other bump:1.81805 Ang E2.CD and E25.CB other bump:2.68415 Ang E2.OE2 and E25.CB other bump:2.36296 Ang E2.OE1 and E25.CA other bump:2.77299 Ang E2.CD and E25.CA other bump:3.17532 Ang E2.CD and E25.N other bump:2.91135 Ang E2.CD and L22.C other bump:2.38025 Ang E2.OE2 and L22.C other bump:2.06348 Ang E2.CD and L22.O other bump:1.26312 Ang E2.OE2 and L22.O other bump:2.80451 Ang E2.CB and L22.CD2 other bump:3.15537 Ang E2.CD and L22.CA other bump:2.86116 Ang I14.CG2 and P17.CD other bump:2.53253 Ang D12.CG and P17.CD other bump:1.84175 Ang D12.OD1 and P17.CD other bump:2.62403 Ang D12.OD2 and P17.CD other bump:2.7188 Ang I14.CG2 and P17.CG other bump:2.32777 Ang D12.CG and P17.CG other bump:2.15813 Ang D12.OD1 and P17.CG other bump:2.46888 Ang D12.OD2 and P17.CG other bump:2.49565 Ang I14.CG2 and P17.CB other bump:2.2404 Ang D12.OD2 and I14.O other bump:2.49129 Ang D12.OD2 and I14.CG2 Number of specific fragments= 6 total=403 Number of alignments=71 # 1hwyA read from T0191.t2k-2track-undertaker.a2m # adding 1hwyA to template set 1hwyA:# found chain 1hwyA in template set T0191 9 :GARMALEEEIGRVKDKNIVIYGAGGAARAVAFELAK 1hwyA 230 :ASYMSILGMTPGFGDKTFAVQGFGNVGLHSMRYLHR Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 38 residues other bump:2.58519 Ang I21.CD1 and A32.CB other bump:2.21184 Ang G23.O and A28.CB other bump:3.15082 Ang G23.C and A28.CB other bump:3.04567 Ang I11.CG2 and K17.NZ other bump:2.48879 Ang I11.CG2 and K17.CE other bump:2.8321 Ang I11.CG2 and D16.OD2 other bump:2.50221 Ang I11.CG2 and D16.OD1 other bump:2.98785 Ang I11.CG2 and D16.CG neighbor-bump: 2.39666 Ang G12.O and R13.CG other bump:3.23763 Ang A6.C and E9.N T0191 45 :DN 1hwyA 267 :GA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues T0191 47 :NIIIANRT 1hwyA 270 :CVAVGESD Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 10 residues neighbor-bump: 2.93671 Ang I4.C and I5.CG2 T0191 55 :VEKAEALAKEIAEKLNKKFGEEVKFSGLD 1hwyA 288 :PKELEDFKLQHGTILGFPKAKIYEGSILE Fragment has 22 clashes (null) has 22 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 31 residues other bump:2.08926 Ang S27.CB and D30.OD2 other bump:2.92402 Ang S27.CB and D30.CG other bump:2.76424 Ang S27.OG and D30.CG neighbor-bump: 2.32103 Ang F26.CB and S27.N other bump:2.24871 Ang V24.CG1 and F26.CE1 neighbor-bump: 2.86187 Ang K25.N and F26.CD1 other bump:1.97898 Ang V24.CG1 and F26.CD1 other bump:3.12002 Ang L16.CD1 and E23.OE2 other bump:2.24372 Ang L16.CD2 and E23.OE2 other bump:2.81026 Ang K4.NZ and F20.CE2 other bump:2.78514 Ang L8.CD1 and K18.NZ other bump:2.86781 Ang K15.CA and K18.CE other bump:2.47085 Ang K15.CB and K18.CE other bump:1.94098 Ang K15.CG and K18.CE other bump:2.94923 Ang I12.CG1 and E14.C other bump:2.90379 Ang I12.CD1 and E14.C other bump:1.87805 Ang I12.CG1 and E14.O other bump:1.87545 Ang I12.CD1 and E14.O neighbor-bump: 2.45633 Ang A13.O and E14.CG other bump:1.91302 Ang L8.CD1 and I12.CD1 other bump:3.16287 Ang L8.CD1 and I12.CG1 other bump:2.80649 Ang E6.CG and K10.CE T0191 87 :DGVDIIINATPIGMYPNID 1hwyA 317 :VDCDILIPAASEKQLTKSN Fragment has 14 clashes (null) has 14 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 21 residues neighbor-bump: 2.82528 Ang N18.ND2 and I19.CG1 other bump:1.88787 Ang M15.O and P17.CD other bump:2.48791 Ang M15.C and P17.CD other bump:2.06725 Ang N9.ND2 and Y16.OH other bump:2.61667 Ang I7.CD1 and Y16.OH other bump:2.30325 Ang N9.ND2 and Y16.CZ other bump:2.22061 Ang N9.CG and Y16.CE1 other bump:1.91441 Ang N9.ND2 and Y16.CE1 other bump:2.14974 Ang N9.OD1 and Y16.CE1 other bump:2.5448 Ang N9.OD1 and Y16.CD1 other bump:2.39686 Ang T11.OG1 and M15.SD neighbor-bump: 2.20996 Ang T11.CB and P12.CD neighbor-bump: 2.4814 Ang T11.OG1 and P12.CD other bump:2.57365 Ang V4.CG1 and I6.O T0191 113 :EKLREDMVVMDLIYNPLETVLLKEAKKVNAKTINGLG 1hwyA 336 :APRVKAKIIAEGANGPTTPQADKIFLERNIMVIPDLY Fragment has 27 clashes (null) has 27 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 39 residues other bump:2.72261 Ang V10.CB and T33.CG2 other bump:2.55246 Ang E25.CD and V29.CG2 other bump:1.93603 Ang E25.OE2 and V29.CG2 other bump:2.6572 Ang E2.CD and A26.N other bump:2.25862 Ang E2.CG and E25.OE1 other bump:3.31187 Ang K3.CA and E25.CD other bump:2.79685 Ang E2.CD and E25.CB other bump:2.05833 Ang E2.OE1 and E25.CB other bump:3.28472 Ang E2.CD and E25.CA other bump:2.58949 Ang E2.OE1 and E25.CA other bump:2.43875 Ang E2.CD and L22.C other bump:2.39203 Ang E2.OE1 and L22.C other bump:2.26892 Ang E2.OE2 and L22.C other bump:1.52715 Ang E2.CD and L22.O other bump:1.78798 Ang E2.OE1 and L22.O other bump:1.21303 Ang E2.OE2 and L22.O other bump:2.55659 Ang E2.CB and L22.CD2 other bump:3.20696 Ang E2.CA and L22.CD2 other bump:2.8792 Ang E2.CD and L22.CA other bump:2.65577 Ang E2.OE1 and L22.CA other bump:2.81311 Ang R5.NH1 and L18.CD2 other bump:2.96323 Ang I14.CG2 and P17.CD other bump:1.70835 Ang I14.CG2 and P17.CG other bump:2.76482 Ang I14.CG2 and P17.CB other bump:2.85789 Ang M11.CE and L13.CD2 other bump:3.07332 Ang R5.CZ and V10.CG1 other bump:2.29352 Ang R5.NH1 and V10.CG1 Number of specific fragments= 6 total=409 Number of alignments=72 # 1hyhA read from T0191.t2k-2track-undertaker.a2m # adding 1hyhA to template set 1hyhA:Skipped atom 1643, because occupancy 0.5 <= existing 0.500001 # found chain 1hyhA in template set T0191 24 :KNIVIYGAGGAARAVAFELAK 1hyhA 22 :RKIGIIGLGNVGAAVAHGLIA Fragment has 8 clashes (null) has 8 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 23 residues other bump:2.42054 Ang F18.CE1 and K22.NZ other bump:2.58874 Ang F18.CE1 and K22.CE other bump:2.46144 Ang F18.CD1 and K22.CD other bump:1.98914 Ang F18.CE1 and K22.CD other bump:2.59124 Ang F18.CZ and K22.CD other bump:2.03996 Ang G8.O and A13.CB other bump:3.07594 Ang G8.C and A13.CB other bump:3.2311 Ang A9.CA and A13.CB T0191 45 :DN 1hyhA 44 :GV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues T0191 47 :NIIIANRTVEKAEALAKEIAEKLNKK 1hyhA 48 :DYVFIDANEAKVKADQIDFQDAMANL Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:2.58189 Ang I20.CD1 and K23.NZ other bump:2.89542 Ang I20.CD1 and K23.CE other bump:2.78808 Ang K12.NZ and L16.CD1 T0191 73 :FGEEVKFSG 1hyhA 78 :NIVINDWAA Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues self-bump: 1.38916 Ang F8.CA and F8.CB other bump:2.04218 Ang E4.OE2 and K7.CE T0191 86 :LDGVDIIINATPIGM 1hyhA 87 :LADADVVISTLGNIK Fragment has 12 clashes (null) has 12 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 17 residues other bump:2.87222 Ang A11.C and P13.CD neighbor-bump: 2.46692 Ang T12.N and P13.CD neighbor-bump: 1.64756 Ang T12.CA and P13.CD neighbor-bump: 0.888288 Ang T12.C and P13.CD neighbor-bump: 1.77754 Ang T12.O and P13.CD other bump:3.2688 Ang A11.C and P13.CG neighbor-bump: 2.95474 Ang T12.CA and P13.CG neighbor-bump: 1.83815 Ang T12.C and P13.CG neighbor-bump: 1.64896 Ang T12.O and P13.CG neighbor-bump: 2.6808 Ang T12.C and P13.CB other bump:2.53134 Ang V5.CG1 and I7.O other bump:3.21858 Ang L2.CA and V5.CG2 Number of specific fragments= 5 total=414 Number of alignments=73 # 1ja9A read from T0191.t2k-2track-undertaker.a2m # found chain 1ja9A in template set T0191 19 :GRVKDKNIVIYGAG 1ja9A 25 :KPLAGKVALTTGAG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 16 residues T0191 33 :GAARAVAFELAK 1ja9A 40 :GIGRGIAIELGR Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:2.85728 Ang R5.CG and F9.CE1 other bump:2.88741 Ang R5.CZ and F9.CE1 other bump:2.94117 Ang R5.NH1 and F9.CE1 T0191 45 :DNNIIIANRT 1ja9A 53 :GASVVVNYGS Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 12 residues self-bump: 1.3897 Ang R10.CA and R10.CB other bump:3.01155 Ang I5.CD1 and I7.CG2 T0191 55 :VEKAEALAKEIAEKLNKKFGEEVKFSGLDVD 1ja9A 64 :SKAAEEVVAELKKLGAQGVAIQADISKPSEV Fragment has 31 clashes (null) has 31 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 33 residues other bump:3.06391 Ang V24.CG1 and V31.C other bump:2.50817 Ang V24.CG1 and V31.O other bump:2.48554 Ang V24.CG1 and V31.CG1 other bump:2.73549 Ang K25.N and V31.CG1 neighbor-bump: 2.45045 Ang E23.O and V24.CG2 neighbor-bump: 2.92735 Ang E23.C and V24.CG2 other bump:1.37741 Ang A9.CA and K19.NZ other bump:2.79379 Ang A9.CB and K19.NZ other bump:2.24606 Ang A9.O and K19.NZ other bump:1.31781 Ang A9.C and K19.NZ other bump:1.78874 Ang K10.N and K19.NZ other bump:1.65104 Ang L8.C and K19.NZ other bump:1.42613 Ang A9.N and K19.NZ other bump:1.76442 Ang L8.O and K19.NZ other bump:0.935012 Ang A9.CA and K19.CE other bump:2.18335 Ang A9.CB and K19.CE other bump:1.76757 Ang A9.O and K19.CE other bump:1.37167 Ang A9.C and K19.CE other bump:2.60345 Ang K10.N and K19.CE other bump:2.75885 Ang L8.C and K19.CE other bump:2.1597 Ang A9.N and K19.CE other bump:2.91193 Ang I12.CD1 and K19.CD other bump:1.63379 Ang A9.CA and K19.CD other bump:2.45234 Ang A9.CB and K19.CD other bump:2.8436 Ang A9.C and K19.CD other bump:2.96009 Ang L8.C and K19.CD other bump:2.35857 Ang A9.N and K19.CD other bump:2.71931 Ang A9.CA and K19.CG other bump:2.78499 Ang A9.CB and K19.CG other bump:3.12403 Ang I12.CD1 and K19.CB other bump:3.05408 Ang I12.CG2 and N17.C T0191 86 :LDGVDIIINATPIGMYPNIDVEPIVKAE 1ja9A 105 :FGGLDFVMSNSGMEVWCDELEVTQELFD Fragment has 24 clashes (null) has 24 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 30 residues other bump:2.38723 Ang M16.CE and K27.NZ other bump:3.11545 Ang M16.SD and K27.NZ other bump:2.74972 Ang M16.CE and K27.CE other bump:2.33989 Ang M16.CE and K27.CD other bump:2.42672 Ang P18.O and E23.OE2 other bump:2.5102 Ang I20.CA and E23.OE2 other bump:2.596 Ang N19.C and E23.OE2 other bump:1.70541 Ang I20.O and E23.OE1 other bump:2.03202 Ang I20.C and E23.OE1 other bump:2.10594 Ang I20.CA and E23.OE1 other bump:3.04974 Ang I20.C and E23.CD other bump:2.62359 Ang I20.CA and E23.CD other bump:3.18529 Ang N19.C and E23.CD neighbor-bump: 2.45839 Ang Y17.CA and P18.CD neighbor-bump: 1.76985 Ang Y17.C and P18.CD other bump:2.6268 Ang A11.C and P13.CD other bump:1.94407 Ang A11.O and P13.CD neighbor-bump: 2.22047 Ang T12.O and P13.CD neighbor-bump: 2.02649 Ang T12.CA and P13.CD neighbor-bump: 1.35838 Ang T12.C and P13.CD other bump:3.08644 Ang A11.C and P13.CG other bump:2.14854 Ang A11.O and P13.CG neighbor-bump: 2.30673 Ang T12.O and P13.CG neighbor-bump: 2.22394 Ang T12.C and P13.CG Number of specific fragments= 5 total=419 Number of alignments=74 # 1jaxA read from T0191.t2k-2track-undertaker.a2m # found chain 1jaxA in template set T0191 25 :NIVIYGA 1jaxA 2 :RVALLGG Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 9 residues other bump:2.60548 Ang I5.CB and A8.CB other bump:2.48976 Ang I5.CG2 and A8.CB other bump:2.24555 Ang I5.O and A8.CB other bump:2.91754 Ang I5.C and A8.CB other bump:3.14389 Ang I5.CG2 and A8.CA T0191 32 :GGAARAVAFELAK 1jaxA 10 :GNLGKGLALRLAT Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGLD 1jaxA 24 :GHEIVVGSRREEKAEAKAAEYRRIAGDASITGMKNEDAA Fragment has 81 clashes (null) has 81 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 41 residues other bump:2.93864 Ang V34.CB and L39.CD2 other bump:1.70767 Ang V34.CG2 and L39.CD2 other bump:2.60435 Ang I6.CB and L39.CD2 other bump:1.33969 Ang I6.CG1 and L39.CD2 other bump:1.68413 Ang I6.CD1 and L39.CD2 other bump:2.29645 Ang I7.O and L39.CD1 other bump:2.41783 Ang I7.C and L39.CD1 other bump:2.33376 Ang A8.N and L39.CD1 other bump:2.82692 Ang V34.CG2 and L39.CD1 other bump:2.11126 Ang A8.CA and L39.CD1 other bump:2.55666 Ang A8.CB and L39.CD1 other bump:3.08697 Ang V34.CB and L39.CG other bump:1.60756 Ang V34.CG2 and L39.CG other bump:2.81748 Ang I6.CG1 and L39.CG other bump:2.6943 Ang V34.CG2 and L39.CB other bump:2.91117 Ang V34.CG2 and L39.CA other bump:3.07176 Ang N9.CA and F36.CZ other bump:2.55044 Ang A8.O and F36.CZ other bump:2.99252 Ang A8.C and F36.CZ other bump:2.57132 Ang N9.CA and F36.CE2 other bump:2.78413 Ang N9.C and F36.CE2 other bump:3.14449 Ang R10.N and F36.CE2 other bump:3.06525 Ang N9.N and F36.CE2 other bump:2.92316 Ang A8.CB and F36.CE1 other bump:2.93525 Ang A8.C and F36.CE1 other bump:3.07999 Ang N9.CA and F36.CD2 other bump:2.76539 Ang N9.C and F36.CD2 other bump:2.50446 Ang A8.CB and F36.CD1 other bump:2.61283 Ang V12.CG2 and K35.CE other bump:2.87829 Ang V12.CG2 and K35.CD other bump:2.1409 Ang V12.CG2 and K35.CG other bump:2.87488 Ang I6.CG1 and V34.CG2 other bump:2.47604 Ang I6.CD1 and V34.CG2 other bump:2.8209 Ang I6.CD1 and V34.CG1 other bump:1.76559 Ang A15.C and E33.OE2 other bump:1.67864 Ang E16.N and E33.OE2 other bump:1.79763 Ang K14.C and E33.OE2 other bump:1.0317 Ang A15.N and E33.OE2 other bump:1.54786 Ang A15.CA and E33.OE2 other bump:2.51127 Ang A15.CB and E33.OE2 other bump:2.21594 Ang A15.C and E33.OE1 other bump:0.899862 Ang E16.N and E33.OE1 other bump:1.10488 Ang E16.CA and E33.OE1 other bump:1.61355 Ang E16.CB and E33.OE1 other bump:2.24411 Ang E16.C and E33.OE1 other bump:2.43633 Ang A15.O and E33.CD other bump:1.30434 Ang A15.C and E33.CD other bump:0.565897 Ang E16.N and E33.CD other bump:1.99209 Ang E16.CA and E33.CD other bump:2.81391 Ang E16.CB and E33.CD other bump:3.01536 Ang E16.C and E33.CD other bump:2.92884 Ang K14.C and E33.CD other bump:2.23224 Ang A15.N and E33.CD other bump:2.02599 Ang A15.CA and E33.CD other bump:2.66184 Ang A15.CB and E33.CD other bump:2.191 Ang A15.O and E33.CG other bump:1.48782 Ang A15.C and E33.CG other bump:1.70188 Ang E16.N and E33.CG other bump:2.63976 Ang E16.CA and E33.CG other bump:3.04308 Ang A15.N and E33.CG other bump:2.10154 Ang A15.CA and E33.CG other bump:2.0153 Ang A15.CB and E33.CG other bump:2.38329 Ang A15.O and E33.CB other bump:2.36144 Ang A15.C and E33.CB other bump:2.36679 Ang E16.N and E33.CB other bump:2.42495 Ang E16.CA and E33.CB other bump:2.8852 Ang F30.CD1 and E32.OE1 other bump:1.68779 Ang F30.CE1 and E32.OE1 other bump:2.16903 Ang F30.CZ and E32.OE1 other bump:2.81264 Ang F30.CZ and E32.CD other bump:2.93181 Ang N4.CB and F30.CE2 other bump:3.08236 Ang N4.CG and F30.CE2 other bump:2.76982 Ang N4.CA and F30.CD2 other bump:2.76488 Ang N4.CB and F30.CD2 other bump:2.82356 Ang N4.CG and F30.CD2 other bump:2.95391 Ang L26.CB and K29.CD other bump:2.89819 Ang I7.CD1 and A19.CA other bump:2.52503 Ang I7.CD1 and A19.N other bump:2.46765 Ang V12.CG1 and E16.OE2 other bump:2.85136 Ang N9.ND2 and K14.CE other bump:2.77127 Ang N9.ND2 and K14.CD T0191 87 :DGVDIIINATPIGMYPN 1jaxA 63 :EACDIAVLTIPWEHAID Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 19 residues neighbor-bump: 2.74793 Ang Y16.CD2 and P17.CD other bump:2.81381 Ang V4.CG1 and I7.CG1 other bump:2.70337 Ang V4.CG2 and I6.C other bump:1.98462 Ang V4.CG2 and I6.O T0191 108 :PIVKAEKLREDMVVMDLIY 1jaxA 80 :TARDLKNILREKIVVSPLV Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 21 residues other bump:2.47542 Ang D17.OD2 and I19.CB other bump:2.95588 Ang M16.CE and L18.CD1 Number of specific fragments= 5 total=424 Number of alignments=75 # 1jayA read from T0191.t2k-2track-undertaker.a2m # found chain 1jayA in template set T0191 25 :NIVIYGA 1jayA 2 :RVALLGG Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 9 residues other bump:2.26145 Ang I5.O and A8.CB other bump:3.09585 Ang I5.C and A8.CB other bump:2.8295 Ang I5.CB and A8.CB T0191 32 :GGAARAVAFELAK 1jayA 10 :GNLGKGLALRLAT Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGLD 1jayA 24 :GHEIVVGSRREEKAEAKAAEYRRIAGDASITGMKNEDAA Fragment has 65 clashes (null) has 65 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 41 residues other bump:2.73282 Ang I6.CB and L39.CD2 other bump:1.51995 Ang I6.CG1 and L39.CD2 other bump:1.92903 Ang I6.CD1 and L39.CD2 other bump:2.17771 Ang V34.CG2 and L39.CD2 other bump:1.90456 Ang A8.CA and L39.CD1 other bump:2.28081 Ang A8.CB and L39.CD1 other bump:2.50061 Ang I7.C and L39.CD1 other bump:2.21443 Ang A8.N and L39.CD1 other bump:2.49815 Ang I7.O and L39.CD1 other bump:3.02789 Ang I6.CG1 and L39.CG other bump:2.18962 Ang V34.CG2 and L39.CG other bump:3.23643 Ang A8.C and F36.CZ other bump:2.83621 Ang N9.CA and F36.CE2 other bump:2.84976 Ang N9.C and F36.CE2 other bump:2.96489 Ang R10.N and F36.CE2 other bump:3.08046 Ang A8.CB and F36.CE1 other bump:3.20197 Ang A8.C and F36.CE1 other bump:3.27579 Ang N9.CA and F36.CD2 other bump:2.83723 Ang N9.C and F36.CD2 other bump:2.66909 Ang A8.CB and F36.CD1 other bump:2.82855 Ang I6.CD1 and V34.CG2 other bump:1.03868 Ang A15.N and E33.OE2 other bump:1.40164 Ang A15.CA and E33.OE2 other bump:2.30971 Ang A15.CB and E33.OE2 other bump:1.76044 Ang A15.C and E33.OE2 other bump:1.80472 Ang E16.N and E33.OE2 other bump:1.92814 Ang K14.C and E33.OE2 other bump:1.95477 Ang A15.C and E33.OE1 other bump:0.640383 Ang E16.N and E33.OE1 other bump:1.14293 Ang E16.CA and E33.OE1 other bump:2.2803 Ang E16.C and E33.OE1 other bump:1.83439 Ang E16.CB and E33.OE1 other bump:2.25518 Ang A15.N and E33.CD other bump:1.85163 Ang A15.CA and E33.CD other bump:2.44784 Ang A15.CB and E33.CD other bump:2.34296 Ang A15.O and E33.CD other bump:1.18326 Ang A15.C and E33.CD other bump:0.740274 Ang E16.N and E33.CD other bump:2.19358 Ang E16.CA and E33.CD other bump:3.16208 Ang E16.C and E33.CD other bump:3.04467 Ang E16.CB and E33.CD other bump:3.00048 Ang K14.C and E33.CD other bump:3.13486 Ang A15.N and E33.CG other bump:2.05368 Ang A15.CA and E33.CG other bump:1.8522 Ang A15.CB and E33.CG other bump:2.28212 Ang A15.O and E33.CG other bump:1.60349 Ang A15.C and E33.CG other bump:1.9129 Ang E16.N and E33.CG other bump:2.93229 Ang E16.CA and E33.CG other bump:2.3601 Ang A15.O and E33.CB other bump:2.35824 Ang A15.C and E33.CB other bump:2.48045 Ang E16.N and E33.CB other bump:2.7196 Ang E16.CA and E33.CB other bump:2.02038 Ang F30.CZ and E32.OE1 other bump:2.37178 Ang F30.CE1 and E32.OE1 other bump:3.0507 Ang F30.CZ and E32.CD other bump:2.28724 Ang L26.CD1 and K29.NZ other bump:2.71608 Ang L26.CD1 and K29.CE other bump:2.22039 Ang L26.CD1 and K29.CD neighbor-bump: 2.25362 Ang L26.O and N27.CB neighbor-bump: 2.63962 Ang L26.C and N27.CB other bump:3.05244 Ang I7.CD1 and A19.CA other bump:2.66412 Ang I7.CD1 and A19.N other bump:2.84289 Ang N9.ND2 and K14.CD other bump:2.22957 Ang N9.OD1 and T11.N T0191 87 :DGVDIIINATPIGMYPN 1jayA 63 :EACDIAVLTIPWEHAID Fragment has 57 clashes (null) has 57 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 19 residues other bump:2.94434 Ang I13.C and P17.CD other bump:1.76897 Ang I13.O and P17.CD other bump:3.05991 Ang G14.C and P17.CD other bump:2.45878 Ang I13.O and P17.CG other bump:1.31315 Ang T11.CA and Y16.OH other bump:2.33084 Ang T11.C and Y16.OH other bump:2.71065 Ang T11.CB and Y16.OH other bump:1.47349 Ang A10.C and Y16.OH other bump:1.11086 Ang T11.N and Y16.OH other bump:1.78841 Ang A10.O and Y16.OH other bump:0.723125 Ang T11.CA and Y16.CZ other bump:2.06695 Ang T11.O and Y16.CZ other bump:1.60167 Ang T11.C and Y16.CZ other bump:1.74391 Ang T11.CB and Y16.CZ other bump:2.95824 Ang T11.CG2 and Y16.CZ other bump:2.55679 Ang T11.OG1 and Y16.CZ other bump:2.26693 Ang A10.C and Y16.CZ other bump:1.00359 Ang T11.N and Y16.CZ other bump:2.82807 Ang P12.N and Y16.CZ other bump:3.05226 Ang N9.C and Y16.CE2 other bump:3.18646 Ang A10.N and Y16.CE2 other bump:1.80188 Ang T11.CA and Y16.CE2 other bump:2.77714 Ang T11.C and Y16.CE2 other bump:1.51701 Ang T11.CB and Y16.CE2 other bump:3.02476 Ang T11.CG2 and Y16.CE2 other bump:1.82179 Ang T11.OG1 and Y16.CE2 other bump:2.56378 Ang A10.C and Y16.CE2 other bump:1.5475 Ang T11.N and Y16.CE2 other bump:1.53223 Ang T11.CA and Y16.CE1 other bump:0.933399 Ang T11.O and Y16.CE1 other bump:0.535686 Ang T11.C and Y16.CE1 other bump:2.95096 Ang P12.C and Y16.CE1 other bump:2.29499 Ang T11.CB and Y16.CE1 other bump:2.26064 Ang T11.N and Y16.CE1 other bump:1.8566 Ang P12.N and Y16.CE1 other bump:2.83516 Ang P12.CA and Y16.CE1 other bump:2.78979 Ang T11.CA and Y16.CD2 other bump:1.94144 Ang T11.CB and Y16.CD2 other bump:2.49942 Ang T11.OG1 and Y16.CD2 other bump:2.80764 Ang T11.N and Y16.CD2 other bump:2.63066 Ang T11.CA and Y16.CD1 other bump:1.33662 Ang T11.O and Y16.CD1 other bump:1.7751 Ang T11.C and Y16.CD1 other bump:2.30741 Ang P12.O and Y16.CD1 other bump:2.54994 Ang P12.C and Y16.CD1 other bump:2.59267 Ang T11.CB and Y16.CD1 other bump:2.65579 Ang P12.N and Y16.CD1 other bump:3.12569 Ang T11.CA and Y16.CG other bump:2.48035 Ang T11.O and Y16.CG other bump:2.89155 Ang T11.C and Y16.CG other bump:2.46526 Ang T11.CB and Y16.CG other bump:2.4329 Ang V4.CG1 and I7.CD1 other bump:2.90582 Ang V4.CB and I7.CD1 other bump:2.95129 Ang V4.CG1 and I7.CG1 other bump:2.71185 Ang V4.CG2 and I6.C other bump:2.00412 Ang V4.CG2 and I6.O other bump:2.76283 Ang V4.CG2 and I6.N T0191 108 :PIVKAEKLREDMVVMDLI 1jayA 80 :TARDLKNILREKIVVSPL Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 20 residues other bump:2.59966 Ang D17.OD2 and I19.CB other bump:2.66412 Ang M16.CE and L18.CD1 Number of specific fragments= 5 total=429 Number of alignments=76 # 1ldg read from T0191.t2k-2track-undertaker.a2m # adding 1ldg to template set 1ldg:# found chain 1ldg in template set T0191 22 :KDKNIVIYGAGGAARAVAFELAK 1ldg 19 :PKAKIVLVGSGMIGGVMATLIVQ Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 25 residues other bump:2.63908 Ang F20.CE1 and K24.NZ other bump:2.5603 Ang G10.O and A15.CB other bump:2.94547 Ang A11.CA and A15.CB T0191 45 :DN 1ldg 44 :NL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues T0191 47 :NIIIAN 1ldg 47 :DVVLFD Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 8 residues T0191 53 :RTVEKAEALAKEIAEKLNKKFGEEVKFSGLDV 1ldg 56 :KNMPHGKALDTSHTNVMAYSNCKVSGSNTYDD Fragment has 43 clashes (null) has 43 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 34 residues other bump:2.55274 Ang R2.CZ and S29.CB other bump:1.83273 Ang R2.NH2 and S29.CB other bump:2.56133 Ang R2.NH2 and S29.CA other bump:2.36584 Ang K6.CA and K27.NZ other bump:0.661556 Ang A7.N and K27.NZ other bump:2.63356 Ang A7.CB and K27.NZ other bump:1.37888 Ang K6.C and K27.NZ other bump:2.73089 Ang K6.CB and K27.NZ other bump:1.72021 Ang A7.CA and K27.NZ other bump:2.62563 Ang E5.C and K27.CE other bump:1.64778 Ang K6.CA and K27.CE other bump:2.73271 Ang A7.C and K27.CE other bump:2.21793 Ang K6.N and K27.CE other bump:1.20194 Ang A7.N and K27.CE other bump:1.5273 Ang K6.O and K27.CE other bump:0.57098 Ang K6.C and K27.CE other bump:2.80229 Ang K6.CB and K27.CE other bump:2.32061 Ang A7.CA and K27.CE other bump:2.29942 Ang E5.O and K27.CD other bump:1.97316 Ang E5.C and K27.CD other bump:0.486815 Ang K6.CA and K27.CD other bump:1.14476 Ang K6.N and K27.CD other bump:2.38369 Ang A7.N and K27.CD other bump:2.45701 Ang K6.O and K27.CD other bump:1.56726 Ang K6.C and K27.CD other bump:2.90648 Ang K6.CG and K27.CD other bump:1.96151 Ang K6.CB and K27.CD other bump:3.2348 Ang E5.CA and K27.CG other bump:1.58022 Ang E5.O and K27.CG other bump:1.83595 Ang E5.C and K27.CG other bump:1.82358 Ang K6.CA and K27.CG other bump:1.90236 Ang K6.N and K27.CG other bump:2.71069 Ang K6.C and K27.CG other bump:2.74963 Ang E5.C and K27.CB other bump:2.5795 Ang K6.CA and K27.CB other bump:2.54397 Ang K6.N and K27.CB other bump:1.84295 Ang K12.CE and E25.OE2 other bump:2.11461 Ang K12.CB and E25.OE1 other bump:3.03237 Ang K12.CE and E25.CD other bump:2.81619 Ang K12.CB and E25.CD other bump:3.04493 Ang N19.CB and K21.CD other bump:2.43852 Ang E16.OE1 and K21.CB other bump:2.3387 Ang G1.O and E5.OE1 T0191 86 :LDGVDIIINATPIGMYPNIDVEPIVKAEKLR 1ldg 88 :LAGSDVVIVTAGFTKAPGKSDKEWNRLDLLP Fragment has 31 clashes (null) has 31 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 33 residues other bump:2.4021 Ang K27.CA and K30.NZ other bump:2.9294 Ang I20.CD1 and E29.OE2 other bump:2.7857 Ang I20.CD1 and E29.OE1 other bump:3.01184 Ang I20.CD1 and P24.C other bump:2.17978 Ang I20.CD1 and P24.O other bump:2.68302 Ang I20.CG1 and P24.CG other bump:1.33844 Ang D21.OD1 and E23.OE1 other bump:2.05281 Ang D21.CG and E23.OE1 other bump:2.48737 Ang D21.OD1 and E23.CD neighbor-bump: 1.85875 Ang P18.O and N19.CG neighbor-bump: 2.68496 Ang P18.C and N19.CG other bump:3.13559 Ang I14.CG2 and M16.C other bump:2.12441 Ang I14.CG2 and M16.O other bump:2.2307 Ang A11.O and P13.CD other bump:2.51354 Ang A11.C and P13.CD neighbor-bump: 2.27992 Ang T12.N and P13.CD neighbor-bump: 1.57385 Ang T12.CA and P13.CD neighbor-bump: 1.62988 Ang T12.O and P13.CD neighbor-bump: 0.71531 Ang T12.C and P13.CD self-bump: 1.37031 Ang P13.N and P13.CD other bump:2.98528 Ang A11.C and P13.CG neighbor-bump: 3.06794 Ang T12.N and P13.CG neighbor-bump: 2.81204 Ang T12.CA and P13.CG neighbor-bump: 1.17973 Ang T12.O and P13.CG neighbor-bump: 1.61288 Ang T12.C and P13.CG self-bump: 2.21794 Ang P13.N and P13.CG neighbor-bump: 2.52256 Ang T12.C and P13.CB other bump:2.46745 Ang V5.CG1 and I8.CG2 other bump:2.69881 Ang V5.CG1 and I7.O other bump:2.44763 Ang L2.O and V5.CG2 other bump:3.06355 Ang L2.C and V5.CG2 Number of specific fragments= 5 total=434 Number of alignments=77 # 1lehA read from T0191.t2k-2track-undertaker.a2m # adding 1lehA to template set 1lehA:# found chain 1lehA in template set T0191 5 :TDGIGARMALEEEIG 1lehA 153 :GVYRGMKAAAKEAFG Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 17 residues other bump:2.97615 Ang L11.CD2 and I15.CD1 T0191 20 :RVKDKNIVIYGAGGAARAVAFELAK 1lehA 170 :SLEGLAVSVQGLGNVAKALCKKLNT Fragment has 17 clashes (null) has 17 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 27 residues other bump:2.50483 Ang F22.CD2 and K26.NZ other bump:2.48865 Ang F22.CE1 and K26.NZ other bump:1.15182 Ang F22.CE2 and K26.NZ other bump:1.13562 Ang F22.CZ and K26.NZ other bump:2.8631 Ang F22.CG and K26.CE other bump:2.50115 Ang F22.CD1 and K26.CE other bump:2.4797 Ang F22.CD2 and K26.CE other bump:1.54529 Ang F22.CE1 and K26.CE other bump:1.52055 Ang F22.CE2 and K26.CE other bump:0.653677 Ang F22.CZ and K26.CE other bump:2.8931 Ang F22.CD2 and K26.CD other bump:2.17411 Ang F22.CE2 and K26.CD other bump:2.14758 Ang F22.CZ and K26.CD other bump:2.60707 Ang I8.CD1 and L24.CD1 self-bump: 1.39658 Ang D5.CA and D5.CB other bump:3.19913 Ang R2.CD and K4.CB other bump:3.0267 Ang R2.CG and K4.N T0191 45 :DNNIIIANRTVEKAEALAKEIA 1lehA 196 :GAKLVVTDVNKAAVSAAVAEEG Fragment has 8 clashes (null) has 8 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 24 residues other bump:3.11539 Ang I7.CB and L18.CD2 other bump:2.58444 Ang I7.CG1 and L18.CD2 other bump:2.71513 Ang I7.CG2 and L18.CD2 other bump:1.70006 Ang I7.CD1 and L18.CD2 other bump:2.26079 Ang I7.CD1 and L18.CG other bump:2.56771 Ang T11.OG1 and K14.CD neighbor-bump: 2.75631 Ang I7.CG2 and A8.N other bump:2.90617 Ang I5.CG2 and I7.CG1 T0191 74 :GEEVKFSGLD 1lehA 218 :ADAVAPNAIY Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 12 residues neighbor-bump: 2.32653 Ang F7.CE1 and S8.OG neighbor-bump: 2.78795 Ang F7.CZ and S8.OG T0191 86 :LDGVDIIINATPIGMY 1lehA 228 :GVTCDIFAPCALGAVL Fragment has 15 clashes (null) has 15 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 18 residues other bump:1.83879 Ang N10.CG and Y17.OH other bump:1.03919 Ang N10.OD1 and Y17.OH other bump:3.0575 Ang N10.ND2 and Y17.CZ other bump:2.35184 Ang N10.CG and Y17.CZ other bump:1.18894 Ang N10.OD1 and Y17.CZ other bump:2.49254 Ang N10.OD1 and Y17.CE2 other bump:2.55707 Ang N10.CG and Y17.CE1 other bump:1.62048 Ang N10.OD1 and Y17.CE1 other bump:2.95145 Ang N10.OD1 and Y17.CD1 other bump:2.54485 Ang P13.O and M16.SD neighbor-bump: 2.46359 Ang I14.CG2 and G15.N neighbor-bump: 2.35923 Ang T12.CG2 and P13.CD neighbor-bump: 2.36174 Ang T12.CB and P13.CD neighbor-bump: 3.12853 Ang T12.CG2 and P13.CG self-bump: 1.33108 Ang T12.CA and T12.CB T0191 108 :PIVKAEKLREDMVVMDLIYNPLETVLLKEAKKVNAKTINGL 1lehA 244 :NDFTIPQLKAKVIAGSADNQLKDPRHGKYLHELGIVYAPDY Fragment has 18 clashes (null) has 18 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 43 residues other bump:2.397 Ang V15.CG2 and I39.CD1 other bump:2.87165 Ang V15.CG2 and I39.CG1 other bump:2.9935 Ang M13.CE and K37.CE other bump:2.73857 Ang M13.CE and K37.CD other bump:2.71903 Ang T25.O and L28.CB other bump:3.2229 Ang P2.CA and L27.CD2 other bump:2.263 Ang G1.O and L27.CD1 other bump:2.88863 Ang P2.CB and L23.CD1 neighbor-bump: 2.90505 Ang I19.CG2 and Y20.CE1 neighbor-bump: 2.55798 Ang I19.CG2 and Y20.CD1 other bump:2.98844 Ang M16.CE and L18.CD1 neighbor-bump: 2.43774 Ang V14.O and V15.CG2 neighbor-bump: 2.86917 Ang V14.C and V15.CG2 other bump:2.23643 Ang V4.CG1 and K8.NZ other bump:2.81898 Ang V4.C and K8.NZ other bump:3.00227 Ang I3.CD1 and E7.OE2 other bump:1.78754 Ang I3.O and E7.OE1 neighbor-bump: 1.93376 Ang G1.C and P2.CD Number of specific fragments= 6 total=440 Number of alignments=78 # 1lldA read from T0191.t2k-2track-undertaker.a2m # adding 1lldA to template set 1lldA:# found chain 1lldA in template set T0191 24 :KNIVIYGAGGAARAVAFELAK 1lldA 8 :TKLAVIGAGAVGSTLAFAAAQ Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 23 residues other bump:2.78551 Ang F18.CZ and K22.CE other bump:3.24898 Ang A9.C and R14.CG other bump:2.46996 Ang I6.CD1 and A13.O other bump:1.8364 Ang G8.O and A13.CB other bump:2.97657 Ang G8.C and A13.CB T0191 45 :DN 1lldA 30 :GI Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues T0191 47 :NIIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVE 1lldA 34 :EIVLEDIAKERVEAEVLDMQHGSSFYPTVSIDGSDDPEICRDADMVVITAGPRQKPGQSRL Fragment has 54 clashes (null) has 54 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 63 residues other bump:2.36197 Ang Y56.CB and I59.CD1 other bump:2.13849 Ang Y56.CB and I59.CG1 neighbor-bump: 2.02412 Ang T51.C and P52.CD other bump:2.28604 Ang A50.O and P52.CD other bump:2.97728 Ang V44.CG1 and I46.C other bump:2.22181 Ang V44.CG1 and I46.O other bump:2.55235 Ang I4.CD1 and D40.O other bump:2.39257 Ang S35.CB and D40.OD2 other bump:1.56752 Ang S35.OG and D40.OD2 other bump:2.64817 Ang S35.OG and D40.CG other bump:3.07285 Ang L37.CD2 and V39.CB other bump:2.52213 Ang A13.C and F34.CZ other bump:2.72188 Ang A17.N and F34.CZ other bump:2.89347 Ang A17.CA and F34.CZ other bump:1.63421 Ang A13.O and F34.CZ other bump:2.1361 Ang A17.CB and F34.CZ other bump:2.80664 Ang E14.N and F34.CZ other bump:2.6512 Ang E14.O and F34.CZ other bump:2.45923 Ang E14.CA and F34.CZ other bump:2.57438 Ang E14.C and F34.CZ other bump:2.2963 Ang A17.N and F34.CE2 other bump:1.91269 Ang A17.CA and F34.CE2 other bump:2.47268 Ang A13.O and F34.CE2 other bump:0.93555 Ang A17.CB and F34.CE2 other bump:3.09095 Ang A17.C and F34.CE2 other bump:2.96161 Ang A13.CA and F34.CE1 other bump:1.65956 Ang A13.C and F34.CE1 other bump:1.34713 Ang A13.O and F34.CE1 other bump:1.95122 Ang E14.N and F34.CE1 other bump:2.15291 Ang E14.CA and F34.CE1 other bump:2.98579 Ang E14.C and F34.CE1 other bump:2.8021 Ang A17.CA and F34.CD2 other bump:1.79274 Ang A17.CB and F34.CD2 other bump:2.84822 Ang A13.CB and F34.CD1 other bump:2.40752 Ang A13.C and F34.CD1 other bump:2.10559 Ang A13.O and F34.CD1 other bump:2.98969 Ang E14.N and F34.CD1 other bump:3.05098 Ang A17.CB and F34.CG other bump:2.82646 Ang I5.CB and F34.CB other bump:1.91443 Ang I3.CD1 and E30.OE2 other bump:2.77686 Ang I3.CD1 and E30.CD other bump:3.15379 Ang N25.CA and F28.CZ other bump:2.47115 Ang N25.O and F28.CZ other bump:3.17244 Ang N25.C and F28.CZ other bump:2.52356 Ang N25.O and F28.CE2 other bump:2.60891 Ang N25.CA and F28.CE1 other bump:2.96797 Ang N25.CB and F28.CE1 other bump:3.17899 Ang N25.C and F28.CE1 other bump:2.50185 Ang A21.O and L24.CD1 other bump:3.1374 Ang A21.CA and L24.CG other bump:2.47402 Ang A21.O and L24.CG other bump:3.14496 Ang A21.C and L24.CG other bump:2.48573 Ang N7.CG and T9.OG1 other bump:1.49183 Ang N7.OD1 and T9.OG1 Number of specific fragments= 3 total=443 Number of alignments=79 # 1pjbA read from T0191.t2k-2track-undertaker.a2m # found chain 1pjbA in template set T0191 7 :GIGARMALEEEIGR 1pjbA 142 :QFGARFLERQQGGR Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 16 residues neighbor-bump: 2.35254 Ang E12.O and I13.CD1 neighbor-bump: 1.89109 Ang E12.O and I13.CG1 neighbor-bump: 2.50232 Ang E12.C and I13.CG1 neighbor-bump: 1.87766 Ang E12.O and I13.CB neighbor-bump: 2.40335 Ang E12.C and I13.CB T0191 21 :VKDKNIVIYGAGGAARAVAFELAK 1pjbA 165 :VKPGKVVILGGGVVGTEAAKMAVG Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 26 residues other bump:2.87104 Ang I7.CD1 and L23.CD2 other bump:2.48007 Ang I7.CG1 and L23.CD1 other bump:1.07324 Ang I7.CD1 and L23.CD1 other bump:2.03151 Ang I7.CD1 and L23.CG other bump:2.39615 Ang I7.CD1 and L23.CB other bump:1.92836 Ang G11.O and A16.CB other bump:2.95158 Ang G11.C and A16.CB T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLN 1pjbA 190 :GAQVQIFDINVERLSYLETLFGSRVE Fragment has 19 clashes (null) has 19 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:2.94969 Ang I22.CD1 and L26.CD2 other bump:2.86667 Ang I5.CD1 and L26.CD2 other bump:2.7084 Ang I5.CG1 and L26.CD1 other bump:2.69185 Ang I5.CD1 and L26.CD1 other bump:2.68568 Ang I5.CG1 and L26.CG other bump:2.55449 Ang I5.CD1 and L26.CG self-bump: 2.20268 Ang A23.CB and A23.C self-bump: 1.22982 Ang A23.CA and A23.CB other bump:1.69946 Ang V12.CG1 and E16.OE2 other bump:1.09857 Ang V12.O and E16.OE1 other bump:1.78251 Ang V12.C and E16.OE1 other bump:2.24801 Ang E13.N and E16.OE1 other bump:2.29401 Ang E13.CA and E16.OE1 other bump:2.77824 Ang E13.C and E16.OE1 other bump:1.88968 Ang V12.O and E16.CD other bump:2.64365 Ang V12.C and E16.CD other bump:2.76124 Ang V12.CG1 and E16.CD other bump:2.98556 Ang N3.CG and I5.CG2 other bump:1.94842 Ang N3.ND2 and I5.CG2 T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLREDMVVMDLIY 1pjbA 216 :LLYSNSAEIETAVAEADLLIGAVLVPGRRAPILVPASLVEQMRTGSVIVDVAV Fragment has 41 clashes (null) has 41 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 55 residues other bump:2.62164 Ang T24.N and I53.CD1 other bump:2.72237 Ang T24.CA and I53.CD1 other bump:1.83179 Ang T24.C and I53.CD1 other bump:2.54505 Ang P25.N and I53.CD1 other bump:2.42416 Ang P25.CG and I53.CD1 other bump:2.88348 Ang P25.CD and I53.CD1 other bump:2.9826 Ang P25.CA and I53.CD1 other bump:3.02195 Ang P25.CB and I53.CD1 other bump:3.01 Ang T24.OG1 and I53.CD1 other bump:1.39498 Ang T24.O and I53.CD1 other bump:2.27341 Ang P25.CG and I53.CG1 other bump:2.56688 Ang P25.CB and I53.CG1 other bump:2.30318 Ang N22.CG and D51.OD2 other bump:1.41777 Ang N22.OD1 and D51.OD2 other bump:2.6915 Ang N22.CB and D51.OD1 other bump:2.41436 Ang N22.CG and D51.OD1 other bump:2.49701 Ang N22.CB and D51.CG other bump:2.42431 Ang N22.CG and D51.CG other bump:2.1063 Ang N22.OD1 and D51.CG other bump:3.11224 Ang N22.CB and D51.CB other bump:3.23977 Ang N22.CB and D51.CA other bump:3.03327 Ang I20.CG1 and V49.CG1 other bump:3.04491 Ang I20.CD1 and V49.CG1 other bump:1.36164 Ang V17.O and M47.CE other bump:2.3306 Ang V17.C and M47.CE other bump:2.41025 Ang V17.O and M47.SD other bump:3.08109 Ang D18.CA and M47.SD other bump:2.74048 Ang D18.O and M47.SD other bump:2.69265 Ang D18.C and M47.SD other bump:2.13005 Ang D15.OD1 and K42.O other bump:2.55501 Ang L14.CB and K39.NZ other bump:2.85577 Ang L14.CB and K39.CE other bump:2.63275 Ang D33.OD1 and E35.C other bump:3.03091 Ang L14.CD1 and E35.OE2 other bump:2.89138 Ang I20.CD1 and E35.OE1 self-bump: 1.34334 Ang M28.CA and M28.CB other bump:2.72802 Ang A23.C and P25.CD other bump:2.55923 Ang V17.CG1 and I20.CG2 other bump:2.87573 Ang V17.CG1 and I19.C other bump:2.67136 Ang V17.CG1 and I19.O other bump:2.76978 Ang V5.CG1 and L10.CD1 Number of specific fragments= 4 total=447 Number of alignments=80 # 1pjcA read from T0191.t2k-2track-undertaker.a2m # found chain 1pjcA in template set T0191 6 :DGIGARMALEEEIGR 1pjcA 141 :VQFGARFLERQQGGR Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 17 residues neighbor-bump: 2.62306 Ang E13.O and I14.CD1 neighbor-bump: 2.21345 Ang E13.O and I14.CG1 neighbor-bump: 2.63699 Ang E13.C and I14.CG1 neighbor-bump: 1.9745 Ang E13.O and I14.CB neighbor-bump: 2.43438 Ang E13.C and I14.CB T0191 21 :VKDKNIVIYGAGGAARAVAFELAK 1pjcA 165 :VKPGKVVILGGGVVGTEAAKMAVG Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 26 residues other bump:2.70113 Ang I7.CD1 and L23.CD2 other bump:2.51188 Ang I7.CG1 and L23.CD1 other bump:1.10707 Ang I7.CD1 and L23.CD1 other bump:1.96604 Ang I7.CD1 and L23.CG other bump:2.36271 Ang I7.CD1 and L23.CB other bump:1.86201 Ang G11.O and A16.CB other bump:2.86011 Ang G11.C and A16.CB T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLN 1pjcA 190 :GAQVQIFDINVERLSYLETLFGSRVE Fragment has 17 clashes (null) has 17 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:2.82109 Ang I22.CD1 and L26.CD2 other bump:2.87292 Ang I5.CD1 and L26.CD2 other bump:2.54449 Ang I5.CG1 and L26.CD1 other bump:2.47902 Ang I5.CD1 and L26.CD1 other bump:2.67771 Ang I5.CG1 and L26.CG other bump:2.50607 Ang I5.CD1 and L26.CG self-bump: 2.21466 Ang A23.CB and A23.C self-bump: 1.23794 Ang A23.CA and A23.CB other bump:1.89358 Ang V12.CG1 and E16.OE2 other bump:1.30061 Ang V12.O and E16.OE1 other bump:2.01321 Ang V12.C and E16.OE1 other bump:2.34526 Ang E13.CA and E16.OE1 other bump:2.11374 Ang V12.O and E16.CD other bump:2.88633 Ang V12.C and E16.CD other bump:2.89138 Ang V12.CG1 and E16.CD other bump:2.91217 Ang N3.CG and I5.CG2 other bump:1.91995 Ang N3.ND2 and I5.CG2 T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLREDMVVMDLIY 1pjcA 216 :LLYSNSAEIETAVAEADLLIGAVLVPGRRAPILVPASLVEQMRTGSVIVDVAV Fragment has 60 clashes (null) has 60 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 55 residues other bump:2.47383 Ang A23.C and I53.CD1 other bump:1.70319 Ang T24.N and I53.CD1 other bump:2.48239 Ang A23.N and I53.CD1 other bump:2.62884 Ang A23.CA and I53.CD1 other bump:2.78794 Ang T24.CA and I53.CD1 other bump:2.18911 Ang N22.ND2 and I53.CD1 other bump:2.82658 Ang T24.N and I53.CG1 other bump:3.16951 Ang N22.ND2 and I53.CG1 other bump:2.22384 Ang N22.CB and D51.OD2 other bump:2.12652 Ang N22.CG and D51.OD2 other bump:1.83036 Ang N22.OD1 and D51.OD1 other bump:2.52796 Ang N22.CB and D51.CG other bump:2.57643 Ang N22.CG and D51.CG other bump:2.19514 Ang N22.OD1 and D51.CG other bump:3.15042 Ang N22.CB and D51.CA other bump:3.02336 Ang I20.CG1 and V49.CG1 other bump:3.00794 Ang I20.CD1 and V49.CG1 other bump:0.885492 Ang V17.O and M47.CE other bump:2.06576 Ang V17.C and M47.CE other bump:2.08315 Ang V17.O and M47.SD other bump:2.68608 Ang V17.C and M47.SD other bump:2.74619 Ang D18.CA and M47.SD other bump:2.55118 Ang D18.O and M47.SD other bump:2.46645 Ang D18.C and M47.SD other bump:2.58219 Ang L14.O and L43.CD2 other bump:2.16854 Ang D15.OD1 and K42.O other bump:2.74141 Ang L14.CB and K39.NZ other bump:2.81738 Ang D33.OD1 and E35.C other bump:2.45887 Ang L14.CD1 and E35.OE2 neighbor-bump: 2.83758 Ang Y29.CD2 and P30.C neighbor-bump: 1.7655 Ang Y29.CD2 and P30.O neighbor-bump: 2.40903 Ang Y29.CE2 and P30.O other bump:2.79301 Ang I26.CA and Y29.OH other bump:1.40781 Ang I26.CB and Y29.OH other bump:1.87505 Ang I26.CG1 and Y29.OH other bump:2.11198 Ang I26.CG2 and Y29.OH other bump:1.85864 Ang I26.CD1 and Y29.OH other bump:2.96035 Ang I26.CA and Y29.CZ other bump:1.49795 Ang I26.CB and Y29.CZ other bump:1.76954 Ang I26.CG1 and Y29.CZ other bump:1.25798 Ang I26.CG2 and Y29.CZ other bump:1.81553 Ang I26.CD1 and Y29.CZ other bump:2.46327 Ang I26.CB and Y29.CE2 other bump:3.11928 Ang I26.CG1 and Y29.CE2 other bump:1.2137 Ang I26.CG2 and Y29.CE2 other bump:2.08915 Ang I26.CB and Y29.CE1 other bump:1.35619 Ang I26.CG1 and Y29.CE1 other bump:2.12197 Ang I26.CG2 and Y29.CE1 other bump:1.70083 Ang I26.CD1 and Y29.CE1 other bump:2.06228 Ang I26.CG2 and Y29.CD2 other bump:2.68452 Ang I26.CG1 and Y29.CD1 other bump:2.70559 Ang I26.CG2 and Y29.CD1 other bump:2.71812 Ang I26.CG2 and Y29.CG neighbor-bump: 1.80648 Ang T24.C and P25.CD neighbor-bump: 2.44044 Ang T24.CA and P25.CD neighbor-bump: 2.66854 Ang T24.C and P25.CG other bump:2.68906 Ang V17.CG1 and I20.CG2 other bump:2.87441 Ang V17.CG1 and I19.C other bump:2.61781 Ang V17.CG1 and I19.O other bump:2.83154 Ang F7.CD1 and D11.OD2 Number of specific fragments= 4 total=451 Number of alignments=81 # 1qp8A read from T0191.t2k-2track-undertaker.a2m # adding 1qp8A to template set 1qp8A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # found chain 1qp8A in template set T0191 13 :ALEEEIGR 1qp8A 107 :KMKRGDYG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 10 residues T0191 21 :VKDKNIVIYGAGGAARAVAFELAK 1qp8A 122 :IQGEKVAVLGLGEIGTRVGKILAA Fragment has 18 clashes (null) has 18 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 26 residues other bump:2.78528 Ang I7.CD1 and L23.CD1 other bump:2.07461 Ang R17.NH2 and F21.CZ other bump:2.95404 Ang R17.CZ and F21.CZ other bump:1.37226 Ang R17.NH2 and F21.CE1 other bump:2.43772 Ang R17.CZ and F21.CE1 other bump:2.56308 Ang R17.NH2 and F21.CD1 other bump:2.85494 Ang I9.CD1 and A20.CB other bump:3.10252 Ang I9.CD1 and A20.CA other bump:2.42952 Ang G13.N and R17.CG other bump:2.64503 Ang G13.CA and R17.CG other bump:2.75808 Ang I9.CD1 and A16.O other bump:2.99942 Ang A12.CA and A16.CB other bump:1.83506 Ang G11.O and A16.CB other bump:2.79074 Ang G11.C and A16.CB self-bump: 1.28328 Ang Y10.CA and Y10.CB neighbor-bump: 2.12629 Ang V8.O and I9.CG2 neighbor-bump: 2.61478 Ang V8.C and I9.CG2 other bump:2.49709 Ang G1.O and K5.CG T0191 45 :DNNIIIANRT 1qp8A 147 :GAQVRGFSRT Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 12 residues T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYP 1qp8A 160 :GPWRFTNSLEEALREARAAVCALPLNKHT Fragment has 21 clashes (null) has 21 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 31 residues neighbor-bump: 2.40882 Ang Y29.N and P30.CD neighbor-bump: 2.0835 Ang Y29.C and P30.CD self-bump: 1.35033 Ang P30.N and P30.CD self-bump: 2.21744 Ang P30.N and P30.CG other bump:2.15157 Ang L14.CD2 and I20.CD1 other bump:3.14712 Ang L14.CD2 and I20.CG1 other bump:2.37316 Ang V17.CG1 and I19.O neighbor-bump: 2.33601 Ang D18.O and I19.CG2 neighbor-bump: 2.93135 Ang D18.C and I19.CG2 other bump:2.08972 Ang D13.O and V17.CG2 other bump:3.06257 Ang L14.CA and V17.CG2 other bump:2.9722 Ang L14.C and V17.CG2 other bump:2.98178 Ang D13.C and V17.CG2 other bump:1.91232 Ang F7.CD1 and D13.OD1 other bump:2.42158 Ang F7.CE1 and D13.OD1 other bump:2.24794 Ang F7.CG and D13.OD1 neighbor-bump: 2.26699 Ang V12.O and D13.CG other bump:3.06226 Ang F7.CG and D13.CG self-bump: 1.39192 Ang V12.CA and V12.CB other bump:2.63611 Ang V5.O and F7.CE1 neighbor-bump: 2.51403 Ang E3.O and E4.CG T0191 104 :IDVEPIVKAEKLREDMVVMDLIYNPLE 1qp8A 189 :RGLVKYQHLALMAEDAVFVNVGRAEVL Fragment has 31 clashes (null) has 31 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 29 residues other bump:2.808 Ang E5.CG and E28.OE2 other bump:2.63212 Ang E5.CB and E28.OE2 other bump:2.00524 Ang E5.CG and E28.OE1 other bump:2.11743 Ang E5.CB and E28.OE1 other bump:2.73562 Ang E5.CG and E28.CD other bump:2.63041 Ang E5.CB and E28.CD other bump:3.00843 Ang L13.CG and M17.CE other bump:1.83666 Ang L13.CD2 and M17.CE other bump:3.1062 Ang L13.CD2 and M17.SD other bump:1.1277 Ang V8.CA and E11.OE2 other bump:1.85603 Ang V8.O and E11.OE2 other bump:1.64279 Ang V8.C and E11.OE2 other bump:2.07719 Ang V8.CB and E11.OE2 other bump:2.39866 Ang V8.CG1 and E11.OE2 other bump:2.44848 Ang V8.N and E11.OE2 other bump:2.08391 Ang V8.CA and E11.OE1 other bump:2.12494 Ang V8.C and E11.OE1 other bump:0.958285 Ang I7.O and E11.OE1 other bump:2.03404 Ang V8.N and E11.OE1 other bump:1.60575 Ang I7.C and E11.OE1 other bump:1.75932 Ang V8.CA and E11.CD other bump:1.83152 Ang V8.O and E11.CD other bump:1.83348 Ang V8.C and E11.CD other bump:2.21269 Ang I7.O and E11.CD other bump:2.5016 Ang V8.N and E11.CD other bump:2.65216 Ang I7.C and E11.CD other bump:3.19515 Ang V8.CA and E11.CG other bump:2.36619 Ang V8.O and E11.CG other bump:3.02574 Ang V8.C and E11.CG other bump:2.59745 Ang E5.OE1 and K9.CB other bump:2.90574 Ang G1.C and V4.CG2 T0191 131 :TVLLKEAK 1qp8A 218 :DGVLRILK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 10 residues Number of specific fragments= 6 total=457 Number of alignments=82 # 1sayA read from T0191.t2k-2track-undertaker.a2m # found chain 1sayA in template set T0191 6 :DGIGARMALEEEIGR 1sayA 141 :VQFGARFLERQQGGR Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 17 residues neighbor-bump: 2.40439 Ang E13.O and I14.CD1 neighbor-bump: 1.9122 Ang E13.O and I14.CG1 neighbor-bump: 2.5899 Ang E13.C and I14.CG1 neighbor-bump: 2.03206 Ang E13.O and I14.CB neighbor-bump: 2.51803 Ang E13.C and I14.CB neighbor-bump: 3.23064 Ang R7.NE and M8.CE T0191 21 :VKDKNIVIYGAGGAARAVAFELAK 1sayA 165 :VKPGKVVILGGGVVGTEAAKMAVG Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 26 residues other bump:2.56061 Ang I7.CD1 and L23.CD2 other bump:2.48157 Ang I7.CG1 and L23.CD1 other bump:1.10128 Ang I7.CD1 and L23.CD1 other bump:1.86376 Ang I7.CD1 and L23.CG other bump:2.28339 Ang I7.CD1 and L23.CB other bump:1.86192 Ang G11.O and A16.CB other bump:2.91693 Ang G11.C and A16.CB T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLN 1sayA 190 :GAQVQIFDINVERLSYLETLFGSRVE Fragment has 19 clashes (null) has 19 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:2.98708 Ang I22.CD1 and L26.CD2 other bump:2.54972 Ang I5.CD1 and L26.CD2 other bump:2.38607 Ang I5.CD1 and L26.CD1 other bump:2.46588 Ang I5.CG1 and L26.CD1 other bump:2.24959 Ang I5.CD1 and L26.CG other bump:2.47498 Ang I5.CG1 and L26.CG self-bump: 2.21791 Ang A23.CB and A23.C self-bump: 1.22414 Ang A23.CA and A23.CB other bump:1.70685 Ang V12.CG1 and E16.OE2 other bump:1.12933 Ang V12.O and E16.OE1 other bump:1.88395 Ang V12.C and E16.OE1 other bump:2.3869 Ang E13.CA and E16.OE1 other bump:1.91758 Ang V12.O and E16.CD other bump:2.73332 Ang V12.C and E16.CD other bump:2.75496 Ang V12.CG1 and E16.CD other bump:1.45654 Ang N9.OD1 and T11.OG1 other bump:2.45045 Ang N9.CG and T11.OG1 other bump:2.92142 Ang N3.CG and I5.CG2 other bump:1.96143 Ang N3.ND2 and I5.CG2 T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLREDMVVMDLIY 1sayA 216 :LLYSNSAEIETAVAEADLLIGAVLVPGRRAPILVPASLVEQMRTGSVIVDVAV Fragment has 42 clashes (null) has 42 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 55 residues other bump:2.51253 Ang T24.N and I53.CD1 other bump:2.05606 Ang T24.C and I53.CD1 other bump:2.93499 Ang P25.N and I53.CD1 other bump:2.6843 Ang T24.CA and I53.CD1 other bump:2.99341 Ang T24.CB and I53.CD1 other bump:2.54819 Ang T24.OG1 and I53.CD1 other bump:1.58666 Ang T24.O and I53.CD1 other bump:3.04979 Ang T24.C and I53.CG1 other bump:2.76659 Ang N22.CB and D51.OD2 other bump:2.23101 Ang N22.CG and D51.OD2 other bump:1.36216 Ang N22.OD1 and D51.OD2 other bump:2.65553 Ang N22.CB and D51.OD1 other bump:2.42288 Ang N22.CG and D51.OD1 other bump:2.46217 Ang N22.CB and D51.CG other bump:2.39239 Ang N22.CG and D51.CG other bump:2.11572 Ang N22.OD1 and D51.CG other bump:3.07608 Ang N22.CB and D51.CB other bump:3.25209 Ang N22.CB and D51.CA other bump:2.70117 Ang I20.CG2 and V49.CG1 other bump:2.47352 Ang L43.CD2 and M47.CE other bump:2.86871 Ang L43.CG and M47.SD other bump:2.20917 Ang L43.CD2 and M47.SD other bump:2.95067 Ang L43.CD1 and M47.SD other bump:2.83464 Ang D15.OD1 and K42.C other bump:2.10641 Ang D15.OD1 and K42.O other bump:2.36746 Ang L14.CG and K39.NZ other bump:2.51947 Ang L14.CB and K39.NZ other bump:1.70521 Ang L14.CD1 and K39.NZ other bump:2.27098 Ang E35.CD and K39.NZ other bump:1.37195 Ang E35.OE2 and K39.NZ other bump:2.40629 Ang L14.CG and K39.CE other bump:2.66309 Ang L14.CB and K39.CE other bump:1.29673 Ang L14.CD1 and K39.CE other bump:2.74995 Ang L14.CD1 and K39.CD other bump:2.62443 Ang D33.OD1 and E35.C other bump:3.00272 Ang I20.CD1 and E35.OE2 other bump:2.91817 Ang L14.CD1 and E35.OE2 self-bump: 1.34485 Ang M28.CA and M28.CB other bump:2.81175 Ang A23.C and P25.CD other bump:2.50518 Ang L14.CD2 and I20.CD1 other bump:2.83688 Ang V17.CG1 and I19.C other bump:2.60825 Ang V17.CG1 and I19.O Number of specific fragments= 4 total=461 Number of alignments=83 # 1ybvA read from T0191.t2k-2track-undertaker.a2m # found chain 1ybvA in template set T0191 18 :IGRVKDKNIVIYGAG 1ybvA 24 :SASLEGKVALVTGAG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 17 residues T0191 33 :GAARAVAFELAK 1ybvA 40 :GIGREMAMELGR Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:2.6813 Ang R5.NE and F9.CE2 T0191 45 :DNNIIIANRT 1ybvA 53 :GCKVIVNYAN Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 12 residues self-bump: 1.3821 Ang R10.CA and R10.CB T0191 55 :VEKAEALAKEIAEKLNKKFGEEVK 1ybvA 64 :TESAEEVVAAIKKNGSDAACVKAN Fragment has 21 clashes (null) has 21 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 26 residues neighbor-bump: 2.91478 Ang E23.C and V24.CG2 neighbor-bump: 2.53248 Ang E23.O and V24.CG2 other bump:1.53548 Ang L8.O and K19.NZ other bump:2.03666 Ang L8.C and K19.NZ other bump:2.14856 Ang A9.N and K19.NZ other bump:1.81125 Ang A9.CA and K19.NZ other bump:2.11459 Ang K10.N and K19.NZ other bump:1.87903 Ang A9.O and K19.NZ other bump:1.39854 Ang A9.C and K19.NZ other bump:2.85306 Ang A9.N and K19.CE other bump:1.72317 Ang A9.CA and K19.CE other bump:2.83049 Ang A9.CB and K19.CE other bump:2.78008 Ang K10.N and K19.CE other bump:1.25267 Ang A9.O and K19.CE other bump:1.48483 Ang A9.C and K19.CE other bump:2.92861 Ang A9.N and K19.CD other bump:1.96387 Ang A9.CA and K19.CD other bump:2.79173 Ang A9.CB and K19.CD other bump:2.72578 Ang A9.C and K19.CD other bump:2.9624 Ang A9.CA and K19.CG other bump:3.06467 Ang A9.CB and K19.CG T0191 79 :FSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEK 1ybvA 98 :FEEAVKIFGKLDIVCSNSGVVSFGHVKDVTPEEFDR Fragment has 34 clashes (null) has 34 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 38 residues other bump:2.52242 Ang I21.CD1 and K37.CE other bump:2.55481 Ang I27.CA and E30.OE2 other bump:2.53492 Ang N26.C and E30.OE2 other bump:2.37338 Ang N26.O and E30.OE2 other bump:2.28662 Ang I27.CA and E30.OE1 other bump:2.99891 Ang I27.CD1 and E30.OE1 other bump:1.4715 Ang I27.O and E30.OE1 other bump:2.05097 Ang I27.C and E30.OE1 other bump:2.75014 Ang I27.CA and E30.CD other bump:2.98542 Ang I27.C and E30.CD other bump:1.71953 Ang N26.CG and D28.OD1 other bump:0.823298 Ang N26.OD1 and D28.OD1 other bump:2.41049 Ang N26.CB and D28.OD1 other bump:2.84032 Ang N26.CG and D28.CG other bump:1.84714 Ang N26.OD1 and D28.CG neighbor-bump: 2.63947 Ang Y24.N and P25.CD neighbor-bump: 2.07167 Ang Y24.CA and P25.CD neighbor-bump: 1.11153 Ang Y24.C and P25.CD neighbor-bump: 1.67303 Ang Y24.O and P25.CD neighbor-bump: 2.36997 Ang Y24.C and P25.CG neighbor-bump: 2.22951 Ang Y24.O and P25.CG neighbor-bump: 2.63691 Ang Y24.C and P25.CB neighbor-bump: 2.15787 Ang T19.O and P20.CD neighbor-bump: 1.33716 Ang T19.C and P20.CD other bump:2.09619 Ang A18.O and P20.CD other bump:2.72974 Ang A18.C and P20.CD neighbor-bump: 2.01921 Ang T19.CA and P20.CD neighbor-bump: 2.2784 Ang T19.O and P20.CG neighbor-bump: 2.23718 Ang T19.C and P20.CG other bump:2.14038 Ang A18.O and P20.CG other bump:3.18769 Ang A18.C and P20.CG other bump:2.771 Ang D6.OD1 and V12.CG2 self-bump: 1.39746 Ang D10.CA and D10.CB self-bump: 1.36358 Ang D8.CA and D8.CB Number of specific fragments= 5 total=466 Number of alignments=84 # 2ae2A read from T0191.t2k-2track-undertaker.a2m # found chain 2ae2A in template set T0191 18 :IGRVKDKNIVIYGAG 2ae2A 4 :RWNLEGCTALVTGGS Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 17 residues T0191 33 :GAARAVAFELAK 2ae2A 20 :GIGYGIVEELAS Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:3.06801 Ang R5.CZ and F9.CZ other bump:2.6714 Ang R5.CZ and F9.CE2 other bump:2.64616 Ang R5.NH1 and F9.CE2 other bump:2.9653 Ang R5.NH2 and F9.CE2 T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGLDVD 2ae2A 33 :GASVYTCSRNQKELNDCLTQWRSKGFKVEASVCDLSSRSER Fragment has 20 clashes (null) has 20 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 43 residues other bump:2.39146 Ang V34.CG2 and V41.CG1 other bump:3.16318 Ang K35.N and V41.CG1 other bump:2.95389 Ang R10.CG and K35.CG other bump:2.9691 Ang A8.CB and V34.CG1 other bump:2.43292 Ang V12.CB and E33.OE1 other bump:1.02211 Ang V12.CG2 and E33.OE1 other bump:2.10747 Ang V12.CG2 and E33.CD other bump:2.45283 Ang F30.CZ and E32.OE1 other bump:2.80423 Ang F30.CE2 and E32.OE1 other bump:2.15307 Ang L18.O and K29.NZ other bump:2.86238 Ang L18.C and K29.NZ other bump:2.05807 Ang I22.CB and K29.NZ other bump:1.81182 Ang I22.CG1 and K29.NZ other bump:2.12203 Ang I22.CB and K29.CE other bump:2.78168 Ang I22.CG2 and K29.CE other bump:2.5956 Ang I22.CG1 and K29.CE other bump:3.30762 Ang I22.CG1 and K29.CD other bump:2.79053 Ang I22.CG2 and N27.CB other bump:1.98154 Ang N9.OD1 and T11.OG1 neighbor-bump: 2.54874 Ang I7.CG2 and A8.N T0191 86 :LDGVDIIINATPIGMYPNIDVEPIVKAEK 2ae2A 85 :HGKLNILVNNAGIVIYKEAKDYTVEDYSL Fragment has 24 clashes (null) has 24 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 31 residues other bump:2.68222 Ang P18.CD and K27.NZ other bump:2.23776 Ang P18.CD and K27.CE other bump:2.93081 Ang P18.CD and K27.CD other bump:2.24399 Ang P24.CD and K27.CD other bump:2.71909 Ang P24.CG and K27.CD other bump:2.7245 Ang M16.CE and K27.CG other bump:2.91241 Ang P24.CD and K27.CG other bump:2.65534 Ang P24.CG and K27.CG other bump:2.75589 Ang N19.C and E23.OE2 other bump:2.55602 Ang I20.CA and E23.OE2 other bump:2.57219 Ang I20.CA and E23.OE1 other bump:1.54674 Ang I20.O and E23.OE1 other bump:2.14226 Ang I20.C and E23.OE1 other bump:2.91149 Ang I20.CA and E23.CD other bump:3.04156 Ang I20.C and E23.CD other bump:1.91617 Ang A11.O and P13.CD other bump:2.61628 Ang A11.C and P13.CD neighbor-bump: 2.08529 Ang T12.CA and P13.CD neighbor-bump: 2.20702 Ang T12.O and P13.CD neighbor-bump: 1.40823 Ang T12.C and P13.CD other bump:2.32549 Ang A11.O and P13.CG other bump:3.2525 Ang A11.C and P13.CG neighbor-bump: 2.35516 Ang T12.O and P13.CG neighbor-bump: 2.30821 Ang T12.C and P13.CG Number of specific fragments= 4 total=470 Number of alignments=85 # command:# Prefix for input files set to 1gpjA/ # command:# reading script from file read-alignments.under # Reading fragments from alignment file # T0191 read from 1gpjA-T0191-local-adpstyle1.pw.a2m.gz # 1gpjA read from 1gpjA-T0191-local-adpstyle1.pw.a2m.gz # found chain 1gpjA in template set T0191 1 :IGYNTDGIGARMALEEEIGR 1gpjA 144 :SEGAVSIGSAAVELAERELG Fragment has 17 clashes (null) has 17 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 21 residues neighbor-bump: 2.11824 Ang G19.O and R20.CD neighbor-bump: 2.33735 Ang G19.C and R20.CG neighbor-bump: 1.50873 Ang G19.O and R20.CG neighbor-bump: 2.35133 Ang G19.C and R20.CB neighbor-bump: 1.77853 Ang G19.O and R20.CB other bump:2.76053 Ang L14.CD1 and I18.CD1 other bump:2.6769 Ang N4.ND2 and A10.C other bump:2.21898 Ang N4.ND2 and A10.CB other bump:2.5988 Ang N4.CG and A10.CA other bump:1.28652 Ang N4.ND2 and A10.CA other bump:2.0724 Ang N4.CG and A10.N other bump:1.0823 Ang N4.ND2 and A10.N other bump:2.3736 Ang N4.CG and G9.C other bump:1.85883 Ang N4.ND2 and G9.C other bump:2.83609 Ang N4.OD1 and G9.C other bump:3.118 Ang N4.CG and G9.CA neighbor-bump: 2.60621 Ang G2.O and Y3.CD1 T0191 21 :VKDKNIVIYGAGGAARAVAFELAK 1gpjA 165 :LHDKTVLVVGAGEMGKTVAKSLVD Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 26 residues other bump:2.12325 Ang A18.C and E22.OE1 other bump:1.16878 Ang A18.O and E22.OE1 other bump:2.71002 Ang V19.CA and E22.OE1 other bump:2.97567 Ang A18.C and E22.CD other bump:2.03305 Ang A18.O and E22.CD T0191 47 :NIIIANRTVEKAEALAKEIA 1gpjA 193 :AVLVANRTYERAVELARDLG Fragment has 19 clashes (null) has 19 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 22 residues other bump:3.28619 Ang I3.CG1 and G22.CA neighbor-bump: 2.2506 Ang I20.O and A21.CB neighbor-bump: 2.53375 Ang I20.C and A21.CB other bump:1.44539 Ang I3.CD1 and I20.CG2 other bump:2.89365 Ang I3.CG1 and I20.CG2 other bump:2.80691 Ang I3.CD1 and I20.CB other bump:2.49571 Ang I5.CD1 and A17.CB other bump:2.9766 Ang I5.CG1 and A17.CB other bump:2.28293 Ang I5.CD1 and A17.CA other bump:1.97413 Ang I5.CD1 and A17.N other bump:2.87382 Ang I5.CD1 and L16.C other bump:2.00721 Ang V10.CG1 and E14.OE2 other bump:2.40763 Ang E11.CA and E14.OE1 other bump:1.64561 Ang V10.O and E14.OE1 other bump:2.29284 Ang V10.C and E14.OE1 other bump:2.41272 Ang V10.O and E14.CD other bump:2.99826 Ang V10.CG1 and E14.CD other bump:3.1113 Ang V10.C and E14.CD other bump:2.66759 Ang I5.CD1 and A13.O T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYP 1gpjA 213 :GEAVRFDELVDHLARSDVVVSATAAPHPV Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 31 residues other bump:2.45711 Ang D13.O and V17.CG2 other bump:2.68119 Ang V5.CG2 and D13.OD2 other bump:2.0717 Ang G9.O and D13.OD1 other bump:2.80762 Ang G9.C and D13.OD1 T0191 103 :NIDVEPIVKAEKLREDMVVMDLIYNPLETV 1gpjA 244 :VDDVREALRKRDRRSPILIIDIANPRDVEE Fragment has 18 clashes (null) has 18 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 32 residues other bump:1.52281 Ang V20.CG2 and E29.OE2 other bump:2.68992 Ang V20.CB and E29.OE2 other bump:2.32514 Ang V20.CG2 and E29.CD other bump:2.77381 Ang I24.CG1 and L28.CD2 other bump:1.65862 Ang I24.CD1 and L28.CD2 other bump:2.57874 Ang I24.CG2 and L28.CD1 other bump:2.87153 Ang I24.CB and L28.CG other bump:2.74877 Ang I24.CG2 and L28.CG other bump:2.00364 Ang I24.CG1 and L28.CG other bump:1.505 Ang I24.CD1 and L28.CG other bump:2.79244 Ang I24.CG1 and L28.CB other bump:2.19287 Ang I24.CD1 and L28.CB other bump:3.09048 Ang I24.CG1 and L28.CA other bump:2.23387 Ang I24.CD1 and L28.CA other bump:2.55671 Ang I24.CG1 and L28.N other bump:2.30715 Ang I24.CD1 and L28.N other bump:2.96953 Ang I24.CD1 and P27.C other bump:2.76002 Ang M21.CE and L23.CD1 T0191 133 :LLKEAKKVNAKTINGLGMLIYQGAVAFK 1gpjA 292 :IARENLERRRKEIPKVEKLIEEELSTVE Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 29 residues Number of specific fragments= 6 total=476 Number of alignments=86 # Reading fragments from alignment file # T0191 read from 1gpjA-T0191-local-adpstyle5.pw.a2m.gz # 1gpjA read from 1gpjA-T0191-local-adpstyle5.pw.a2m.gz # found chain 1gpjA in template set T0191 1 :IGYNTDGIGARMALEEEIGR 1gpjA 144 :SEGAVSIGSAAVELAERELG Fragment has 17 clashes (null) has 17 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 21 residues neighbor-bump: 2.11824 Ang G19.O and R20.CD neighbor-bump: 2.33735 Ang G19.C and R20.CG neighbor-bump: 1.50873 Ang G19.O and R20.CG neighbor-bump: 2.35133 Ang G19.C and R20.CB neighbor-bump: 1.77853 Ang G19.O and R20.CB other bump:2.76053 Ang L14.CD1 and I18.CD1 other bump:2.6769 Ang N4.ND2 and A10.C other bump:2.21898 Ang N4.ND2 and A10.CB other bump:2.5988 Ang N4.CG and A10.CA other bump:1.28652 Ang N4.ND2 and A10.CA other bump:2.0724 Ang N4.CG and A10.N other bump:1.0823 Ang N4.ND2 and A10.N other bump:2.3736 Ang N4.CG and G9.C other bump:1.85883 Ang N4.ND2 and G9.C other bump:2.83609 Ang N4.OD1 and G9.C other bump:3.118 Ang N4.CG and G9.CA neighbor-bump: 2.60621 Ang G2.O and Y3.CD1 T0191 21 :VKDKNIVIYGAGGAARAVAFELAK 1gpjA 165 :LHDKTVLVVGAGEMGKTVAKSLVD Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 26 residues other bump:2.12325 Ang A18.C and E22.OE1 other bump:1.16878 Ang A18.O and E22.OE1 other bump:2.71002 Ang V19.CA and E22.OE1 other bump:2.97567 Ang A18.C and E22.CD other bump:2.03305 Ang A18.O and E22.CD T0191 47 :NIIIANRTVEKAEALAKEIA 1gpjA 193 :AVLVANRTYERAVELARDLG Fragment has 19 clashes (null) has 19 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 22 residues other bump:3.28619 Ang I3.CG1 and G22.CA neighbor-bump: 2.2506 Ang I20.O and A21.CB neighbor-bump: 2.53375 Ang I20.C and A21.CB other bump:1.44539 Ang I3.CD1 and I20.CG2 other bump:2.89365 Ang I3.CG1 and I20.CG2 other bump:2.80691 Ang I3.CD1 and I20.CB other bump:2.49571 Ang I5.CD1 and A17.CB other bump:2.9766 Ang I5.CG1 and A17.CB other bump:2.28293 Ang I5.CD1 and A17.CA other bump:1.97413 Ang I5.CD1 and A17.N other bump:2.87382 Ang I5.CD1 and L16.C other bump:2.00721 Ang V10.CG1 and E14.OE2 other bump:2.40763 Ang E11.CA and E14.OE1 other bump:1.64561 Ang V10.O and E14.OE1 other bump:2.29284 Ang V10.C and E14.OE1 other bump:2.41272 Ang V10.O and E14.CD other bump:2.99826 Ang V10.CG1 and E14.CD other bump:3.1113 Ang V10.C and E14.CD other bump:2.66759 Ang I5.CD1 and A13.O T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYP 1gpjA 213 :GEAVRFDELVDHLARSDVVVSATAAPHPV Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 31 residues other bump:2.45711 Ang D13.O and V17.CG2 other bump:2.68119 Ang V5.CG2 and D13.OD2 other bump:2.0717 Ang G9.O and D13.OD1 other bump:2.80762 Ang G9.C and D13.OD1 T0191 103 :NIDVEPIVKAEKLREDMVVMDLIYNPLETV 1gpjA 244 :VDDVREALRKRDRRSPILIIDIANPRDVEE Fragment has 18 clashes (null) has 18 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 32 residues other bump:1.52281 Ang V20.CG2 and E29.OE2 other bump:2.68992 Ang V20.CB and E29.OE2 other bump:2.32514 Ang V20.CG2 and E29.CD other bump:2.77381 Ang I24.CG1 and L28.CD2 other bump:1.65862 Ang I24.CD1 and L28.CD2 other bump:2.57874 Ang I24.CG2 and L28.CD1 other bump:2.87153 Ang I24.CB and L28.CG other bump:2.74877 Ang I24.CG2 and L28.CG other bump:2.00364 Ang I24.CG1 and L28.CG other bump:1.505 Ang I24.CD1 and L28.CG other bump:2.79244 Ang I24.CG1 and L28.CB other bump:2.19287 Ang I24.CD1 and L28.CB other bump:3.09048 Ang I24.CG1 and L28.CA other bump:2.23387 Ang I24.CD1 and L28.CA other bump:2.55671 Ang I24.CG1 and L28.N other bump:2.30715 Ang I24.CD1 and L28.N other bump:2.96953 Ang I24.CD1 and P27.C other bump:2.76002 Ang M21.CE and L23.CD1 T0191 133 :LLKEAKKVNAKTINGLGMLIYQGAVAFK 1gpjA 292 :IARENLERRRKEIPKVEKLIEEELSTVE Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 29 residues Number of specific fragments= 6 total=482 Number of alignments=87 # Reading fragments from alignment file # T0191 read from 1gpjA-T0191-vit-adpstyle1.pw.a2m.gz # 1gpjA read from 1gpjA-T0191-vit-adpstyle1.pw.a2m.gz # found chain 1gpjA in template set T0191 1 :IGYNTDGIGARMALEEEIGR 1gpjA 144 :SEGAVSIGSAAVELAERELG Fragment has 17 clashes (null) has 17 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 21 residues neighbor-bump: 2.11824 Ang G19.O and R20.CD neighbor-bump: 2.33735 Ang G19.C and R20.CG neighbor-bump: 1.50873 Ang G19.O and R20.CG neighbor-bump: 2.35133 Ang G19.C and R20.CB neighbor-bump: 1.77853 Ang G19.O and R20.CB other bump:2.76053 Ang L14.CD1 and I18.CD1 other bump:2.6769 Ang N4.ND2 and A10.C other bump:2.21898 Ang N4.ND2 and A10.CB other bump:2.5988 Ang N4.CG and A10.CA other bump:1.28652 Ang N4.ND2 and A10.CA other bump:2.0724 Ang N4.CG and A10.N other bump:1.0823 Ang N4.ND2 and A10.N other bump:2.3736 Ang N4.CG and G9.C other bump:1.85883 Ang N4.ND2 and G9.C other bump:2.83609 Ang N4.OD1 and G9.C other bump:3.118 Ang N4.CG and G9.CA neighbor-bump: 2.60621 Ang G2.O and Y3.CD1 T0191 21 :VKDKNIVIYGAGGAARAVAFELAK 1gpjA 165 :LHDKTVLVVGAGEMGKTVAKSLVD Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 26 residues other bump:2.12325 Ang A18.C and E22.OE1 other bump:1.16878 Ang A18.O and E22.OE1 other bump:2.71002 Ang V19.CA and E22.OE1 other bump:2.97567 Ang A18.C and E22.CD other bump:2.03305 Ang A18.O and E22.CD T0191 47 :NIIIANRTVEKAEALAKEIA 1gpjA 193 :AVLVANRTYERAVELARDLG Fragment has 19 clashes (null) has 19 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 22 residues other bump:3.28619 Ang I3.CG1 and G22.CA neighbor-bump: 2.2506 Ang I20.O and A21.CB neighbor-bump: 2.53375 Ang I20.C and A21.CB other bump:1.44539 Ang I3.CD1 and I20.CG2 other bump:2.89365 Ang I3.CG1 and I20.CG2 other bump:2.80691 Ang I3.CD1 and I20.CB other bump:2.49571 Ang I5.CD1 and A17.CB other bump:2.9766 Ang I5.CG1 and A17.CB other bump:2.28293 Ang I5.CD1 and A17.CA other bump:1.97413 Ang I5.CD1 and A17.N other bump:2.87382 Ang I5.CD1 and L16.C other bump:2.00721 Ang V10.CG1 and E14.OE2 other bump:2.40763 Ang E11.CA and E14.OE1 other bump:1.64561 Ang V10.O and E14.OE1 other bump:2.29284 Ang V10.C and E14.OE1 other bump:2.41272 Ang V10.O and E14.CD other bump:2.99826 Ang V10.CG1 and E14.CD other bump:3.1113 Ang V10.C and E14.CD other bump:2.66759 Ang I5.CD1 and A13.O T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYP 1gpjA 213 :GEAVRFDELVDHLARSDVVVSATAAPHPV Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 31 residues other bump:2.45711 Ang D13.O and V17.CG2 other bump:2.68119 Ang V5.CG2 and D13.OD2 other bump:2.0717 Ang G9.O and D13.OD1 other bump:2.80762 Ang G9.C and D13.OD1 T0191 103 :NIDVEPIVKAEKLREDMVVMDLIYNPLETV 1gpjA 244 :VDDVREALRKRDRRSPILIIDIANPRDVEE Fragment has 18 clashes (null) has 18 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 32 residues other bump:1.52281 Ang V20.CG2 and E29.OE2 other bump:2.68992 Ang V20.CB and E29.OE2 other bump:2.32514 Ang V20.CG2 and E29.CD other bump:2.77381 Ang I24.CG1 and L28.CD2 other bump:1.65862 Ang I24.CD1 and L28.CD2 other bump:2.57874 Ang I24.CG2 and L28.CD1 other bump:2.87153 Ang I24.CB and L28.CG other bump:2.74877 Ang I24.CG2 and L28.CG other bump:2.00364 Ang I24.CG1 and L28.CG other bump:1.505 Ang I24.CD1 and L28.CG other bump:2.79244 Ang I24.CG1 and L28.CB other bump:2.19287 Ang I24.CD1 and L28.CB other bump:3.09048 Ang I24.CG1 and L28.CA other bump:2.23387 Ang I24.CD1 and L28.CA other bump:2.55671 Ang I24.CG1 and L28.N other bump:2.30715 Ang I24.CD1 and L28.N other bump:2.96953 Ang I24.CD1 and P27.C other bump:2.76002 Ang M21.CE and L23.CD1 T0191 133 :LLKEAKKVNAKTINGLGMLIYQGAVAFK 1gpjA 292 :IARENLERRRKEIPKVEKLIEEELSTVE Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 29 residues Number of specific fragments= 6 total=488 Number of alignments=88 # Reading fragments from alignment file # T0191 read from 1gpjA-T0191-vit-adpstyle5.pw.a2m.gz # 1gpjA read from 1gpjA-T0191-vit-adpstyle5.pw.a2m.gz # found chain 1gpjA in template set T0191 1 :IGYNTDGIGARMALEEEIGR 1gpjA 144 :SEGAVSIGSAAVELAERELG Fragment has 17 clashes (null) has 17 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 21 residues neighbor-bump: 2.11824 Ang G19.O and R20.CD neighbor-bump: 2.33735 Ang G19.C and R20.CG neighbor-bump: 1.50873 Ang G19.O and R20.CG neighbor-bump: 2.35133 Ang G19.C and R20.CB neighbor-bump: 1.77853 Ang G19.O and R20.CB other bump:2.76053 Ang L14.CD1 and I18.CD1 other bump:2.6769 Ang N4.ND2 and A10.C other bump:2.21898 Ang N4.ND2 and A10.CB other bump:2.5988 Ang N4.CG and A10.CA other bump:1.28652 Ang N4.ND2 and A10.CA other bump:2.0724 Ang N4.CG and A10.N other bump:1.0823 Ang N4.ND2 and A10.N other bump:2.3736 Ang N4.CG and G9.C other bump:1.85883 Ang N4.ND2 and G9.C other bump:2.83609 Ang N4.OD1 and G9.C other bump:3.118 Ang N4.CG and G9.CA neighbor-bump: 2.60621 Ang G2.O and Y3.CD1 T0191 21 :VKDKNIVIYGAGGAARAVAFELAK 1gpjA 165 :LHDKTVLVVGAGEMGKTVAKSLVD Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 26 residues other bump:2.12325 Ang A18.C and E22.OE1 other bump:1.16878 Ang A18.O and E22.OE1 other bump:2.71002 Ang V19.CA and E22.OE1 other bump:2.97567 Ang A18.C and E22.CD other bump:2.03305 Ang A18.O and E22.CD T0191 47 :NIIIANRTVEKAEALAKEIA 1gpjA 193 :AVLVANRTYERAVELARDLG Fragment has 19 clashes (null) has 19 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 22 residues other bump:3.28619 Ang I3.CG1 and G22.CA neighbor-bump: 2.2506 Ang I20.O and A21.CB neighbor-bump: 2.53375 Ang I20.C and A21.CB other bump:1.44539 Ang I3.CD1 and I20.CG2 other bump:2.89365 Ang I3.CG1 and I20.CG2 other bump:2.80691 Ang I3.CD1 and I20.CB other bump:2.49571 Ang I5.CD1 and A17.CB other bump:2.9766 Ang I5.CG1 and A17.CB other bump:2.28293 Ang I5.CD1 and A17.CA other bump:1.97413 Ang I5.CD1 and A17.N other bump:2.87382 Ang I5.CD1 and L16.C other bump:2.00721 Ang V10.CG1 and E14.OE2 other bump:2.40763 Ang E11.CA and E14.OE1 other bump:1.64561 Ang V10.O and E14.OE1 other bump:2.29284 Ang V10.C and E14.OE1 other bump:2.41272 Ang V10.O and E14.CD other bump:2.99826 Ang V10.CG1 and E14.CD other bump:3.1113 Ang V10.C and E14.CD other bump:2.66759 Ang I5.CD1 and A13.O T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYP 1gpjA 213 :GEAVRFDELVDHLARSDVVVSATAAPHPV Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 31 residues other bump:2.45711 Ang D13.O and V17.CG2 other bump:2.68119 Ang V5.CG2 and D13.OD2 other bump:2.0717 Ang G9.O and D13.OD1 other bump:2.80762 Ang G9.C and D13.OD1 T0191 103 :NIDVEPIVKAEKLREDMVVMDLIYNPLETV 1gpjA 244 :VDDVREALRKRDRRSPILIIDIANPRDVEE Fragment has 18 clashes (null) has 18 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 32 residues other bump:1.52281 Ang V20.CG2 and E29.OE2 other bump:2.68992 Ang V20.CB and E29.OE2 other bump:2.32514 Ang V20.CG2 and E29.CD other bump:2.77381 Ang I24.CG1 and L28.CD2 other bump:1.65862 Ang I24.CD1 and L28.CD2 other bump:2.57874 Ang I24.CG2 and L28.CD1 other bump:2.87153 Ang I24.CB and L28.CG other bump:2.74877 Ang I24.CG2 and L28.CG other bump:2.00364 Ang I24.CG1 and L28.CG other bump:1.505 Ang I24.CD1 and L28.CG other bump:2.79244 Ang I24.CG1 and L28.CB other bump:2.19287 Ang I24.CD1 and L28.CB other bump:3.09048 Ang I24.CG1 and L28.CA other bump:2.23387 Ang I24.CD1 and L28.CA other bump:2.55671 Ang I24.CG1 and L28.N other bump:2.30715 Ang I24.CD1 and L28.N other bump:2.96953 Ang I24.CD1 and P27.C other bump:2.76002 Ang M21.CE and L23.CD1 T0191 133 :LLKEAKKVNAKTINGLGMLIYQGAVAFK 1gpjA 292 :IARENLERRRKEIPKVEKLIEEELSTVE Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 29 residues Number of specific fragments= 6 total=494 Number of alignments=89 # Reading fragments from alignment file # T0191 read from T0191-1gpjA-2track-protein-EBGHSTL-global-adpstyle1.pw.a2m.gz # 1gpjA read from T0191-1gpjA-2track-protein-EBGHSTL-global-adpstyle1.pw.a2m.gz # found chain 1gpjA in template set T0191 1 :I 1gpjA 1 :M Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 2 residues T0191 2 :GYNTDGIGARMALEEEIGRVKDKNIVIYGAGGAARAVAFELAK 1gpjA 146 :GAVSIGSAAVELAERELGSLHDKTVLVVGAGEMGKTVAKSLVD Fragment has 76 clashes (null) has 76 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 45 residues other bump:2.32562 Ang L14.CD1 and L42.CD2 other bump:2.26175 Ang R11.NH1 and E41.C other bump:2.70446 Ang R11.CD and E41.O other bump:2.20049 Ang R11.NH1 and E41.O other bump:1.16878 Ang A37.O and E41.OE1 other bump:2.12325 Ang A37.C and E41.OE1 other bump:2.71002 Ang V38.CA and E41.OE1 other bump:3.06491 Ang G7.CA and E41.CD other bump:2.03305 Ang A37.O and E41.CD other bump:2.97567 Ang A37.C and E41.CD other bump:3.08232 Ang G7.CA and E41.CG other bump:3.24563 Ang G7.C and E41.CG other bump:2.83406 Ang R11.CZ and E41.CB other bump:1.98869 Ang R11.NH1 and E41.CB other bump:1.91041 Ang R11.NH1 and E41.CA other bump:2.71694 Ang Y3.CB and M12.SD other bump:1.83398 Ang I8.CD1 and R11.NH2 other bump:2.88577 Ang Y3.CG and G9.CA other bump:2.27855 Ang Y3.CD2 and G9.CA other bump:2.62641 Ang Y3.CE2 and G9.CA other bump:2.49919 Ang Y3.CD1 and G9.N other bump:2.16413 Ang Y3.CG and G9.N other bump:1.652 Ang Y3.CD2 and G9.N other bump:1.55884 Ang Y3.CE2 and G9.N other bump:2.44228 Ang Y3.CE1 and G9.N other bump:2.00811 Ang Y3.CZ and G9.N other bump:1.75321 Ang Y3.CD1 and I8.C other bump:2.1123 Ang Y3.CG and I8.C other bump:2.42046 Ang Y3.CD2 and I8.C other bump:2.44556 Ang Y3.CE2 and I8.C other bump:3.29349 Ang Y3.CB and I8.C other bump:1.78431 Ang Y3.CE1 and I8.C other bump:2.14011 Ang Y3.CZ and I8.C other bump:2.31189 Ang Y3.CD1 and I8.O other bump:2.61852 Ang Y3.CG and I8.O other bump:3.14929 Ang Y3.CA and I8.CG2 other bump:1.35201 Ang Y3.CD1 and I8.CG2 other bump:2.30031 Ang Y3.CG and I8.CG2 other bump:2.78818 Ang Y3.CB and I8.CG2 other bump:2.34648 Ang Y3.CE1 and I8.CG2 other bump:2.74217 Ang Y3.CD1 and I8.CG1 other bump:2.23779 Ang Y3.CE1 and I8.CG1 other bump:1.23883 Ang Y3.CD1 and I8.CB other bump:2.40368 Ang Y3.CG and I8.CB other bump:3.10444 Ang Y3.CD2 and I8.CB other bump:3.069 Ang Y3.CE2 and I8.CB other bump:1.12483 Ang Y3.CE1 and I8.CB other bump:2.26274 Ang Y3.CZ and I8.CB other bump:1.62932 Ang Y3.CD1 and I8.CA other bump:2.71932 Ang Y3.CG and I8.CA other bump:3.12305 Ang Y3.CD2 and I8.CA other bump:2.75622 Ang Y3.CE2 and I8.CA other bump:2.512 Ang Y3.OH and I8.CA other bump:0.665591 Ang Y3.CE1 and I8.CA other bump:1.68541 Ang Y3.CZ and I8.CA other bump:2.83655 Ang Y3.CD1 and I8.N other bump:2.57477 Ang Y3.CE2 and I8.N other bump:1.15168 Ang Y3.OH and I8.N other bump:1.48594 Ang Y3.CE1 and I8.N other bump:1.20467 Ang Y3.CZ and I8.N other bump:3.2778 Ang Y3.CE2 and G7.C other bump:1.5461 Ang Y3.OH and G7.C other bump:2.68496 Ang Y3.CE1 and G7.C other bump:2.19595 Ang Y3.CZ and G7.C other bump:1.81848 Ang Y3.OH and G7.CA other bump:3.05225 Ang Y3.CZ and G7.CA other bump:1.8189 Ang Y3.OH and G7.N other bump:2.96188 Ang Y3.CZ and G7.N other bump:3.11491 Ang Y3.CE2 and D6.C other bump:2.54751 Ang Y3.OH and D6.C other bump:3.21493 Ang Y3.CZ and D6.C other bump:2.49392 Ang Y3.CE2 and T5.C other bump:3.13648 Ang Y3.CZ and T5.C other bump:2.21115 Ang Y3.CD2 and T5.O other bump:1.32678 Ang Y3.CE2 and T5.O other bump:2.27616 Ang Y3.CZ and T5.O T0191 45 :DN 1gpjA 190 :GV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues T0191 47 :NIIIANRTVEKAEALAKEIA 1gpjA 193 :AVLVANRTYERAVELARDLG Fragment has 19 clashes (null) has 19 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 22 residues other bump:3.28619 Ang I3.CG1 and G22.CA neighbor-bump: 2.2506 Ang I20.O and A21.CB neighbor-bump: 2.53375 Ang I20.C and A21.CB other bump:1.44539 Ang I3.CD1 and I20.CG2 other bump:2.89365 Ang I3.CG1 and I20.CG2 other bump:2.80691 Ang I3.CD1 and I20.CB other bump:2.49571 Ang I5.CD1 and A17.CB other bump:2.9766 Ang I5.CG1 and A17.CB other bump:2.28293 Ang I5.CD1 and A17.CA other bump:1.97413 Ang I5.CD1 and A17.N other bump:2.87382 Ang I5.CD1 and L16.C other bump:2.00721 Ang V10.CG1 and E14.OE2 other bump:2.40763 Ang E11.CA and E14.OE1 other bump:1.64561 Ang V10.O and E14.OE1 other bump:2.29284 Ang V10.C and E14.OE1 other bump:2.41272 Ang V10.O and E14.CD other bump:2.99826 Ang V10.CG1 and E14.CD other bump:3.1113 Ang V10.C and E14.CD other bump:2.66759 Ang I5.CD1 and A13.O T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLR 1gpjA 213 :GEAVRFDELVDHLARSDVVVSATAAPHPVIHVDDVREALRKRD Fragment has 44 clashes (null) has 44 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 45 residues other bump:2.86372 Ang D15.CG and L43.CD2 other bump:2.2607 Ang D15.OD2 and L43.CD2 other bump:2.76557 Ang D15.C and L43.CD1 other bump:1.73614 Ang D15.O and L43.CD1 other bump:2.79188 Ang D15.OD1 and L43.CD1 other bump:2.34312 Ang D15.CG and L43.CG other bump:2.41345 Ang D15.OD2 and L43.CG other bump:2.13139 Ang D15.OD1 and L43.CG other bump:1.94768 Ang D15.OD1 and K39.O other bump:0.500343 Ang L14.O and K39.NZ other bump:2.52873 Ang L14.CA and K39.NZ other bump:1.14865 Ang L14.C and K39.NZ other bump:2.20145 Ang D15.CA and K39.NZ other bump:2.34434 Ang D15.C and K39.NZ other bump:1.87788 Ang D15.N and K39.NZ other bump:2.89342 Ang D13.C and K39.CE other bump:2.22774 Ang L14.N and K39.CE other bump:1.51092 Ang L14.O and K39.CE other bump:1.18933 Ang L14.CA and K39.CE other bump:2.11486 Ang L14.CB and K39.CE other bump:0.373084 Ang L14.C and K39.CE other bump:2.63342 Ang D15.CA and K39.CE other bump:1.44807 Ang D15.N and K39.CE other bump:3.02821 Ang L14.CG and K39.CD other bump:2.51902 Ang L14.O and K39.CD other bump:1.94455 Ang L14.CA and K39.CD other bump:1.51814 Ang L14.CB and K39.CD other bump:1.75693 Ang L14.C and K39.CD other bump:3.0843 Ang D15.CA and K39.CD other bump:2.10043 Ang D15.N and K39.CD other bump:2.9058 Ang L14.CB and K39.CG other bump:2.58549 Ang L14.C and K39.CG other bump:2.49827 Ang D15.CA and K39.CG other bump:2.11939 Ang D15.N and K39.CG other bump:3.04697 Ang D15.CB and K39.CG other bump:1.67603 Ang I32.O and P36.CD other bump:2.89863 Ang I32.C and P36.CD other bump:3.08794 Ang D33.C and P36.CD other bump:2.47197 Ang I32.O and P36.CG self-bump: 1.39825 Ang D33.CA and D33.CB other bump:2.45711 Ang D13.O and V17.CG2 other bump:2.68119 Ang V5.CG2 and D13.OD2 other bump:2.80762 Ang G9.C and D13.OD1 other bump:2.0717 Ang G9.O and D13.OD1 T0191 117 :EDMVVMDLIYNPLETVLLKEAKKVNAKTINGLGMLIYQGAVAFK 1gpjA 258 :SPILIIDIANPRDVEEGVENIEDVEVRTIDDLRVIARENLERRR Fragment has 22 clashes (null) has 22 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 45 residues other bump:2.83524 Ang M7.SD and L33.CD1 other bump:2.96977 Ang K20.CG and A27.CB neighbor-bump: 2.17254 Ang V17.O and L18.CB neighbor-bump: 2.59256 Ang V17.C and L18.CB other bump:1.52281 Ang V6.CG2 and E15.OE2 other bump:2.68992 Ang V6.CB and E15.OE2 other bump:2.32514 Ang V6.CG2 and E15.CD other bump:2.77381 Ang I10.CG1 and L14.CD2 other bump:1.65862 Ang I10.CD1 and L14.CD2 other bump:2.57874 Ang I10.CG2 and L14.CD1 other bump:2.87153 Ang I10.CB and L14.CG other bump:2.00364 Ang I10.CG1 and L14.CG other bump:2.74877 Ang I10.CG2 and L14.CG other bump:1.505 Ang I10.CD1 and L14.CG other bump:2.79244 Ang I10.CG1 and L14.CB other bump:2.19287 Ang I10.CD1 and L14.CB other bump:3.09048 Ang I10.CG1 and L14.CA other bump:2.23387 Ang I10.CD1 and L14.CA other bump:2.55671 Ang I10.CG1 and L14.N other bump:2.30715 Ang I10.CD1 and L14.N other bump:2.96953 Ang I10.CD1 and P13.C other bump:2.76002 Ang M7.CE and L9.CD1 Number of specific fragments= 6 total=500 Number of alignments=90 # Reading fragments from alignment file # T0191 read from T0191-1gpjA-2track-protein-EBGHSTL-global-adpstyle5.pw.a2m.gz # 1gpjA read from T0191-1gpjA-2track-protein-EBGHSTL-global-adpstyle5.pw.a2m.gz # found chain 1gpjA in template set T0191 1 :I 1gpjA 1 :M Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 2 residues T0191 2 :GYNTDGIGARMALEEEIGRVKDKNIVIYGAGGAARAVAFELAK 1gpjA 146 :GAVSIGSAAVELAERELGSLHDKTVLVVGAGEMGKTVAKSLVD Fragment has 76 clashes (null) has 76 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 45 residues other bump:2.32562 Ang L14.CD1 and L42.CD2 other bump:2.26175 Ang R11.NH1 and E41.C other bump:2.70446 Ang R11.CD and E41.O other bump:2.20049 Ang R11.NH1 and E41.O other bump:1.16878 Ang A37.O and E41.OE1 other bump:2.12325 Ang A37.C and E41.OE1 other bump:2.71002 Ang V38.CA and E41.OE1 other bump:3.06491 Ang G7.CA and E41.CD other bump:2.03305 Ang A37.O and E41.CD other bump:2.97567 Ang A37.C and E41.CD other bump:3.08232 Ang G7.CA and E41.CG other bump:3.24563 Ang G7.C and E41.CG other bump:2.83406 Ang R11.CZ and E41.CB other bump:1.98869 Ang R11.NH1 and E41.CB other bump:1.91041 Ang R11.NH1 and E41.CA other bump:2.71694 Ang Y3.CB and M12.SD other bump:1.83398 Ang I8.CD1 and R11.NH2 other bump:2.88577 Ang Y3.CG and G9.CA other bump:2.27855 Ang Y3.CD2 and G9.CA other bump:2.62641 Ang Y3.CE2 and G9.CA other bump:2.49919 Ang Y3.CD1 and G9.N other bump:2.16413 Ang Y3.CG and G9.N other bump:1.652 Ang Y3.CD2 and G9.N other bump:1.55884 Ang Y3.CE2 and G9.N other bump:2.44228 Ang Y3.CE1 and G9.N other bump:2.00811 Ang Y3.CZ and G9.N other bump:1.75321 Ang Y3.CD1 and I8.C other bump:2.1123 Ang Y3.CG and I8.C other bump:2.42046 Ang Y3.CD2 and I8.C other bump:2.44556 Ang Y3.CE2 and I8.C other bump:3.29349 Ang Y3.CB and I8.C other bump:1.78431 Ang Y3.CE1 and I8.C other bump:2.14011 Ang Y3.CZ and I8.C other bump:2.31189 Ang Y3.CD1 and I8.O other bump:2.61852 Ang Y3.CG and I8.O other bump:3.14929 Ang Y3.CA and I8.CG2 other bump:1.35201 Ang Y3.CD1 and I8.CG2 other bump:2.30031 Ang Y3.CG and I8.CG2 other bump:2.78818 Ang Y3.CB and I8.CG2 other bump:2.34648 Ang Y3.CE1 and I8.CG2 other bump:2.74217 Ang Y3.CD1 and I8.CG1 other bump:2.23779 Ang Y3.CE1 and I8.CG1 other bump:1.23883 Ang Y3.CD1 and I8.CB other bump:2.40368 Ang Y3.CG and I8.CB other bump:3.10444 Ang Y3.CD2 and I8.CB other bump:3.069 Ang Y3.CE2 and I8.CB other bump:1.12483 Ang Y3.CE1 and I8.CB other bump:2.26274 Ang Y3.CZ and I8.CB other bump:1.62932 Ang Y3.CD1 and I8.CA other bump:2.71932 Ang Y3.CG and I8.CA other bump:3.12305 Ang Y3.CD2 and I8.CA other bump:2.75622 Ang Y3.CE2 and I8.CA other bump:2.512 Ang Y3.OH and I8.CA other bump:0.665591 Ang Y3.CE1 and I8.CA other bump:1.68541 Ang Y3.CZ and I8.CA other bump:2.83655 Ang Y3.CD1 and I8.N other bump:2.57477 Ang Y3.CE2 and I8.N other bump:1.15168 Ang Y3.OH and I8.N other bump:1.48594 Ang Y3.CE1 and I8.N other bump:1.20467 Ang Y3.CZ and I8.N other bump:3.2778 Ang Y3.CE2 and G7.C other bump:1.5461 Ang Y3.OH and G7.C other bump:2.68496 Ang Y3.CE1 and G7.C other bump:2.19595 Ang Y3.CZ and G7.C other bump:1.81848 Ang Y3.OH and G7.CA other bump:3.05225 Ang Y3.CZ and G7.CA other bump:1.8189 Ang Y3.OH and G7.N other bump:2.96188 Ang Y3.CZ and G7.N other bump:3.11491 Ang Y3.CE2 and D6.C other bump:2.54751 Ang Y3.OH and D6.C other bump:3.21493 Ang Y3.CZ and D6.C other bump:2.49392 Ang Y3.CE2 and T5.C other bump:3.13648 Ang Y3.CZ and T5.C other bump:2.21115 Ang Y3.CD2 and T5.O other bump:1.32678 Ang Y3.CE2 and T5.O other bump:2.27616 Ang Y3.CZ and T5.O T0191 45 :DN 1gpjA 190 :GV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues T0191 47 :NIIIANRTVEKAEALAKEIA 1gpjA 193 :AVLVANRTYERAVELARDLG Fragment has 19 clashes (null) has 19 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 22 residues other bump:3.28619 Ang I3.CG1 and G22.CA neighbor-bump: 2.2506 Ang I20.O and A21.CB neighbor-bump: 2.53375 Ang I20.C and A21.CB other bump:1.44539 Ang I3.CD1 and I20.CG2 other bump:2.89365 Ang I3.CG1 and I20.CG2 other bump:2.80691 Ang I3.CD1 and I20.CB other bump:2.49571 Ang I5.CD1 and A17.CB other bump:2.9766 Ang I5.CG1 and A17.CB other bump:2.28293 Ang I5.CD1 and A17.CA other bump:1.97413 Ang I5.CD1 and A17.N other bump:2.87382 Ang I5.CD1 and L16.C other bump:2.00721 Ang V10.CG1 and E14.OE2 other bump:2.40763 Ang E11.CA and E14.OE1 other bump:1.64561 Ang V10.O and E14.OE1 other bump:2.29284 Ang V10.C and E14.OE1 other bump:2.41272 Ang V10.O and E14.CD other bump:2.99826 Ang V10.CG1 and E14.CD other bump:3.1113 Ang V10.C and E14.CD other bump:2.66759 Ang I5.CD1 and A13.O T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLR 1gpjA 213 :GEAVRFDELVDHLARSDVVVSATAAPHPVIHVDDVREALRKRD Fragment has 44 clashes (null) has 44 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 45 residues other bump:2.86372 Ang D15.CG and L43.CD2 other bump:2.2607 Ang D15.OD2 and L43.CD2 other bump:2.76557 Ang D15.C and L43.CD1 other bump:1.73614 Ang D15.O and L43.CD1 other bump:2.79188 Ang D15.OD1 and L43.CD1 other bump:2.34312 Ang D15.CG and L43.CG other bump:2.41345 Ang D15.OD2 and L43.CG other bump:2.13139 Ang D15.OD1 and L43.CG other bump:1.94768 Ang D15.OD1 and K39.O other bump:0.500343 Ang L14.O and K39.NZ other bump:2.52873 Ang L14.CA and K39.NZ other bump:1.14865 Ang L14.C and K39.NZ other bump:2.20145 Ang D15.CA and K39.NZ other bump:2.34434 Ang D15.C and K39.NZ other bump:1.87788 Ang D15.N and K39.NZ other bump:2.89342 Ang D13.C and K39.CE other bump:2.22774 Ang L14.N and K39.CE other bump:1.51092 Ang L14.O and K39.CE other bump:1.18933 Ang L14.CA and K39.CE other bump:2.11486 Ang L14.CB and K39.CE other bump:0.373084 Ang L14.C and K39.CE other bump:2.63342 Ang D15.CA and K39.CE other bump:1.44807 Ang D15.N and K39.CE other bump:3.02821 Ang L14.CG and K39.CD other bump:2.51902 Ang L14.O and K39.CD other bump:1.94455 Ang L14.CA and K39.CD other bump:1.51814 Ang L14.CB and K39.CD other bump:1.75693 Ang L14.C and K39.CD other bump:3.0843 Ang D15.CA and K39.CD other bump:2.10043 Ang D15.N and K39.CD other bump:2.9058 Ang L14.CB and K39.CG other bump:2.58549 Ang L14.C and K39.CG other bump:2.49827 Ang D15.CA and K39.CG other bump:2.11939 Ang D15.N and K39.CG other bump:3.04697 Ang D15.CB and K39.CG other bump:1.67603 Ang I32.O and P36.CD other bump:2.89863 Ang I32.C and P36.CD other bump:3.08794 Ang D33.C and P36.CD other bump:2.47197 Ang I32.O and P36.CG self-bump: 1.39825 Ang D33.CA and D33.CB other bump:2.45711 Ang D13.O and V17.CG2 other bump:2.68119 Ang V5.CG2 and D13.OD2 other bump:2.80762 Ang G9.C and D13.OD1 other bump:2.0717 Ang G9.O and D13.OD1 T0191 117 :EDMVVMDLIYNPLETVLLKEAKKVNAKTINGLGMLIYQGAVAFK 1gpjA 258 :SPILIIDIANPRDVEEGVENIEDVEVRTIDDLRVIARENLERRR Fragment has 22 clashes (null) has 22 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 45 residues other bump:2.83524 Ang M7.SD and L33.CD1 other bump:2.96977 Ang K20.CG and A27.CB neighbor-bump: 2.17254 Ang V17.O and L18.CB neighbor-bump: 2.59256 Ang V17.C and L18.CB other bump:1.52281 Ang V6.CG2 and E15.OE2 other bump:2.68992 Ang V6.CB and E15.OE2 other bump:2.32514 Ang V6.CG2 and E15.CD other bump:2.77381 Ang I10.CG1 and L14.CD2 other bump:1.65862 Ang I10.CD1 and L14.CD2 other bump:2.57874 Ang I10.CG2 and L14.CD1 other bump:2.87153 Ang I10.CB and L14.CG other bump:2.00364 Ang I10.CG1 and L14.CG other bump:2.74877 Ang I10.CG2 and L14.CG other bump:1.505 Ang I10.CD1 and L14.CG other bump:2.79244 Ang I10.CG1 and L14.CB other bump:2.19287 Ang I10.CD1 and L14.CB other bump:3.09048 Ang I10.CG1 and L14.CA other bump:2.23387 Ang I10.CD1 and L14.CA other bump:2.55671 Ang I10.CG1 and L14.N other bump:2.30715 Ang I10.CD1 and L14.N other bump:2.96953 Ang I10.CD1 and P13.C other bump:2.76002 Ang M7.CE and L9.CD1 Number of specific fragments= 6 total=506 Number of alignments=91 # Reading fragments from alignment file # T0191 read from T0191-1gpjA-2track-protein-EBGHSTL-local-adpstyle1.pw.a2m.gz # 1gpjA read from T0191-1gpjA-2track-protein-EBGHSTL-local-adpstyle1.pw.a2m.gz # found chain 1gpjA in template set T0191 1 :IGYNTDGIGARMALEEEIGRVKDKNIVIYGAGGAARAVAFELAK 1gpjA 145 :EGAVSIGSAAVELAERELGSLHDKTVLVVGAGEMGKTVAKSLVD Fragment has 76 clashes (null) has 76 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 45 residues other bump:2.32562 Ang L14.CD1 and L42.CD2 other bump:2.26175 Ang R11.NH1 and E41.C other bump:2.70446 Ang R11.CD and E41.O other bump:2.20049 Ang R11.NH1 and E41.O other bump:1.16878 Ang A37.O and E41.OE1 other bump:2.12325 Ang A37.C and E41.OE1 other bump:2.71002 Ang V38.CA and E41.OE1 other bump:3.06491 Ang G7.CA and E41.CD other bump:2.03305 Ang A37.O and E41.CD other bump:2.97567 Ang A37.C and E41.CD other bump:3.08232 Ang G7.CA and E41.CG other bump:3.24563 Ang G7.C and E41.CG other bump:2.83406 Ang R11.CZ and E41.CB other bump:1.98869 Ang R11.NH1 and E41.CB other bump:1.91041 Ang R11.NH1 and E41.CA other bump:2.71694 Ang Y3.CB and M12.SD other bump:1.83398 Ang I8.CD1 and R11.NH2 other bump:2.88577 Ang Y3.CG and G9.CA other bump:2.27855 Ang Y3.CD2 and G9.CA other bump:2.62641 Ang Y3.CE2 and G9.CA other bump:2.16413 Ang Y3.CG and G9.N other bump:1.652 Ang Y3.CD2 and G9.N other bump:2.49919 Ang Y3.CD1 and G9.N other bump:2.44228 Ang Y3.CE1 and G9.N other bump:1.55884 Ang Y3.CE2 and G9.N other bump:2.00811 Ang Y3.CZ and G9.N other bump:2.1123 Ang Y3.CG and I8.C other bump:2.42046 Ang Y3.CD2 and I8.C other bump:3.29349 Ang Y3.CB and I8.C other bump:1.75321 Ang Y3.CD1 and I8.C other bump:1.78431 Ang Y3.CE1 and I8.C other bump:2.44556 Ang Y3.CE2 and I8.C other bump:2.14011 Ang Y3.CZ and I8.C other bump:2.61852 Ang Y3.CG and I8.O other bump:2.31189 Ang Y3.CD1 and I8.O other bump:3.14929 Ang Y3.CA and I8.CG2 other bump:2.30031 Ang Y3.CG and I8.CG2 other bump:2.78818 Ang Y3.CB and I8.CG2 other bump:1.35201 Ang Y3.CD1 and I8.CG2 other bump:2.34648 Ang Y3.CE1 and I8.CG2 other bump:2.74217 Ang Y3.CD1 and I8.CG1 other bump:2.23779 Ang Y3.CE1 and I8.CG1 other bump:2.40368 Ang Y3.CG and I8.CB other bump:3.10444 Ang Y3.CD2 and I8.CB other bump:1.23883 Ang Y3.CD1 and I8.CB other bump:1.12483 Ang Y3.CE1 and I8.CB other bump:3.069 Ang Y3.CE2 and I8.CB other bump:2.26274 Ang Y3.CZ and I8.CB other bump:2.71932 Ang Y3.CG and I8.CA other bump:3.12305 Ang Y3.CD2 and I8.CA other bump:2.512 Ang Y3.OH and I8.CA other bump:1.62932 Ang Y3.CD1 and I8.CA other bump:0.665591 Ang Y3.CE1 and I8.CA other bump:2.75622 Ang Y3.CE2 and I8.CA other bump:1.68541 Ang Y3.CZ and I8.CA other bump:1.15168 Ang Y3.OH and I8.N other bump:2.83655 Ang Y3.CD1 and I8.N other bump:1.48594 Ang Y3.CE1 and I8.N other bump:2.57477 Ang Y3.CE2 and I8.N other bump:1.20467 Ang Y3.CZ and I8.N other bump:1.5461 Ang Y3.OH and G7.C other bump:2.68496 Ang Y3.CE1 and G7.C other bump:3.2778 Ang Y3.CE2 and G7.C other bump:2.19595 Ang Y3.CZ and G7.C other bump:1.81848 Ang Y3.OH and G7.CA other bump:3.05225 Ang Y3.CZ and G7.CA other bump:1.8189 Ang Y3.OH and G7.N other bump:2.96188 Ang Y3.CZ and G7.N other bump:2.54751 Ang Y3.OH and D6.C other bump:3.11491 Ang Y3.CE2 and D6.C other bump:3.21493 Ang Y3.CZ and D6.C other bump:2.49392 Ang Y3.CE2 and T5.C other bump:3.13648 Ang Y3.CZ and T5.C other bump:2.21115 Ang Y3.CD2 and T5.O other bump:1.32678 Ang Y3.CE2 and T5.O other bump:2.27616 Ang Y3.CZ and T5.O T0191 45 :DN 1gpjA 190 :GV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues T0191 47 :NIIIANRTVEKAEALAKEIA 1gpjA 193 :AVLVANRTYERAVELARDLG Fragment has 19 clashes (null) has 19 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 22 residues other bump:3.28619 Ang I3.CG1 and G22.CA neighbor-bump: 2.2506 Ang I20.O and A21.CB neighbor-bump: 2.53375 Ang I20.C and A21.CB other bump:1.44539 Ang I3.CD1 and I20.CG2 other bump:2.89365 Ang I3.CG1 and I20.CG2 other bump:2.80691 Ang I3.CD1 and I20.CB other bump:2.49571 Ang I5.CD1 and A17.CB other bump:2.9766 Ang I5.CG1 and A17.CB other bump:2.28293 Ang I5.CD1 and A17.CA other bump:1.97413 Ang I5.CD1 and A17.N other bump:2.87382 Ang I5.CD1 and L16.C other bump:2.00721 Ang V10.CG1 and E14.OE2 other bump:2.40763 Ang E11.CA and E14.OE1 other bump:1.64561 Ang V10.O and E14.OE1 other bump:2.29284 Ang V10.C and E14.OE1 other bump:2.41272 Ang V10.O and E14.CD other bump:2.99826 Ang V10.CG1 and E14.CD other bump:3.1113 Ang V10.C and E14.CD other bump:2.66759 Ang I5.CD1 and A13.O T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLR 1gpjA 213 :GEAVRFDELVDHLARSDVVVSATAAPHPVIHVDDVREALRKRD Fragment has 44 clashes (null) has 44 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 45 residues other bump:2.86372 Ang D15.CG and L43.CD2 other bump:2.2607 Ang D15.OD2 and L43.CD2 other bump:2.76557 Ang D15.C and L43.CD1 other bump:1.73614 Ang D15.O and L43.CD1 other bump:2.79188 Ang D15.OD1 and L43.CD1 other bump:2.34312 Ang D15.CG and L43.CG other bump:2.41345 Ang D15.OD2 and L43.CG other bump:2.13139 Ang D15.OD1 and L43.CG other bump:1.94768 Ang D15.OD1 and K39.O other bump:0.500343 Ang L14.O and K39.NZ other bump:2.52873 Ang L14.CA and K39.NZ other bump:1.14865 Ang L14.C and K39.NZ other bump:2.20145 Ang D15.CA and K39.NZ other bump:2.34434 Ang D15.C and K39.NZ other bump:1.87788 Ang D15.N and K39.NZ other bump:2.89342 Ang D13.C and K39.CE other bump:2.22774 Ang L14.N and K39.CE other bump:1.51092 Ang L14.O and K39.CE other bump:1.18933 Ang L14.CA and K39.CE other bump:2.11486 Ang L14.CB and K39.CE other bump:0.373084 Ang L14.C and K39.CE other bump:2.63342 Ang D15.CA and K39.CE other bump:1.44807 Ang D15.N and K39.CE other bump:3.02821 Ang L14.CG and K39.CD other bump:2.51902 Ang L14.O and K39.CD other bump:1.94455 Ang L14.CA and K39.CD other bump:1.51814 Ang L14.CB and K39.CD other bump:1.75693 Ang L14.C and K39.CD other bump:3.0843 Ang D15.CA and K39.CD other bump:2.10043 Ang D15.N and K39.CD other bump:2.9058 Ang L14.CB and K39.CG other bump:2.58549 Ang L14.C and K39.CG other bump:2.49827 Ang D15.CA and K39.CG other bump:2.11939 Ang D15.N and K39.CG other bump:3.04697 Ang D15.CB and K39.CG other bump:1.67603 Ang I32.O and P36.CD other bump:2.89863 Ang I32.C and P36.CD other bump:3.08794 Ang D33.C and P36.CD other bump:2.47197 Ang I32.O and P36.CG self-bump: 1.39825 Ang D33.CA and D33.CB other bump:2.45711 Ang D13.O and V17.CG2 other bump:2.68119 Ang V5.CG2 and D13.OD2 other bump:2.80762 Ang G9.C and D13.OD1 other bump:2.0717 Ang G9.O and D13.OD1 T0191 117 :EDMVVMDLIYNPLETVLLKEAKKVNAKTINGLGMLIYQGAVAF 1gpjA 258 :SPILIIDIANPRDVEEGVENIEDVEVRTIDDLRVIARENLERR Fragment has 22 clashes (null) has 22 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 45 residues other bump:2.83524 Ang M7.SD and L33.CD1 other bump:2.96977 Ang K20.CG and A27.CB neighbor-bump: 2.17254 Ang V17.O and L18.CB neighbor-bump: 2.59256 Ang V17.C and L18.CB other bump:1.52281 Ang V6.CG2 and E15.OE2 other bump:2.68992 Ang V6.CB and E15.OE2 other bump:2.32514 Ang V6.CG2 and E15.CD other bump:2.77381 Ang I10.CG1 and L14.CD2 other bump:1.65862 Ang I10.CD1 and L14.CD2 other bump:2.57874 Ang I10.CG2 and L14.CD1 other bump:2.87153 Ang I10.CB and L14.CG other bump:2.00364 Ang I10.CG1 and L14.CG other bump:2.74877 Ang I10.CG2 and L14.CG other bump:1.505 Ang I10.CD1 and L14.CG other bump:2.79244 Ang I10.CG1 and L14.CB other bump:2.19287 Ang I10.CD1 and L14.CB other bump:3.09048 Ang I10.CG1 and L14.CA other bump:2.23387 Ang I10.CD1 and L14.CA other bump:2.55671 Ang I10.CG1 and L14.N other bump:2.30715 Ang I10.CD1 and L14.N other bump:2.96953 Ang I10.CD1 and P13.C other bump:2.76002 Ang M7.CE and L9.CD1 Number of specific fragments= 5 total=511 Number of alignments=92 # Reading fragments from alignment file # T0191 read from T0191-1gpjA-2track-protein-EBGHSTL-local-adpstyle5.pw.a2m.gz # 1gpjA read from T0191-1gpjA-2track-protein-EBGHSTL-local-adpstyle5.pw.a2m.gz # found chain 1gpjA in template set T0191 1 :IGYNTDGIGARMALEEEIGRVKDKNIVIYGAGGAARAVAFELAK 1gpjA 145 :EGAVSIGSAAVELAERELGSLHDKTVLVVGAGEMGKTVAKSLVD Fragment has 76 clashes (null) has 76 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 45 residues other bump:2.32562 Ang L14.CD1 and L42.CD2 other bump:2.26175 Ang R11.NH1 and E41.C other bump:2.70446 Ang R11.CD and E41.O other bump:2.20049 Ang R11.NH1 and E41.O other bump:1.16878 Ang A37.O and E41.OE1 other bump:2.12325 Ang A37.C and E41.OE1 other bump:2.71002 Ang V38.CA and E41.OE1 other bump:3.06491 Ang G7.CA and E41.CD other bump:2.03305 Ang A37.O and E41.CD other bump:2.97567 Ang A37.C and E41.CD other bump:3.08232 Ang G7.CA and E41.CG other bump:3.24563 Ang G7.C and E41.CG other bump:2.83406 Ang R11.CZ and E41.CB other bump:1.98869 Ang R11.NH1 and E41.CB other bump:1.91041 Ang R11.NH1 and E41.CA other bump:2.71694 Ang Y3.CB and M12.SD other bump:1.83398 Ang I8.CD1 and R11.NH2 other bump:2.88577 Ang Y3.CG and G9.CA other bump:2.27855 Ang Y3.CD2 and G9.CA other bump:2.62641 Ang Y3.CE2 and G9.CA other bump:2.16413 Ang Y3.CG and G9.N other bump:1.652 Ang Y3.CD2 and G9.N other bump:2.49919 Ang Y3.CD1 and G9.N other bump:2.44228 Ang Y3.CE1 and G9.N other bump:1.55884 Ang Y3.CE2 and G9.N other bump:2.00811 Ang Y3.CZ and G9.N other bump:2.1123 Ang Y3.CG and I8.C other bump:2.42046 Ang Y3.CD2 and I8.C other bump:3.29349 Ang Y3.CB and I8.C other bump:1.75321 Ang Y3.CD1 and I8.C other bump:1.78431 Ang Y3.CE1 and I8.C other bump:2.44556 Ang Y3.CE2 and I8.C other bump:2.14011 Ang Y3.CZ and I8.C other bump:2.61852 Ang Y3.CG and I8.O other bump:2.31189 Ang Y3.CD1 and I8.O other bump:3.14929 Ang Y3.CA and I8.CG2 other bump:2.30031 Ang Y3.CG and I8.CG2 other bump:2.78818 Ang Y3.CB and I8.CG2 other bump:1.35201 Ang Y3.CD1 and I8.CG2 other bump:2.34648 Ang Y3.CE1 and I8.CG2 other bump:2.74217 Ang Y3.CD1 and I8.CG1 other bump:2.23779 Ang Y3.CE1 and I8.CG1 other bump:2.40368 Ang Y3.CG and I8.CB other bump:3.10444 Ang Y3.CD2 and I8.CB other bump:1.23883 Ang Y3.CD1 and I8.CB other bump:1.12483 Ang Y3.CE1 and I8.CB other bump:3.069 Ang Y3.CE2 and I8.CB other bump:2.26274 Ang Y3.CZ and I8.CB other bump:2.71932 Ang Y3.CG and I8.CA other bump:3.12305 Ang Y3.CD2 and I8.CA other bump:2.512 Ang Y3.OH and I8.CA other bump:1.62932 Ang Y3.CD1 and I8.CA other bump:0.665591 Ang Y3.CE1 and I8.CA other bump:2.75622 Ang Y3.CE2 and I8.CA other bump:1.68541 Ang Y3.CZ and I8.CA other bump:1.15168 Ang Y3.OH and I8.N other bump:2.83655 Ang Y3.CD1 and I8.N other bump:1.48594 Ang Y3.CE1 and I8.N other bump:2.57477 Ang Y3.CE2 and I8.N other bump:1.20467 Ang Y3.CZ and I8.N other bump:1.5461 Ang Y3.OH and G7.C other bump:2.68496 Ang Y3.CE1 and G7.C other bump:3.2778 Ang Y3.CE2 and G7.C other bump:2.19595 Ang Y3.CZ and G7.C other bump:1.81848 Ang Y3.OH and G7.CA other bump:3.05225 Ang Y3.CZ and G7.CA other bump:1.8189 Ang Y3.OH and G7.N other bump:2.96188 Ang Y3.CZ and G7.N other bump:2.54751 Ang Y3.OH and D6.C other bump:3.11491 Ang Y3.CE2 and D6.C other bump:3.21493 Ang Y3.CZ and D6.C other bump:2.49392 Ang Y3.CE2 and T5.C other bump:3.13648 Ang Y3.CZ and T5.C other bump:2.21115 Ang Y3.CD2 and T5.O other bump:1.32678 Ang Y3.CE2 and T5.O other bump:2.27616 Ang Y3.CZ and T5.O T0191 45 :DN 1gpjA 190 :GV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues T0191 47 :NIIIANRTVEKAEALAKEIA 1gpjA 193 :AVLVANRTYERAVELARDLG Fragment has 19 clashes (null) has 19 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 22 residues other bump:3.28619 Ang I3.CG1 and G22.CA neighbor-bump: 2.2506 Ang I20.O and A21.CB neighbor-bump: 2.53375 Ang I20.C and A21.CB other bump:1.44539 Ang I3.CD1 and I20.CG2 other bump:2.89365 Ang I3.CG1 and I20.CG2 other bump:2.80691 Ang I3.CD1 and I20.CB other bump:2.49571 Ang I5.CD1 and A17.CB other bump:2.9766 Ang I5.CG1 and A17.CB other bump:2.28293 Ang I5.CD1 and A17.CA other bump:1.97413 Ang I5.CD1 and A17.N other bump:2.87382 Ang I5.CD1 and L16.C other bump:2.00721 Ang V10.CG1 and E14.OE2 other bump:2.40763 Ang E11.CA and E14.OE1 other bump:1.64561 Ang V10.O and E14.OE1 other bump:2.29284 Ang V10.C and E14.OE1 other bump:2.41272 Ang V10.O and E14.CD other bump:2.99826 Ang V10.CG1 and E14.CD other bump:3.1113 Ang V10.C and E14.CD other bump:2.66759 Ang I5.CD1 and A13.O T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLR 1gpjA 213 :GEAVRFDELVDHLARSDVVVSATAAPHPVIHVDDVREALRKRD Fragment has 44 clashes (null) has 44 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 45 residues other bump:2.86372 Ang D15.CG and L43.CD2 other bump:2.2607 Ang D15.OD2 and L43.CD2 other bump:2.76557 Ang D15.C and L43.CD1 other bump:1.73614 Ang D15.O and L43.CD1 other bump:2.79188 Ang D15.OD1 and L43.CD1 other bump:2.34312 Ang D15.CG and L43.CG other bump:2.41345 Ang D15.OD2 and L43.CG other bump:2.13139 Ang D15.OD1 and L43.CG other bump:1.94768 Ang D15.OD1 and K39.O other bump:0.500343 Ang L14.O and K39.NZ other bump:2.52873 Ang L14.CA and K39.NZ other bump:1.14865 Ang L14.C and K39.NZ other bump:2.20145 Ang D15.CA and K39.NZ other bump:2.34434 Ang D15.C and K39.NZ other bump:1.87788 Ang D15.N and K39.NZ other bump:2.89342 Ang D13.C and K39.CE other bump:2.22774 Ang L14.N and K39.CE other bump:1.51092 Ang L14.O and K39.CE other bump:1.18933 Ang L14.CA and K39.CE other bump:2.11486 Ang L14.CB and K39.CE other bump:0.373084 Ang L14.C and K39.CE other bump:2.63342 Ang D15.CA and K39.CE other bump:1.44807 Ang D15.N and K39.CE other bump:3.02821 Ang L14.CG and K39.CD other bump:2.51902 Ang L14.O and K39.CD other bump:1.94455 Ang L14.CA and K39.CD other bump:1.51814 Ang L14.CB and K39.CD other bump:1.75693 Ang L14.C and K39.CD other bump:3.0843 Ang D15.CA and K39.CD other bump:2.10043 Ang D15.N and K39.CD other bump:2.9058 Ang L14.CB and K39.CG other bump:2.58549 Ang L14.C and K39.CG other bump:2.49827 Ang D15.CA and K39.CG other bump:2.11939 Ang D15.N and K39.CG other bump:3.04697 Ang D15.CB and K39.CG other bump:1.67603 Ang I32.O and P36.CD other bump:2.89863 Ang I32.C and P36.CD other bump:3.08794 Ang D33.C and P36.CD other bump:2.47197 Ang I32.O and P36.CG self-bump: 1.39825 Ang D33.CA and D33.CB other bump:2.45711 Ang D13.O and V17.CG2 other bump:2.68119 Ang V5.CG2 and D13.OD2 other bump:2.80762 Ang G9.C and D13.OD1 other bump:2.0717 Ang G9.O and D13.OD1 T0191 117 :EDMVVMDLIYNPLETVLLKEAKKVNAKTINGLGMLIYQGAVAF 1gpjA 258 :SPILIIDIANPRDVEEGVENIEDVEVRTIDDLRVIARENLERR Fragment has 22 clashes (null) has 22 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 45 residues other bump:2.83524 Ang M7.SD and L33.CD1 other bump:2.96977 Ang K20.CG and A27.CB neighbor-bump: 2.17254 Ang V17.O and L18.CB neighbor-bump: 2.59256 Ang V17.C and L18.CB other bump:1.52281 Ang V6.CG2 and E15.OE2 other bump:2.68992 Ang V6.CB and E15.OE2 other bump:2.32514 Ang V6.CG2 and E15.CD other bump:2.77381 Ang I10.CG1 and L14.CD2 other bump:1.65862 Ang I10.CD1 and L14.CD2 other bump:2.57874 Ang I10.CG2 and L14.CD1 other bump:2.87153 Ang I10.CB and L14.CG other bump:2.00364 Ang I10.CG1 and L14.CG other bump:2.74877 Ang I10.CG2 and L14.CG other bump:1.505 Ang I10.CD1 and L14.CG other bump:2.79244 Ang I10.CG1 and L14.CB other bump:2.19287 Ang I10.CD1 and L14.CB other bump:3.09048 Ang I10.CG1 and L14.CA other bump:2.23387 Ang I10.CD1 and L14.CA other bump:2.55671 Ang I10.CG1 and L14.N other bump:2.30715 Ang I10.CD1 and L14.N other bump:2.96953 Ang I10.CD1 and P13.C other bump:2.76002 Ang M7.CE and L9.CD1 Number of specific fragments= 5 total=516 Number of alignments=93 # Reading fragments from alignment file # T0191 read from T0191-1gpjA-2track-protein-EBGHTL-global-adpstyle1.pw.a2m.gz # 1gpjA read from T0191-1gpjA-2track-protein-EBGHTL-global-adpstyle1.pw.a2m.gz # found chain 1gpjA in template set T0191 1 :I 1gpjA 1 :M Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 2 residues T0191 2 :GYNTDGIGARMALEEEIGRVKDKNIVIYGAGGAARAVAFELAK 1gpjA 146 :GAVSIGSAAVELAERELGSLHDKTVLVVGAGEMGKTVAKSLVD Fragment has 76 clashes (null) has 76 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 45 residues other bump:2.32562 Ang L14.CD1 and L42.CD2 other bump:2.26175 Ang R11.NH1 and E41.C other bump:2.70446 Ang R11.CD and E41.O other bump:2.20049 Ang R11.NH1 and E41.O other bump:1.16878 Ang A37.O and E41.OE1 other bump:2.12325 Ang A37.C and E41.OE1 other bump:2.71002 Ang V38.CA and E41.OE1 other bump:3.06491 Ang G7.CA and E41.CD other bump:2.03305 Ang A37.O and E41.CD other bump:2.97567 Ang A37.C and E41.CD other bump:3.08232 Ang G7.CA and E41.CG other bump:3.24563 Ang G7.C and E41.CG other bump:2.83406 Ang R11.CZ and E41.CB other bump:1.98869 Ang R11.NH1 and E41.CB other bump:1.91041 Ang R11.NH1 and E41.CA other bump:2.71694 Ang Y3.CB and M12.SD other bump:1.83398 Ang I8.CD1 and R11.NH2 other bump:2.88577 Ang Y3.CG and G9.CA other bump:2.27855 Ang Y3.CD2 and G9.CA other bump:2.62641 Ang Y3.CE2 and G9.CA other bump:2.49919 Ang Y3.CD1 and G9.N other bump:2.16413 Ang Y3.CG and G9.N other bump:1.652 Ang Y3.CD2 and G9.N other bump:1.55884 Ang Y3.CE2 and G9.N other bump:2.44228 Ang Y3.CE1 and G9.N other bump:2.00811 Ang Y3.CZ and G9.N other bump:1.75321 Ang Y3.CD1 and I8.C other bump:2.1123 Ang Y3.CG and I8.C other bump:2.42046 Ang Y3.CD2 and I8.C other bump:2.44556 Ang Y3.CE2 and I8.C other bump:3.29349 Ang Y3.CB and I8.C other bump:1.78431 Ang Y3.CE1 and I8.C other bump:2.14011 Ang Y3.CZ and I8.C other bump:2.31189 Ang Y3.CD1 and I8.O other bump:2.61852 Ang Y3.CG and I8.O other bump:3.14929 Ang Y3.CA and I8.CG2 other bump:1.35201 Ang Y3.CD1 and I8.CG2 other bump:2.30031 Ang Y3.CG and I8.CG2 other bump:2.78818 Ang Y3.CB and I8.CG2 other bump:2.34648 Ang Y3.CE1 and I8.CG2 other bump:2.74217 Ang Y3.CD1 and I8.CG1 other bump:2.23779 Ang Y3.CE1 and I8.CG1 other bump:1.23883 Ang Y3.CD1 and I8.CB other bump:2.40368 Ang Y3.CG and I8.CB other bump:3.10444 Ang Y3.CD2 and I8.CB other bump:3.069 Ang Y3.CE2 and I8.CB other bump:1.12483 Ang Y3.CE1 and I8.CB other bump:2.26274 Ang Y3.CZ and I8.CB other bump:1.62932 Ang Y3.CD1 and I8.CA other bump:2.71932 Ang Y3.CG and I8.CA other bump:3.12305 Ang Y3.CD2 and I8.CA other bump:2.75622 Ang Y3.CE2 and I8.CA other bump:2.512 Ang Y3.OH and I8.CA other bump:0.665591 Ang Y3.CE1 and I8.CA other bump:1.68541 Ang Y3.CZ and I8.CA other bump:2.83655 Ang Y3.CD1 and I8.N other bump:2.57477 Ang Y3.CE2 and I8.N other bump:1.15168 Ang Y3.OH and I8.N other bump:1.48594 Ang Y3.CE1 and I8.N other bump:1.20467 Ang Y3.CZ and I8.N other bump:3.2778 Ang Y3.CE2 and G7.C other bump:1.5461 Ang Y3.OH and G7.C other bump:2.68496 Ang Y3.CE1 and G7.C other bump:2.19595 Ang Y3.CZ and G7.C other bump:1.81848 Ang Y3.OH and G7.CA other bump:3.05225 Ang Y3.CZ and G7.CA other bump:1.8189 Ang Y3.OH and G7.N other bump:2.96188 Ang Y3.CZ and G7.N other bump:3.11491 Ang Y3.CE2 and D6.C other bump:2.54751 Ang Y3.OH and D6.C other bump:3.21493 Ang Y3.CZ and D6.C other bump:2.49392 Ang Y3.CE2 and T5.C other bump:3.13648 Ang Y3.CZ and T5.C other bump:2.21115 Ang Y3.CD2 and T5.O other bump:1.32678 Ang Y3.CE2 and T5.O other bump:2.27616 Ang Y3.CZ and T5.O T0191 45 :DN 1gpjA 190 :GV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues T0191 47 :NIIIANRTVEKAEALAKEIA 1gpjA 193 :AVLVANRTYERAVELARDLG Fragment has 19 clashes (null) has 19 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 22 residues other bump:3.28619 Ang I3.CG1 and G22.CA neighbor-bump: 2.2506 Ang I20.O and A21.CB neighbor-bump: 2.53375 Ang I20.C and A21.CB other bump:1.44539 Ang I3.CD1 and I20.CG2 other bump:2.89365 Ang I3.CG1 and I20.CG2 other bump:2.80691 Ang I3.CD1 and I20.CB other bump:2.49571 Ang I5.CD1 and A17.CB other bump:2.9766 Ang I5.CG1 and A17.CB other bump:2.28293 Ang I5.CD1 and A17.CA other bump:1.97413 Ang I5.CD1 and A17.N other bump:2.87382 Ang I5.CD1 and L16.C other bump:2.00721 Ang V10.CG1 and E14.OE2 other bump:2.40763 Ang E11.CA and E14.OE1 other bump:1.64561 Ang V10.O and E14.OE1 other bump:2.29284 Ang V10.C and E14.OE1 other bump:2.41272 Ang V10.O and E14.CD other bump:2.99826 Ang V10.CG1 and E14.CD other bump:3.1113 Ang V10.C and E14.CD other bump:2.66759 Ang I5.CD1 and A13.O T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLR 1gpjA 213 :GEAVRFDELVDHLARSDVVVSATAAPHPVIHVDDVREALRKRD Fragment has 44 clashes (null) has 44 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 45 residues other bump:2.86372 Ang D15.CG and L43.CD2 other bump:2.2607 Ang D15.OD2 and L43.CD2 other bump:2.76557 Ang D15.C and L43.CD1 other bump:1.73614 Ang D15.O and L43.CD1 other bump:2.79188 Ang D15.OD1 and L43.CD1 other bump:2.34312 Ang D15.CG and L43.CG other bump:2.41345 Ang D15.OD2 and L43.CG other bump:2.13139 Ang D15.OD1 and L43.CG other bump:1.94768 Ang D15.OD1 and K39.O other bump:0.500343 Ang L14.O and K39.NZ other bump:2.52873 Ang L14.CA and K39.NZ other bump:1.14865 Ang L14.C and K39.NZ other bump:2.20145 Ang D15.CA and K39.NZ other bump:2.34434 Ang D15.C and K39.NZ other bump:1.87788 Ang D15.N and K39.NZ other bump:2.89342 Ang D13.C and K39.CE other bump:2.22774 Ang L14.N and K39.CE other bump:1.51092 Ang L14.O and K39.CE other bump:1.18933 Ang L14.CA and K39.CE other bump:2.11486 Ang L14.CB and K39.CE other bump:0.373084 Ang L14.C and K39.CE other bump:2.63342 Ang D15.CA and K39.CE other bump:1.44807 Ang D15.N and K39.CE other bump:3.02821 Ang L14.CG and K39.CD other bump:2.51902 Ang L14.O and K39.CD other bump:1.94455 Ang L14.CA and K39.CD other bump:1.51814 Ang L14.CB and K39.CD other bump:1.75693 Ang L14.C and K39.CD other bump:3.0843 Ang D15.CA and K39.CD other bump:2.10043 Ang D15.N and K39.CD other bump:2.9058 Ang L14.CB and K39.CG other bump:2.58549 Ang L14.C and K39.CG other bump:2.49827 Ang D15.CA and K39.CG other bump:2.11939 Ang D15.N and K39.CG other bump:3.04697 Ang D15.CB and K39.CG other bump:1.67603 Ang I32.O and P36.CD other bump:2.89863 Ang I32.C and P36.CD other bump:3.08794 Ang D33.C and P36.CD other bump:2.47197 Ang I32.O and P36.CG self-bump: 1.39825 Ang D33.CA and D33.CB other bump:2.45711 Ang D13.O and V17.CG2 other bump:2.68119 Ang V5.CG2 and D13.OD2 other bump:2.80762 Ang G9.C and D13.OD1 other bump:2.0717 Ang G9.O and D13.OD1 T0191 117 :EDMVVMDLIYNPLETVLLKEAKKVNAKTINGLGMLIYQGAVAFK 1gpjA 258 :SPILIIDIANPRDVEEGVENIEDVEVRTIDDLRVIARENLERRR Fragment has 22 clashes (null) has 22 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 45 residues other bump:2.83524 Ang M7.SD and L33.CD1 other bump:2.96977 Ang K20.CG and A27.CB neighbor-bump: 2.17254 Ang V17.O and L18.CB neighbor-bump: 2.59256 Ang V17.C and L18.CB other bump:1.52281 Ang V6.CG2 and E15.OE2 other bump:2.68992 Ang V6.CB and E15.OE2 other bump:2.32514 Ang V6.CG2 and E15.CD other bump:2.77381 Ang I10.CG1 and L14.CD2 other bump:1.65862 Ang I10.CD1 and L14.CD2 other bump:2.57874 Ang I10.CG2 and L14.CD1 other bump:2.87153 Ang I10.CB and L14.CG other bump:2.00364 Ang I10.CG1 and L14.CG other bump:2.74877 Ang I10.CG2 and L14.CG other bump:1.505 Ang I10.CD1 and L14.CG other bump:2.79244 Ang I10.CG1 and L14.CB other bump:2.19287 Ang I10.CD1 and L14.CB other bump:3.09048 Ang I10.CG1 and L14.CA other bump:2.23387 Ang I10.CD1 and L14.CA other bump:2.55671 Ang I10.CG1 and L14.N other bump:2.30715 Ang I10.CD1 and L14.N other bump:2.96953 Ang I10.CD1 and P13.C other bump:2.76002 Ang M7.CE and L9.CD1 Number of specific fragments= 6 total=522 Number of alignments=94 # Reading fragments from alignment file # T0191 read from T0191-1gpjA-2track-protein-EBGHTL-global-adpstyle5.pw.a2m.gz # 1gpjA read from T0191-1gpjA-2track-protein-EBGHTL-global-adpstyle5.pw.a2m.gz # found chain 1gpjA in template set T0191 1 :I 1gpjA 1 :M Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 2 residues T0191 2 :GYNTDGIGARMALEEEIGRVKDKNIVIYGAGGAARAVAFELAK 1gpjA 146 :GAVSIGSAAVELAERELGSLHDKTVLVVGAGEMGKTVAKSLVD Fragment has 76 clashes (null) has 76 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 45 residues other bump:2.32562 Ang L14.CD1 and L42.CD2 other bump:2.26175 Ang R11.NH1 and E41.C other bump:2.70446 Ang R11.CD and E41.O other bump:2.20049 Ang R11.NH1 and E41.O other bump:1.16878 Ang A37.O and E41.OE1 other bump:2.12325 Ang A37.C and E41.OE1 other bump:2.71002 Ang V38.CA and E41.OE1 other bump:3.06491 Ang G7.CA and E41.CD other bump:2.03305 Ang A37.O and E41.CD other bump:2.97567 Ang A37.C and E41.CD other bump:3.08232 Ang G7.CA and E41.CG other bump:3.24563 Ang G7.C and E41.CG other bump:2.83406 Ang R11.CZ and E41.CB other bump:1.98869 Ang R11.NH1 and E41.CB other bump:1.91041 Ang R11.NH1 and E41.CA other bump:2.71694 Ang Y3.CB and M12.SD other bump:1.83398 Ang I8.CD1 and R11.NH2 other bump:2.88577 Ang Y3.CG and G9.CA other bump:2.27855 Ang Y3.CD2 and G9.CA other bump:2.62641 Ang Y3.CE2 and G9.CA other bump:2.49919 Ang Y3.CD1 and G9.N other bump:2.16413 Ang Y3.CG and G9.N other bump:1.652 Ang Y3.CD2 and G9.N other bump:1.55884 Ang Y3.CE2 and G9.N other bump:2.44228 Ang Y3.CE1 and G9.N other bump:2.00811 Ang Y3.CZ and G9.N other bump:1.75321 Ang Y3.CD1 and I8.C other bump:2.1123 Ang Y3.CG and I8.C other bump:2.42046 Ang Y3.CD2 and I8.C other bump:2.44556 Ang Y3.CE2 and I8.C other bump:3.29349 Ang Y3.CB and I8.C other bump:1.78431 Ang Y3.CE1 and I8.C other bump:2.14011 Ang Y3.CZ and I8.C other bump:2.31189 Ang Y3.CD1 and I8.O other bump:2.61852 Ang Y3.CG and I8.O other bump:3.14929 Ang Y3.CA and I8.CG2 other bump:1.35201 Ang Y3.CD1 and I8.CG2 other bump:2.30031 Ang Y3.CG and I8.CG2 other bump:2.78818 Ang Y3.CB and I8.CG2 other bump:2.34648 Ang Y3.CE1 and I8.CG2 other bump:2.74217 Ang Y3.CD1 and I8.CG1 other bump:2.23779 Ang Y3.CE1 and I8.CG1 other bump:1.23883 Ang Y3.CD1 and I8.CB other bump:2.40368 Ang Y3.CG and I8.CB other bump:3.10444 Ang Y3.CD2 and I8.CB other bump:3.069 Ang Y3.CE2 and I8.CB other bump:1.12483 Ang Y3.CE1 and I8.CB other bump:2.26274 Ang Y3.CZ and I8.CB other bump:1.62932 Ang Y3.CD1 and I8.CA other bump:2.71932 Ang Y3.CG and I8.CA other bump:3.12305 Ang Y3.CD2 and I8.CA other bump:2.75622 Ang Y3.CE2 and I8.CA other bump:2.512 Ang Y3.OH and I8.CA other bump:0.665591 Ang Y3.CE1 and I8.CA other bump:1.68541 Ang Y3.CZ and I8.CA other bump:2.83655 Ang Y3.CD1 and I8.N other bump:2.57477 Ang Y3.CE2 and I8.N other bump:1.15168 Ang Y3.OH and I8.N other bump:1.48594 Ang Y3.CE1 and I8.N other bump:1.20467 Ang Y3.CZ and I8.N other bump:3.2778 Ang Y3.CE2 and G7.C other bump:1.5461 Ang Y3.OH and G7.C other bump:2.68496 Ang Y3.CE1 and G7.C other bump:2.19595 Ang Y3.CZ and G7.C other bump:1.81848 Ang Y3.OH and G7.CA other bump:3.05225 Ang Y3.CZ and G7.CA other bump:1.8189 Ang Y3.OH and G7.N other bump:2.96188 Ang Y3.CZ and G7.N other bump:3.11491 Ang Y3.CE2 and D6.C other bump:2.54751 Ang Y3.OH and D6.C other bump:3.21493 Ang Y3.CZ and D6.C other bump:2.49392 Ang Y3.CE2 and T5.C other bump:3.13648 Ang Y3.CZ and T5.C other bump:2.21115 Ang Y3.CD2 and T5.O other bump:1.32678 Ang Y3.CE2 and T5.O other bump:2.27616 Ang Y3.CZ and T5.O T0191 45 :DN 1gpjA 190 :GV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues T0191 47 :NIIIANRTVEKAEALAKEIA 1gpjA 193 :AVLVANRTYERAVELARDLG Fragment has 19 clashes (null) has 19 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 22 residues other bump:3.28619 Ang I3.CG1 and G22.CA neighbor-bump: 2.2506 Ang I20.O and A21.CB neighbor-bump: 2.53375 Ang I20.C and A21.CB other bump:1.44539 Ang I3.CD1 and I20.CG2 other bump:2.89365 Ang I3.CG1 and I20.CG2 other bump:2.80691 Ang I3.CD1 and I20.CB other bump:2.49571 Ang I5.CD1 and A17.CB other bump:2.9766 Ang I5.CG1 and A17.CB other bump:2.28293 Ang I5.CD1 and A17.CA other bump:1.97413 Ang I5.CD1 and A17.N other bump:2.87382 Ang I5.CD1 and L16.C other bump:2.00721 Ang V10.CG1 and E14.OE2 other bump:2.40763 Ang E11.CA and E14.OE1 other bump:1.64561 Ang V10.O and E14.OE1 other bump:2.29284 Ang V10.C and E14.OE1 other bump:2.41272 Ang V10.O and E14.CD other bump:2.99826 Ang V10.CG1 and E14.CD other bump:3.1113 Ang V10.C and E14.CD other bump:2.66759 Ang I5.CD1 and A13.O T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLR 1gpjA 213 :GEAVRFDELVDHLARSDVVVSATAAPHPVIHVDDVREALRKRD Fragment has 44 clashes (null) has 44 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 45 residues other bump:2.86372 Ang D15.CG and L43.CD2 other bump:2.2607 Ang D15.OD2 and L43.CD2 other bump:2.76557 Ang D15.C and L43.CD1 other bump:1.73614 Ang D15.O and L43.CD1 other bump:2.79188 Ang D15.OD1 and L43.CD1 other bump:2.34312 Ang D15.CG and L43.CG other bump:2.41345 Ang D15.OD2 and L43.CG other bump:2.13139 Ang D15.OD1 and L43.CG other bump:1.94768 Ang D15.OD1 and K39.O other bump:0.500343 Ang L14.O and K39.NZ other bump:2.52873 Ang L14.CA and K39.NZ other bump:1.14865 Ang L14.C and K39.NZ other bump:2.20145 Ang D15.CA and K39.NZ other bump:2.34434 Ang D15.C and K39.NZ other bump:1.87788 Ang D15.N and K39.NZ other bump:2.89342 Ang D13.C and K39.CE other bump:2.22774 Ang L14.N and K39.CE other bump:1.51092 Ang L14.O and K39.CE other bump:1.18933 Ang L14.CA and K39.CE other bump:2.11486 Ang L14.CB and K39.CE other bump:0.373084 Ang L14.C and K39.CE other bump:2.63342 Ang D15.CA and K39.CE other bump:1.44807 Ang D15.N and K39.CE other bump:3.02821 Ang L14.CG and K39.CD other bump:2.51902 Ang L14.O and K39.CD other bump:1.94455 Ang L14.CA and K39.CD other bump:1.51814 Ang L14.CB and K39.CD other bump:1.75693 Ang L14.C and K39.CD other bump:3.0843 Ang D15.CA and K39.CD other bump:2.10043 Ang D15.N and K39.CD other bump:2.9058 Ang L14.CB and K39.CG other bump:2.58549 Ang L14.C and K39.CG other bump:2.49827 Ang D15.CA and K39.CG other bump:2.11939 Ang D15.N and K39.CG other bump:3.04697 Ang D15.CB and K39.CG other bump:1.67603 Ang I32.O and P36.CD other bump:2.89863 Ang I32.C and P36.CD other bump:3.08794 Ang D33.C and P36.CD other bump:2.47197 Ang I32.O and P36.CG self-bump: 1.39825 Ang D33.CA and D33.CB other bump:2.45711 Ang D13.O and V17.CG2 other bump:2.68119 Ang V5.CG2 and D13.OD2 other bump:2.80762 Ang G9.C and D13.OD1 other bump:2.0717 Ang G9.O and D13.OD1 T0191 117 :EDMVVMDLIYNPLETVLLKEAKKVNAKTINGLGMLIYQGAVAFK 1gpjA 258 :SPILIIDIANPRDVEEGVENIEDVEVRTIDDLRVIARENLERRR Fragment has 22 clashes (null) has 22 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 45 residues other bump:2.83524 Ang M7.SD and L33.CD1 other bump:2.96977 Ang K20.CG and A27.CB neighbor-bump: 2.17254 Ang V17.O and L18.CB neighbor-bump: 2.59256 Ang V17.C and L18.CB other bump:1.52281 Ang V6.CG2 and E15.OE2 other bump:2.68992 Ang V6.CB and E15.OE2 other bump:2.32514 Ang V6.CG2 and E15.CD other bump:2.77381 Ang I10.CG1 and L14.CD2 other bump:1.65862 Ang I10.CD1 and L14.CD2 other bump:2.57874 Ang I10.CG2 and L14.CD1 other bump:2.87153 Ang I10.CB and L14.CG other bump:2.00364 Ang I10.CG1 and L14.CG other bump:2.74877 Ang I10.CG2 and L14.CG other bump:1.505 Ang I10.CD1 and L14.CG other bump:2.79244 Ang I10.CG1 and L14.CB other bump:2.19287 Ang I10.CD1 and L14.CB other bump:3.09048 Ang I10.CG1 and L14.CA other bump:2.23387 Ang I10.CD1 and L14.CA other bump:2.55671 Ang I10.CG1 and L14.N other bump:2.30715 Ang I10.CD1 and L14.N other bump:2.96953 Ang I10.CD1 and P13.C other bump:2.76002 Ang M7.CE and L9.CD1 Number of specific fragments= 6 total=528 Number of alignments=95 # Reading fragments from alignment file # T0191 read from T0191-1gpjA-2track-protein-EBGHTL-local-adpstyle1.pw.a2m.gz # 1gpjA read from T0191-1gpjA-2track-protein-EBGHTL-local-adpstyle1.pw.a2m.gz # found chain 1gpjA in template set T0191 2 :GYNTDGIGARMALEEEIGRVKDKNIVIYGAGGAARAVAFELAK 1gpjA 146 :GAVSIGSAAVELAERELGSLHDKTVLVVGAGEMGKTVAKSLVD Fragment has 76 clashes (null) has 76 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 45 residues other bump:2.32562 Ang L14.CD1 and L42.CD2 other bump:2.26175 Ang R11.NH1 and E41.C other bump:2.70446 Ang R11.CD and E41.O other bump:2.20049 Ang R11.NH1 and E41.O other bump:1.16878 Ang A37.O and E41.OE1 other bump:2.12325 Ang A37.C and E41.OE1 other bump:2.71002 Ang V38.CA and E41.OE1 other bump:3.06491 Ang G7.CA and E41.CD other bump:2.03305 Ang A37.O and E41.CD other bump:2.97567 Ang A37.C and E41.CD other bump:3.08232 Ang G7.CA and E41.CG other bump:3.24563 Ang G7.C and E41.CG other bump:2.83406 Ang R11.CZ and E41.CB other bump:1.98869 Ang R11.NH1 and E41.CB other bump:1.91041 Ang R11.NH1 and E41.CA other bump:2.71694 Ang Y3.CB and M12.SD other bump:1.83398 Ang I8.CD1 and R11.NH2 other bump:2.88577 Ang Y3.CG and G9.CA other bump:2.27855 Ang Y3.CD2 and G9.CA other bump:2.62641 Ang Y3.CE2 and G9.CA other bump:2.49919 Ang Y3.CD1 and G9.N other bump:2.16413 Ang Y3.CG and G9.N other bump:1.652 Ang Y3.CD2 and G9.N other bump:1.55884 Ang Y3.CE2 and G9.N other bump:2.44228 Ang Y3.CE1 and G9.N other bump:2.00811 Ang Y3.CZ and G9.N other bump:1.75321 Ang Y3.CD1 and I8.C other bump:2.1123 Ang Y3.CG and I8.C other bump:2.42046 Ang Y3.CD2 and I8.C other bump:2.44556 Ang Y3.CE2 and I8.C other bump:3.29349 Ang Y3.CB and I8.C other bump:1.78431 Ang Y3.CE1 and I8.C other bump:2.14011 Ang Y3.CZ and I8.C other bump:2.31189 Ang Y3.CD1 and I8.O other bump:2.61852 Ang Y3.CG and I8.O other bump:3.14929 Ang Y3.CA and I8.CG2 other bump:1.35201 Ang Y3.CD1 and I8.CG2 other bump:2.30031 Ang Y3.CG and I8.CG2 other bump:2.78818 Ang Y3.CB and I8.CG2 other bump:2.34648 Ang Y3.CE1 and I8.CG2 other bump:2.74217 Ang Y3.CD1 and I8.CG1 other bump:2.23779 Ang Y3.CE1 and I8.CG1 other bump:1.23883 Ang Y3.CD1 and I8.CB other bump:2.40368 Ang Y3.CG and I8.CB other bump:3.10444 Ang Y3.CD2 and I8.CB other bump:3.069 Ang Y3.CE2 and I8.CB other bump:1.12483 Ang Y3.CE1 and I8.CB other bump:2.26274 Ang Y3.CZ and I8.CB other bump:1.62932 Ang Y3.CD1 and I8.CA other bump:2.71932 Ang Y3.CG and I8.CA other bump:3.12305 Ang Y3.CD2 and I8.CA other bump:2.75622 Ang Y3.CE2 and I8.CA other bump:2.512 Ang Y3.OH and I8.CA other bump:0.665591 Ang Y3.CE1 and I8.CA other bump:1.68541 Ang Y3.CZ and I8.CA other bump:2.83655 Ang Y3.CD1 and I8.N other bump:2.57477 Ang Y3.CE2 and I8.N other bump:1.15168 Ang Y3.OH and I8.N other bump:1.48594 Ang Y3.CE1 and I8.N other bump:1.20467 Ang Y3.CZ and I8.N other bump:3.2778 Ang Y3.CE2 and G7.C other bump:1.5461 Ang Y3.OH and G7.C other bump:2.68496 Ang Y3.CE1 and G7.C other bump:2.19595 Ang Y3.CZ and G7.C other bump:1.81848 Ang Y3.OH and G7.CA other bump:3.05225 Ang Y3.CZ and G7.CA other bump:1.8189 Ang Y3.OH and G7.N other bump:2.96188 Ang Y3.CZ and G7.N other bump:3.11491 Ang Y3.CE2 and D6.C other bump:2.54751 Ang Y3.OH and D6.C other bump:3.21493 Ang Y3.CZ and D6.C other bump:2.49392 Ang Y3.CE2 and T5.C other bump:3.13648 Ang Y3.CZ and T5.C other bump:2.21115 Ang Y3.CD2 and T5.O other bump:1.32678 Ang Y3.CE2 and T5.O other bump:2.27616 Ang Y3.CZ and T5.O T0191 45 :DN 1gpjA 190 :GV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues T0191 47 :NIIIANRTVEKAEALAKEIA 1gpjA 193 :AVLVANRTYERAVELARDLG Fragment has 19 clashes (null) has 19 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 22 residues other bump:3.28619 Ang I3.CG1 and G22.CA neighbor-bump: 2.2506 Ang I20.O and A21.CB neighbor-bump: 2.53375 Ang I20.C and A21.CB other bump:1.44539 Ang I3.CD1 and I20.CG2 other bump:2.89365 Ang I3.CG1 and I20.CG2 other bump:2.80691 Ang I3.CD1 and I20.CB other bump:2.49571 Ang I5.CD1 and A17.CB other bump:2.9766 Ang I5.CG1 and A17.CB other bump:2.28293 Ang I5.CD1 and A17.CA other bump:1.97413 Ang I5.CD1 and A17.N other bump:2.87382 Ang I5.CD1 and L16.C other bump:2.00721 Ang V10.CG1 and E14.OE2 other bump:2.40763 Ang E11.CA and E14.OE1 other bump:1.64561 Ang V10.O and E14.OE1 other bump:2.29284 Ang V10.C and E14.OE1 other bump:2.41272 Ang V10.O and E14.CD other bump:2.99826 Ang V10.CG1 and E14.CD other bump:3.1113 Ang V10.C and E14.CD other bump:2.66759 Ang I5.CD1 and A13.O T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLR 1gpjA 213 :GEAVRFDELVDHLARSDVVVSATAAPHPVIHVDDVREALRKRD Fragment has 44 clashes (null) has 44 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 45 residues other bump:2.86372 Ang D15.CG and L43.CD2 other bump:2.2607 Ang D15.OD2 and L43.CD2 other bump:2.76557 Ang D15.C and L43.CD1 other bump:1.73614 Ang D15.O and L43.CD1 other bump:2.79188 Ang D15.OD1 and L43.CD1 other bump:2.34312 Ang D15.CG and L43.CG other bump:2.41345 Ang D15.OD2 and L43.CG other bump:2.13139 Ang D15.OD1 and L43.CG other bump:1.94768 Ang D15.OD1 and K39.O other bump:0.500343 Ang L14.O and K39.NZ other bump:2.52873 Ang L14.CA and K39.NZ other bump:1.14865 Ang L14.C and K39.NZ other bump:2.20145 Ang D15.CA and K39.NZ other bump:2.34434 Ang D15.C and K39.NZ other bump:1.87788 Ang D15.N and K39.NZ other bump:2.89342 Ang D13.C and K39.CE other bump:2.22774 Ang L14.N and K39.CE other bump:1.51092 Ang L14.O and K39.CE other bump:1.18933 Ang L14.CA and K39.CE other bump:2.11486 Ang L14.CB and K39.CE other bump:0.373084 Ang L14.C and K39.CE other bump:2.63342 Ang D15.CA and K39.CE other bump:1.44807 Ang D15.N and K39.CE other bump:3.02821 Ang L14.CG and K39.CD other bump:2.51902 Ang L14.O and K39.CD other bump:1.94455 Ang L14.CA and K39.CD other bump:1.51814 Ang L14.CB and K39.CD other bump:1.75693 Ang L14.C and K39.CD other bump:3.0843 Ang D15.CA and K39.CD other bump:2.10043 Ang D15.N and K39.CD other bump:2.9058 Ang L14.CB and K39.CG other bump:2.58549 Ang L14.C and K39.CG other bump:2.49827 Ang D15.CA and K39.CG other bump:2.11939 Ang D15.N and K39.CG other bump:3.04697 Ang D15.CB and K39.CG other bump:1.67603 Ang I32.O and P36.CD other bump:2.89863 Ang I32.C and P36.CD other bump:3.08794 Ang D33.C and P36.CD other bump:2.47197 Ang I32.O and P36.CG self-bump: 1.39825 Ang D33.CA and D33.CB other bump:2.45711 Ang D13.O and V17.CG2 other bump:2.68119 Ang V5.CG2 and D13.OD2 other bump:2.80762 Ang G9.C and D13.OD1 other bump:2.0717 Ang G9.O and D13.OD1 T0191 117 :EDMVVMDLIYNPLETVLLKEAKKVNAKTINGLGMLIYQGAVAF 1gpjA 258 :SPILIIDIANPRDVEEGVENIEDVEVRTIDDLRVIARENLERR Fragment has 22 clashes (null) has 22 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 45 residues other bump:2.83524 Ang M7.SD and L33.CD1 other bump:2.96977 Ang K20.CG and A27.CB neighbor-bump: 2.17254 Ang V17.O and L18.CB neighbor-bump: 2.59256 Ang V17.C and L18.CB other bump:1.52281 Ang V6.CG2 and E15.OE2 other bump:2.68992 Ang V6.CB and E15.OE2 other bump:2.32514 Ang V6.CG2 and E15.CD other bump:2.77381 Ang I10.CG1 and L14.CD2 other bump:1.65862 Ang I10.CD1 and L14.CD2 other bump:2.57874 Ang I10.CG2 and L14.CD1 other bump:2.87153 Ang I10.CB and L14.CG other bump:2.00364 Ang I10.CG1 and L14.CG other bump:2.74877 Ang I10.CG2 and L14.CG other bump:1.505 Ang I10.CD1 and L14.CG other bump:2.79244 Ang I10.CG1 and L14.CB other bump:2.19287 Ang I10.CD1 and L14.CB other bump:3.09048 Ang I10.CG1 and L14.CA other bump:2.23387 Ang I10.CD1 and L14.CA other bump:2.55671 Ang I10.CG1 and L14.N other bump:2.30715 Ang I10.CD1 and L14.N other bump:2.96953 Ang I10.CD1 and P13.C other bump:2.76002 Ang M7.CE and L9.CD1 Number of specific fragments= 5 total=533 Number of alignments=96 # Reading fragments from alignment file # T0191 read from T0191-1gpjA-2track-protein-EBGHTL-local-adpstyle5.pw.a2m.gz # 1gpjA read from T0191-1gpjA-2track-protein-EBGHTL-local-adpstyle5.pw.a2m.gz # found chain 1gpjA in template set T0191 1 :IGYNTDGIGARMALEEEIGRVKDKNIVIYGAGGAARAVAFELAK 1gpjA 145 :EGAVSIGSAAVELAERELGSLHDKTVLVVGAGEMGKTVAKSLVD Fragment has 76 clashes (null) has 76 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 45 residues other bump:2.32562 Ang L14.CD1 and L42.CD2 other bump:2.26175 Ang R11.NH1 and E41.C other bump:2.70446 Ang R11.CD and E41.O other bump:2.20049 Ang R11.NH1 and E41.O other bump:1.16878 Ang A37.O and E41.OE1 other bump:2.12325 Ang A37.C and E41.OE1 other bump:2.71002 Ang V38.CA and E41.OE1 other bump:3.06491 Ang G7.CA and E41.CD other bump:2.03305 Ang A37.O and E41.CD other bump:2.97567 Ang A37.C and E41.CD other bump:3.08232 Ang G7.CA and E41.CG other bump:3.24563 Ang G7.C and E41.CG other bump:2.83406 Ang R11.CZ and E41.CB other bump:1.98869 Ang R11.NH1 and E41.CB other bump:1.91041 Ang R11.NH1 and E41.CA other bump:2.71694 Ang Y3.CB and M12.SD other bump:1.83398 Ang I8.CD1 and R11.NH2 other bump:2.88577 Ang Y3.CG and G9.CA other bump:2.27855 Ang Y3.CD2 and G9.CA other bump:2.62641 Ang Y3.CE2 and G9.CA other bump:2.16413 Ang Y3.CG and G9.N other bump:1.652 Ang Y3.CD2 and G9.N other bump:2.49919 Ang Y3.CD1 and G9.N other bump:2.44228 Ang Y3.CE1 and G9.N other bump:1.55884 Ang Y3.CE2 and G9.N other bump:2.00811 Ang Y3.CZ and G9.N other bump:2.1123 Ang Y3.CG and I8.C other bump:2.42046 Ang Y3.CD2 and I8.C other bump:3.29349 Ang Y3.CB and I8.C other bump:1.75321 Ang Y3.CD1 and I8.C other bump:1.78431 Ang Y3.CE1 and I8.C other bump:2.44556 Ang Y3.CE2 and I8.C other bump:2.14011 Ang Y3.CZ and I8.C other bump:2.61852 Ang Y3.CG and I8.O other bump:2.31189 Ang Y3.CD1 and I8.O other bump:3.14929 Ang Y3.CA and I8.CG2 other bump:2.30031 Ang Y3.CG and I8.CG2 other bump:2.78818 Ang Y3.CB and I8.CG2 other bump:1.35201 Ang Y3.CD1 and I8.CG2 other bump:2.34648 Ang Y3.CE1 and I8.CG2 other bump:2.74217 Ang Y3.CD1 and I8.CG1 other bump:2.23779 Ang Y3.CE1 and I8.CG1 other bump:2.40368 Ang Y3.CG and I8.CB other bump:3.10444 Ang Y3.CD2 and I8.CB other bump:1.23883 Ang Y3.CD1 and I8.CB other bump:1.12483 Ang Y3.CE1 and I8.CB other bump:3.069 Ang Y3.CE2 and I8.CB other bump:2.26274 Ang Y3.CZ and I8.CB other bump:2.71932 Ang Y3.CG and I8.CA other bump:3.12305 Ang Y3.CD2 and I8.CA other bump:2.512 Ang Y3.OH and I8.CA other bump:1.62932 Ang Y3.CD1 and I8.CA other bump:0.665591 Ang Y3.CE1 and I8.CA other bump:2.75622 Ang Y3.CE2 and I8.CA other bump:1.68541 Ang Y3.CZ and I8.CA other bump:1.15168 Ang Y3.OH and I8.N other bump:2.83655 Ang Y3.CD1 and I8.N other bump:1.48594 Ang Y3.CE1 and I8.N other bump:2.57477 Ang Y3.CE2 and I8.N other bump:1.20467 Ang Y3.CZ and I8.N other bump:1.5461 Ang Y3.OH and G7.C other bump:2.68496 Ang Y3.CE1 and G7.C other bump:3.2778 Ang Y3.CE2 and G7.C other bump:2.19595 Ang Y3.CZ and G7.C other bump:1.81848 Ang Y3.OH and G7.CA other bump:3.05225 Ang Y3.CZ and G7.CA other bump:1.8189 Ang Y3.OH and G7.N other bump:2.96188 Ang Y3.CZ and G7.N other bump:2.54751 Ang Y3.OH and D6.C other bump:3.11491 Ang Y3.CE2 and D6.C other bump:3.21493 Ang Y3.CZ and D6.C other bump:2.49392 Ang Y3.CE2 and T5.C other bump:3.13648 Ang Y3.CZ and T5.C other bump:2.21115 Ang Y3.CD2 and T5.O other bump:1.32678 Ang Y3.CE2 and T5.O other bump:2.27616 Ang Y3.CZ and T5.O T0191 45 :DN 1gpjA 190 :GV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues T0191 47 :NIIIANRTVEKAEALAKEIA 1gpjA 193 :AVLVANRTYERAVELARDLG Fragment has 19 clashes (null) has 19 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 22 residues other bump:3.28619 Ang I3.CG1 and G22.CA neighbor-bump: 2.2506 Ang I20.O and A21.CB neighbor-bump: 2.53375 Ang I20.C and A21.CB other bump:1.44539 Ang I3.CD1 and I20.CG2 other bump:2.89365 Ang I3.CG1 and I20.CG2 other bump:2.80691 Ang I3.CD1 and I20.CB other bump:2.49571 Ang I5.CD1 and A17.CB other bump:2.9766 Ang I5.CG1 and A17.CB other bump:2.28293 Ang I5.CD1 and A17.CA other bump:1.97413 Ang I5.CD1 and A17.N other bump:2.87382 Ang I5.CD1 and L16.C other bump:2.00721 Ang V10.CG1 and E14.OE2 other bump:2.40763 Ang E11.CA and E14.OE1 other bump:1.64561 Ang V10.O and E14.OE1 other bump:2.29284 Ang V10.C and E14.OE1 other bump:2.41272 Ang V10.O and E14.CD other bump:2.99826 Ang V10.CG1 and E14.CD other bump:3.1113 Ang V10.C and E14.CD other bump:2.66759 Ang I5.CD1 and A13.O T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLR 1gpjA 213 :GEAVRFDELVDHLARSDVVVSATAAPHPVIHVDDVREALRKRD Fragment has 44 clashes (null) has 44 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 45 residues other bump:2.86372 Ang D15.CG and L43.CD2 other bump:2.2607 Ang D15.OD2 and L43.CD2 other bump:2.76557 Ang D15.C and L43.CD1 other bump:1.73614 Ang D15.O and L43.CD1 other bump:2.79188 Ang D15.OD1 and L43.CD1 other bump:2.34312 Ang D15.CG and L43.CG other bump:2.41345 Ang D15.OD2 and L43.CG other bump:2.13139 Ang D15.OD1 and L43.CG other bump:1.94768 Ang D15.OD1 and K39.O other bump:0.500343 Ang L14.O and K39.NZ other bump:2.52873 Ang L14.CA and K39.NZ other bump:1.14865 Ang L14.C and K39.NZ other bump:2.20145 Ang D15.CA and K39.NZ other bump:2.34434 Ang D15.C and K39.NZ other bump:1.87788 Ang D15.N and K39.NZ other bump:2.89342 Ang D13.C and K39.CE other bump:2.22774 Ang L14.N and K39.CE other bump:1.51092 Ang L14.O and K39.CE other bump:1.18933 Ang L14.CA and K39.CE other bump:2.11486 Ang L14.CB and K39.CE other bump:0.373084 Ang L14.C and K39.CE other bump:2.63342 Ang D15.CA and K39.CE other bump:1.44807 Ang D15.N and K39.CE other bump:3.02821 Ang L14.CG and K39.CD other bump:2.51902 Ang L14.O and K39.CD other bump:1.94455 Ang L14.CA and K39.CD other bump:1.51814 Ang L14.CB and K39.CD other bump:1.75693 Ang L14.C and K39.CD other bump:3.0843 Ang D15.CA and K39.CD other bump:2.10043 Ang D15.N and K39.CD other bump:2.9058 Ang L14.CB and K39.CG other bump:2.58549 Ang L14.C and K39.CG other bump:2.49827 Ang D15.CA and K39.CG other bump:2.11939 Ang D15.N and K39.CG other bump:3.04697 Ang D15.CB and K39.CG other bump:1.67603 Ang I32.O and P36.CD other bump:2.89863 Ang I32.C and P36.CD other bump:3.08794 Ang D33.C and P36.CD other bump:2.47197 Ang I32.O and P36.CG self-bump: 1.39825 Ang D33.CA and D33.CB other bump:2.45711 Ang D13.O and V17.CG2 other bump:2.68119 Ang V5.CG2 and D13.OD2 other bump:2.80762 Ang G9.C and D13.OD1 other bump:2.0717 Ang G9.O and D13.OD1 T0191 117 :EDMVVMDLIYNPLETVLLKEAKKVNAKTINGLGMLIYQGAVAF 1gpjA 258 :SPILIIDIANPRDVEEGVENIEDVEVRTIDDLRVIARENLERR Fragment has 22 clashes (null) has 22 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 45 residues other bump:2.83524 Ang M7.SD and L33.CD1 other bump:2.96977 Ang K20.CG and A27.CB neighbor-bump: 2.17254 Ang V17.O and L18.CB neighbor-bump: 2.59256 Ang V17.C and L18.CB other bump:1.52281 Ang V6.CG2 and E15.OE2 other bump:2.68992 Ang V6.CB and E15.OE2 other bump:2.32514 Ang V6.CG2 and E15.CD other bump:2.77381 Ang I10.CG1 and L14.CD2 other bump:1.65862 Ang I10.CD1 and L14.CD2 other bump:2.57874 Ang I10.CG2 and L14.CD1 other bump:2.87153 Ang I10.CB and L14.CG other bump:2.00364 Ang I10.CG1 and L14.CG other bump:2.74877 Ang I10.CG2 and L14.CG other bump:1.505 Ang I10.CD1 and L14.CG other bump:2.79244 Ang I10.CG1 and L14.CB other bump:2.19287 Ang I10.CD1 and L14.CB other bump:3.09048 Ang I10.CG1 and L14.CA other bump:2.23387 Ang I10.CD1 and L14.CA other bump:2.55671 Ang I10.CG1 and L14.N other bump:2.30715 Ang I10.CD1 and L14.N other bump:2.96953 Ang I10.CD1 and P13.C other bump:2.76002 Ang M7.CE and L9.CD1 Number of specific fragments= 5 total=538 Number of alignments=97 # Reading fragments from alignment file # T0191 read from T0191-1gpjA-2track-protein-STR-global-adpstyle1.pw.a2m.gz # 1gpjA read from T0191-1gpjA-2track-protein-STR-global-adpstyle1.pw.a2m.gz # found chain 1gpjA in template set T0191 1 :I 1gpjA 1 :M Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 2 residues T0191 2 :GYNTDGIGARMALEEEIGRVKDKNIVIYGAGGAARAVAFELAK 1gpjA 146 :GAVSIGSAAVELAERELGSLHDKTVLVVGAGEMGKTVAKSLVD Fragment has 76 clashes (null) has 76 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 45 residues other bump:2.32562 Ang L14.CD1 and L42.CD2 other bump:2.26175 Ang R11.NH1 and E41.C other bump:2.70446 Ang R11.CD and E41.O other bump:2.20049 Ang R11.NH1 and E41.O other bump:1.16878 Ang A37.O and E41.OE1 other bump:2.12325 Ang A37.C and E41.OE1 other bump:2.71002 Ang V38.CA and E41.OE1 other bump:3.06491 Ang G7.CA and E41.CD other bump:2.03305 Ang A37.O and E41.CD other bump:2.97567 Ang A37.C and E41.CD other bump:3.08232 Ang G7.CA and E41.CG other bump:3.24563 Ang G7.C and E41.CG other bump:2.83406 Ang R11.CZ and E41.CB other bump:1.98869 Ang R11.NH1 and E41.CB other bump:1.91041 Ang R11.NH1 and E41.CA other bump:2.71694 Ang Y3.CB and M12.SD other bump:1.83398 Ang I8.CD1 and R11.NH2 other bump:2.88577 Ang Y3.CG and G9.CA other bump:2.27855 Ang Y3.CD2 and G9.CA other bump:2.62641 Ang Y3.CE2 and G9.CA other bump:2.49919 Ang Y3.CD1 and G9.N other bump:2.16413 Ang Y3.CG and G9.N other bump:1.652 Ang Y3.CD2 and G9.N other bump:1.55884 Ang Y3.CE2 and G9.N other bump:2.44228 Ang Y3.CE1 and G9.N other bump:2.00811 Ang Y3.CZ and G9.N other bump:1.75321 Ang Y3.CD1 and I8.C other bump:2.1123 Ang Y3.CG and I8.C other bump:2.42046 Ang Y3.CD2 and I8.C other bump:2.44556 Ang Y3.CE2 and I8.C other bump:3.29349 Ang Y3.CB and I8.C other bump:1.78431 Ang Y3.CE1 and I8.C other bump:2.14011 Ang Y3.CZ and I8.C other bump:2.31189 Ang Y3.CD1 and I8.O other bump:2.61852 Ang Y3.CG and I8.O other bump:3.14929 Ang Y3.CA and I8.CG2 other bump:1.35201 Ang Y3.CD1 and I8.CG2 other bump:2.30031 Ang Y3.CG and I8.CG2 other bump:2.78818 Ang Y3.CB and I8.CG2 other bump:2.34648 Ang Y3.CE1 and I8.CG2 other bump:2.74217 Ang Y3.CD1 and I8.CG1 other bump:2.23779 Ang Y3.CE1 and I8.CG1 other bump:1.23883 Ang Y3.CD1 and I8.CB other bump:2.40368 Ang Y3.CG and I8.CB other bump:3.10444 Ang Y3.CD2 and I8.CB other bump:3.069 Ang Y3.CE2 and I8.CB other bump:1.12483 Ang Y3.CE1 and I8.CB other bump:2.26274 Ang Y3.CZ and I8.CB other bump:1.62932 Ang Y3.CD1 and I8.CA other bump:2.71932 Ang Y3.CG and I8.CA other bump:3.12305 Ang Y3.CD2 and I8.CA other bump:2.75622 Ang Y3.CE2 and I8.CA other bump:2.512 Ang Y3.OH and I8.CA other bump:0.665591 Ang Y3.CE1 and I8.CA other bump:1.68541 Ang Y3.CZ and I8.CA other bump:2.83655 Ang Y3.CD1 and I8.N other bump:2.57477 Ang Y3.CE2 and I8.N other bump:1.15168 Ang Y3.OH and I8.N other bump:1.48594 Ang Y3.CE1 and I8.N other bump:1.20467 Ang Y3.CZ and I8.N other bump:3.2778 Ang Y3.CE2 and G7.C other bump:1.5461 Ang Y3.OH and G7.C other bump:2.68496 Ang Y3.CE1 and G7.C other bump:2.19595 Ang Y3.CZ and G7.C other bump:1.81848 Ang Y3.OH and G7.CA other bump:3.05225 Ang Y3.CZ and G7.CA other bump:1.8189 Ang Y3.OH and G7.N other bump:2.96188 Ang Y3.CZ and G7.N other bump:3.11491 Ang Y3.CE2 and D6.C other bump:2.54751 Ang Y3.OH and D6.C other bump:3.21493 Ang Y3.CZ and D6.C other bump:2.49392 Ang Y3.CE2 and T5.C other bump:3.13648 Ang Y3.CZ and T5.C other bump:2.21115 Ang Y3.CD2 and T5.O other bump:1.32678 Ang Y3.CE2 and T5.O other bump:2.27616 Ang Y3.CZ and T5.O T0191 45 :DN 1gpjA 190 :GV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues T0191 47 :NIIIANRTVEKAEALAKEIA 1gpjA 193 :AVLVANRTYERAVELARDLG Fragment has 19 clashes (null) has 19 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 22 residues other bump:3.28619 Ang I3.CG1 and G22.CA neighbor-bump: 2.2506 Ang I20.O and A21.CB neighbor-bump: 2.53375 Ang I20.C and A21.CB other bump:1.44539 Ang I3.CD1 and I20.CG2 other bump:2.89365 Ang I3.CG1 and I20.CG2 other bump:2.80691 Ang I3.CD1 and I20.CB other bump:2.49571 Ang I5.CD1 and A17.CB other bump:2.9766 Ang I5.CG1 and A17.CB other bump:2.28293 Ang I5.CD1 and A17.CA other bump:1.97413 Ang I5.CD1 and A17.N other bump:2.87382 Ang I5.CD1 and L16.C other bump:2.00721 Ang V10.CG1 and E14.OE2 other bump:2.40763 Ang E11.CA and E14.OE1 other bump:1.64561 Ang V10.O and E14.OE1 other bump:2.29284 Ang V10.C and E14.OE1 other bump:2.41272 Ang V10.O and E14.CD other bump:2.99826 Ang V10.CG1 and E14.CD other bump:3.1113 Ang V10.C and E14.CD other bump:2.66759 Ang I5.CD1 and A13.O T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLR 1gpjA 213 :GEAVRFDELVDHLARSDVVVSATAAPHPVIHVDDVREALRKRD Fragment has 44 clashes (null) has 44 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 45 residues other bump:2.86372 Ang D15.CG and L43.CD2 other bump:2.2607 Ang D15.OD2 and L43.CD2 other bump:2.76557 Ang D15.C and L43.CD1 other bump:1.73614 Ang D15.O and L43.CD1 other bump:2.79188 Ang D15.OD1 and L43.CD1 other bump:2.34312 Ang D15.CG and L43.CG other bump:2.41345 Ang D15.OD2 and L43.CG other bump:2.13139 Ang D15.OD1 and L43.CG other bump:1.94768 Ang D15.OD1 and K39.O other bump:0.500343 Ang L14.O and K39.NZ other bump:2.52873 Ang L14.CA and K39.NZ other bump:1.14865 Ang L14.C and K39.NZ other bump:2.20145 Ang D15.CA and K39.NZ other bump:2.34434 Ang D15.C and K39.NZ other bump:1.87788 Ang D15.N and K39.NZ other bump:2.89342 Ang D13.C and K39.CE other bump:2.22774 Ang L14.N and K39.CE other bump:1.51092 Ang L14.O and K39.CE other bump:1.18933 Ang L14.CA and K39.CE other bump:2.11486 Ang L14.CB and K39.CE other bump:0.373084 Ang L14.C and K39.CE other bump:2.63342 Ang D15.CA and K39.CE other bump:1.44807 Ang D15.N and K39.CE other bump:3.02821 Ang L14.CG and K39.CD other bump:2.51902 Ang L14.O and K39.CD other bump:1.94455 Ang L14.CA and K39.CD other bump:1.51814 Ang L14.CB and K39.CD other bump:1.75693 Ang L14.C and K39.CD other bump:3.0843 Ang D15.CA and K39.CD other bump:2.10043 Ang D15.N and K39.CD other bump:2.9058 Ang L14.CB and K39.CG other bump:2.58549 Ang L14.C and K39.CG other bump:2.49827 Ang D15.CA and K39.CG other bump:2.11939 Ang D15.N and K39.CG other bump:3.04697 Ang D15.CB and K39.CG other bump:1.67603 Ang I32.O and P36.CD other bump:2.89863 Ang I32.C and P36.CD other bump:3.08794 Ang D33.C and P36.CD other bump:2.47197 Ang I32.O and P36.CG self-bump: 1.39825 Ang D33.CA and D33.CB other bump:2.45711 Ang D13.O and V17.CG2 other bump:2.68119 Ang V5.CG2 and D13.OD2 other bump:2.80762 Ang G9.C and D13.OD1 other bump:2.0717 Ang G9.O and D13.OD1 T0191 117 :EDMVVMDLIYNPLETVLLKEAKKVNAKTINGLGMLIYQGAVAFK 1gpjA 258 :SPILIIDIANPRDVEEGVENIEDVEVRTIDDLRVIARENLERRR Fragment has 22 clashes (null) has 22 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 45 residues other bump:2.83524 Ang M7.SD and L33.CD1 other bump:2.96977 Ang K20.CG and A27.CB neighbor-bump: 2.17254 Ang V17.O and L18.CB neighbor-bump: 2.59256 Ang V17.C and L18.CB other bump:1.52281 Ang V6.CG2 and E15.OE2 other bump:2.68992 Ang V6.CB and E15.OE2 other bump:2.32514 Ang V6.CG2 and E15.CD other bump:2.77381 Ang I10.CG1 and L14.CD2 other bump:1.65862 Ang I10.CD1 and L14.CD2 other bump:2.57874 Ang I10.CG2 and L14.CD1 other bump:2.87153 Ang I10.CB and L14.CG other bump:2.00364 Ang I10.CG1 and L14.CG other bump:2.74877 Ang I10.CG2 and L14.CG other bump:1.505 Ang I10.CD1 and L14.CG other bump:2.79244 Ang I10.CG1 and L14.CB other bump:2.19287 Ang I10.CD1 and L14.CB other bump:3.09048 Ang I10.CG1 and L14.CA other bump:2.23387 Ang I10.CD1 and L14.CA other bump:2.55671 Ang I10.CG1 and L14.N other bump:2.30715 Ang I10.CD1 and L14.N other bump:2.96953 Ang I10.CD1 and P13.C other bump:2.76002 Ang M7.CE and L9.CD1 Number of specific fragments= 6 total=544 Number of alignments=98 # Reading fragments from alignment file # T0191 read from T0191-1gpjA-2track-protein-STR-global-adpstyle5.pw.a2m.gz # 1gpjA read from T0191-1gpjA-2track-protein-STR-global-adpstyle5.pw.a2m.gz # found chain 1gpjA in template set T0191 1 :I 1gpjA 1 :M Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 2 residues T0191 2 :GYNTDGIGARMALEEEIGRVKDKNIVIYGAGGAARAVAFELAK 1gpjA 146 :GAVSIGSAAVELAERELGSLHDKTVLVVGAGEMGKTVAKSLVD Fragment has 76 clashes (null) has 76 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 45 residues other bump:2.32562 Ang L14.CD1 and L42.CD2 other bump:2.26175 Ang R11.NH1 and E41.C other bump:2.70446 Ang R11.CD and E41.O other bump:2.20049 Ang R11.NH1 and E41.O other bump:1.16878 Ang A37.O and E41.OE1 other bump:2.12325 Ang A37.C and E41.OE1 other bump:2.71002 Ang V38.CA and E41.OE1 other bump:3.06491 Ang G7.CA and E41.CD other bump:2.03305 Ang A37.O and E41.CD other bump:2.97567 Ang A37.C and E41.CD other bump:3.08232 Ang G7.CA and E41.CG other bump:3.24563 Ang G7.C and E41.CG other bump:2.83406 Ang R11.CZ and E41.CB other bump:1.98869 Ang R11.NH1 and E41.CB other bump:1.91041 Ang R11.NH1 and E41.CA other bump:2.71694 Ang Y3.CB and M12.SD other bump:1.83398 Ang I8.CD1 and R11.NH2 other bump:2.88577 Ang Y3.CG and G9.CA other bump:2.27855 Ang Y3.CD2 and G9.CA other bump:2.62641 Ang Y3.CE2 and G9.CA other bump:2.49919 Ang Y3.CD1 and G9.N other bump:2.16413 Ang Y3.CG and G9.N other bump:1.652 Ang Y3.CD2 and G9.N other bump:1.55884 Ang Y3.CE2 and G9.N other bump:2.44228 Ang Y3.CE1 and G9.N other bump:2.00811 Ang Y3.CZ and G9.N other bump:1.75321 Ang Y3.CD1 and I8.C other bump:2.1123 Ang Y3.CG and I8.C other bump:2.42046 Ang Y3.CD2 and I8.C other bump:2.44556 Ang Y3.CE2 and I8.C other bump:3.29349 Ang Y3.CB and I8.C other bump:1.78431 Ang Y3.CE1 and I8.C other bump:2.14011 Ang Y3.CZ and I8.C other bump:2.31189 Ang Y3.CD1 and I8.O other bump:2.61852 Ang Y3.CG and I8.O other bump:3.14929 Ang Y3.CA and I8.CG2 other bump:1.35201 Ang Y3.CD1 and I8.CG2 other bump:2.30031 Ang Y3.CG and I8.CG2 other bump:2.78818 Ang Y3.CB and I8.CG2 other bump:2.34648 Ang Y3.CE1 and I8.CG2 other bump:2.74217 Ang Y3.CD1 and I8.CG1 other bump:2.23779 Ang Y3.CE1 and I8.CG1 other bump:1.23883 Ang Y3.CD1 and I8.CB other bump:2.40368 Ang Y3.CG and I8.CB other bump:3.10444 Ang Y3.CD2 and I8.CB other bump:3.069 Ang Y3.CE2 and I8.CB other bump:1.12483 Ang Y3.CE1 and I8.CB other bump:2.26274 Ang Y3.CZ and I8.CB other bump:1.62932 Ang Y3.CD1 and I8.CA other bump:2.71932 Ang Y3.CG and I8.CA other bump:3.12305 Ang Y3.CD2 and I8.CA other bump:2.75622 Ang Y3.CE2 and I8.CA other bump:2.512 Ang Y3.OH and I8.CA other bump:0.665591 Ang Y3.CE1 and I8.CA other bump:1.68541 Ang Y3.CZ and I8.CA other bump:2.83655 Ang Y3.CD1 and I8.N other bump:2.57477 Ang Y3.CE2 and I8.N other bump:1.15168 Ang Y3.OH and I8.N other bump:1.48594 Ang Y3.CE1 and I8.N other bump:1.20467 Ang Y3.CZ and I8.N other bump:3.2778 Ang Y3.CE2 and G7.C other bump:1.5461 Ang Y3.OH and G7.C other bump:2.68496 Ang Y3.CE1 and G7.C other bump:2.19595 Ang Y3.CZ and G7.C other bump:1.81848 Ang Y3.OH and G7.CA other bump:3.05225 Ang Y3.CZ and G7.CA other bump:1.8189 Ang Y3.OH and G7.N other bump:2.96188 Ang Y3.CZ and G7.N other bump:3.11491 Ang Y3.CE2 and D6.C other bump:2.54751 Ang Y3.OH and D6.C other bump:3.21493 Ang Y3.CZ and D6.C other bump:2.49392 Ang Y3.CE2 and T5.C other bump:3.13648 Ang Y3.CZ and T5.C other bump:2.21115 Ang Y3.CD2 and T5.O other bump:1.32678 Ang Y3.CE2 and T5.O other bump:2.27616 Ang Y3.CZ and T5.O T0191 45 :DN 1gpjA 190 :GV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues T0191 47 :NIIIANRTVEKAEALAKEIA 1gpjA 193 :AVLVANRTYERAVELARDLG Fragment has 19 clashes (null) has 19 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 22 residues other bump:3.28619 Ang I3.CG1 and G22.CA neighbor-bump: 2.2506 Ang I20.O and A21.CB neighbor-bump: 2.53375 Ang I20.C and A21.CB other bump:1.44539 Ang I3.CD1 and I20.CG2 other bump:2.89365 Ang I3.CG1 and I20.CG2 other bump:2.80691 Ang I3.CD1 and I20.CB other bump:2.49571 Ang I5.CD1 and A17.CB other bump:2.9766 Ang I5.CG1 and A17.CB other bump:2.28293 Ang I5.CD1 and A17.CA other bump:1.97413 Ang I5.CD1 and A17.N other bump:2.87382 Ang I5.CD1 and L16.C other bump:2.00721 Ang V10.CG1 and E14.OE2 other bump:2.40763 Ang E11.CA and E14.OE1 other bump:1.64561 Ang V10.O and E14.OE1 other bump:2.29284 Ang V10.C and E14.OE1 other bump:2.41272 Ang V10.O and E14.CD other bump:2.99826 Ang V10.CG1 and E14.CD other bump:3.1113 Ang V10.C and E14.CD other bump:2.66759 Ang I5.CD1 and A13.O T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLR 1gpjA 213 :GEAVRFDELVDHLARSDVVVSATAAPHPVIHVDDVREALRKRD Fragment has 44 clashes (null) has 44 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 45 residues other bump:2.86372 Ang D15.CG and L43.CD2 other bump:2.2607 Ang D15.OD2 and L43.CD2 other bump:2.76557 Ang D15.C and L43.CD1 other bump:1.73614 Ang D15.O and L43.CD1 other bump:2.79188 Ang D15.OD1 and L43.CD1 other bump:2.34312 Ang D15.CG and L43.CG other bump:2.41345 Ang D15.OD2 and L43.CG other bump:2.13139 Ang D15.OD1 and L43.CG other bump:1.94768 Ang D15.OD1 and K39.O other bump:0.500343 Ang L14.O and K39.NZ other bump:2.52873 Ang L14.CA and K39.NZ other bump:1.14865 Ang L14.C and K39.NZ other bump:2.20145 Ang D15.CA and K39.NZ other bump:2.34434 Ang D15.C and K39.NZ other bump:1.87788 Ang D15.N and K39.NZ other bump:2.89342 Ang D13.C and K39.CE other bump:2.22774 Ang L14.N and K39.CE other bump:1.51092 Ang L14.O and K39.CE other bump:1.18933 Ang L14.CA and K39.CE other bump:2.11486 Ang L14.CB and K39.CE other bump:0.373084 Ang L14.C and K39.CE other bump:2.63342 Ang D15.CA and K39.CE other bump:1.44807 Ang D15.N and K39.CE other bump:3.02821 Ang L14.CG and K39.CD other bump:2.51902 Ang L14.O and K39.CD other bump:1.94455 Ang L14.CA and K39.CD other bump:1.51814 Ang L14.CB and K39.CD other bump:1.75693 Ang L14.C and K39.CD other bump:3.0843 Ang D15.CA and K39.CD other bump:2.10043 Ang D15.N and K39.CD other bump:2.9058 Ang L14.CB and K39.CG other bump:2.58549 Ang L14.C and K39.CG other bump:2.49827 Ang D15.CA and K39.CG other bump:2.11939 Ang D15.N and K39.CG other bump:3.04697 Ang D15.CB and K39.CG other bump:1.67603 Ang I32.O and P36.CD other bump:2.89863 Ang I32.C and P36.CD other bump:3.08794 Ang D33.C and P36.CD other bump:2.47197 Ang I32.O and P36.CG self-bump: 1.39825 Ang D33.CA and D33.CB other bump:2.45711 Ang D13.O and V17.CG2 other bump:2.68119 Ang V5.CG2 and D13.OD2 other bump:2.80762 Ang G9.C and D13.OD1 other bump:2.0717 Ang G9.O and D13.OD1 T0191 117 :EDMVVMDLIYNPLETVLLKEAKKVNAKTINGLGMLIYQGAVAFK 1gpjA 258 :SPILIIDIANPRDVEEGVENIEDVEVRTIDDLRVIARENLERRR Fragment has 22 clashes (null) has 22 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 45 residues other bump:2.83524 Ang M7.SD and L33.CD1 other bump:2.96977 Ang K20.CG and A27.CB neighbor-bump: 2.17254 Ang V17.O and L18.CB neighbor-bump: 2.59256 Ang V17.C and L18.CB other bump:1.52281 Ang V6.CG2 and E15.OE2 other bump:2.68992 Ang V6.CB and E15.OE2 other bump:2.32514 Ang V6.CG2 and E15.CD other bump:2.77381 Ang I10.CG1 and L14.CD2 other bump:1.65862 Ang I10.CD1 and L14.CD2 other bump:2.57874 Ang I10.CG2 and L14.CD1 other bump:2.87153 Ang I10.CB and L14.CG other bump:2.00364 Ang I10.CG1 and L14.CG other bump:2.74877 Ang I10.CG2 and L14.CG other bump:1.505 Ang I10.CD1 and L14.CG other bump:2.79244 Ang I10.CG1 and L14.CB other bump:2.19287 Ang I10.CD1 and L14.CB other bump:3.09048 Ang I10.CG1 and L14.CA other bump:2.23387 Ang I10.CD1 and L14.CA other bump:2.55671 Ang I10.CG1 and L14.N other bump:2.30715 Ang I10.CD1 and L14.N other bump:2.96953 Ang I10.CD1 and P13.C other bump:2.76002 Ang M7.CE and L9.CD1 Number of specific fragments= 6 total=550 Number of alignments=99 # Reading fragments from alignment file # T0191 read from T0191-1gpjA-2track-protein-STR-local-adpstyle1.pw.a2m.gz # 1gpjA read from T0191-1gpjA-2track-protein-STR-local-adpstyle1.pw.a2m.gz # found chain 1gpjA in template set T0191 1 :IGYNTDGIGARMALEEEIGRVKDKNIVIYGAGGAARAVAFELAK 1gpjA 145 :EGAVSIGSAAVELAERELGSLHDKTVLVVGAGEMGKTVAKSLVD Fragment has 76 clashes (null) has 76 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 45 residues other bump:2.32562 Ang L14.CD1 and L42.CD2 other bump:2.26175 Ang R11.NH1 and E41.C other bump:2.70446 Ang R11.CD and E41.O other bump:2.20049 Ang R11.NH1 and E41.O other bump:1.16878 Ang A37.O and E41.OE1 other bump:2.12325 Ang A37.C and E41.OE1 other bump:2.71002 Ang V38.CA and E41.OE1 other bump:3.06491 Ang G7.CA and E41.CD other bump:2.03305 Ang A37.O and E41.CD other bump:2.97567 Ang A37.C and E41.CD other bump:3.08232 Ang G7.CA and E41.CG other bump:3.24563 Ang G7.C and E41.CG other bump:2.83406 Ang R11.CZ and E41.CB other bump:1.98869 Ang R11.NH1 and E41.CB other bump:1.91041 Ang R11.NH1 and E41.CA other bump:2.71694 Ang Y3.CB and M12.SD other bump:1.83398 Ang I8.CD1 and R11.NH2 other bump:2.88577 Ang Y3.CG and G9.CA other bump:2.27855 Ang Y3.CD2 and G9.CA other bump:2.62641 Ang Y3.CE2 and G9.CA other bump:2.16413 Ang Y3.CG and G9.N other bump:1.652 Ang Y3.CD2 and G9.N other bump:2.49919 Ang Y3.CD1 and G9.N other bump:2.44228 Ang Y3.CE1 and G9.N other bump:1.55884 Ang Y3.CE2 and G9.N other bump:2.00811 Ang Y3.CZ and G9.N other bump:2.1123 Ang Y3.CG and I8.C other bump:2.42046 Ang Y3.CD2 and I8.C other bump:3.29349 Ang Y3.CB and I8.C other bump:1.75321 Ang Y3.CD1 and I8.C other bump:1.78431 Ang Y3.CE1 and I8.C other bump:2.44556 Ang Y3.CE2 and I8.C other bump:2.14011 Ang Y3.CZ and I8.C other bump:2.61852 Ang Y3.CG and I8.O other bump:2.31189 Ang Y3.CD1 and I8.O other bump:3.14929 Ang Y3.CA and I8.CG2 other bump:2.30031 Ang Y3.CG and I8.CG2 other bump:2.78818 Ang Y3.CB and I8.CG2 other bump:1.35201 Ang Y3.CD1 and I8.CG2 other bump:2.34648 Ang Y3.CE1 and I8.CG2 other bump:2.74217 Ang Y3.CD1 and I8.CG1 other bump:2.23779 Ang Y3.CE1 and I8.CG1 other bump:2.40368 Ang Y3.CG and I8.CB other bump:3.10444 Ang Y3.CD2 and I8.CB other bump:1.23883 Ang Y3.CD1 and I8.CB other bump:1.12483 Ang Y3.CE1 and I8.CB other bump:3.069 Ang Y3.CE2 and I8.CB other bump:2.26274 Ang Y3.CZ and I8.CB other bump:2.71932 Ang Y3.CG and I8.CA other bump:3.12305 Ang Y3.CD2 and I8.CA other bump:2.512 Ang Y3.OH and I8.CA other bump:1.62932 Ang Y3.CD1 and I8.CA other bump:0.665591 Ang Y3.CE1 and I8.CA other bump:2.75622 Ang Y3.CE2 and I8.CA other bump:1.68541 Ang Y3.CZ and I8.CA other bump:1.15168 Ang Y3.OH and I8.N other bump:2.83655 Ang Y3.CD1 and I8.N other bump:1.48594 Ang Y3.CE1 and I8.N other bump:2.57477 Ang Y3.CE2 and I8.N other bump:1.20467 Ang Y3.CZ and I8.N other bump:1.5461 Ang Y3.OH and G7.C other bump:2.68496 Ang Y3.CE1 and G7.C other bump:3.2778 Ang Y3.CE2 and G7.C other bump:2.19595 Ang Y3.CZ and G7.C other bump:1.81848 Ang Y3.OH and G7.CA other bump:3.05225 Ang Y3.CZ and G7.CA other bump:1.8189 Ang Y3.OH and G7.N other bump:2.96188 Ang Y3.CZ and G7.N other bump:2.54751 Ang Y3.OH and D6.C other bump:3.11491 Ang Y3.CE2 and D6.C other bump:3.21493 Ang Y3.CZ and D6.C other bump:2.49392 Ang Y3.CE2 and T5.C other bump:3.13648 Ang Y3.CZ and T5.C other bump:2.21115 Ang Y3.CD2 and T5.O other bump:1.32678 Ang Y3.CE2 and T5.O other bump:2.27616 Ang Y3.CZ and T5.O T0191 45 :DN 1gpjA 190 :GV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues T0191 47 :NIIIANRTVEKAEALAKEIA 1gpjA 193 :AVLVANRTYERAVELARDLG Fragment has 19 clashes (null) has 19 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 22 residues other bump:3.28619 Ang I3.CG1 and G22.CA neighbor-bump: 2.2506 Ang I20.O and A21.CB neighbor-bump: 2.53375 Ang I20.C and A21.CB other bump:1.44539 Ang I3.CD1 and I20.CG2 other bump:2.89365 Ang I3.CG1 and I20.CG2 other bump:2.80691 Ang I3.CD1 and I20.CB other bump:2.49571 Ang I5.CD1 and A17.CB other bump:2.9766 Ang I5.CG1 and A17.CB other bump:2.28293 Ang I5.CD1 and A17.CA other bump:1.97413 Ang I5.CD1 and A17.N other bump:2.87382 Ang I5.CD1 and L16.C other bump:2.00721 Ang V10.CG1 and E14.OE2 other bump:2.40763 Ang E11.CA and E14.OE1 other bump:1.64561 Ang V10.O and E14.OE1 other bump:2.29284 Ang V10.C and E14.OE1 other bump:2.41272 Ang V10.O and E14.CD other bump:2.99826 Ang V10.CG1 and E14.CD other bump:3.1113 Ang V10.C and E14.CD other bump:2.66759 Ang I5.CD1 and A13.O T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLR 1gpjA 213 :GEAVRFDELVDHLARSDVVVSATAAPHPVIHVDDVREALRKRD Fragment has 44 clashes (null) has 44 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 45 residues other bump:2.86372 Ang D15.CG and L43.CD2 other bump:2.2607 Ang D15.OD2 and L43.CD2 other bump:2.76557 Ang D15.C and L43.CD1 other bump:1.73614 Ang D15.O and L43.CD1 other bump:2.79188 Ang D15.OD1 and L43.CD1 other bump:2.34312 Ang D15.CG and L43.CG other bump:2.41345 Ang D15.OD2 and L43.CG other bump:2.13139 Ang D15.OD1 and L43.CG other bump:1.94768 Ang D15.OD1 and K39.O other bump:0.500343 Ang L14.O and K39.NZ other bump:2.52873 Ang L14.CA and K39.NZ other bump:1.14865 Ang L14.C and K39.NZ other bump:2.20145 Ang D15.CA and K39.NZ other bump:2.34434 Ang D15.C and K39.NZ other bump:1.87788 Ang D15.N and K39.NZ other bump:2.89342 Ang D13.C and K39.CE other bump:2.22774 Ang L14.N and K39.CE other bump:1.51092 Ang L14.O and K39.CE other bump:1.18933 Ang L14.CA and K39.CE other bump:2.11486 Ang L14.CB and K39.CE other bump:0.373084 Ang L14.C and K39.CE other bump:2.63342 Ang D15.CA and K39.CE other bump:1.44807 Ang D15.N and K39.CE other bump:3.02821 Ang L14.CG and K39.CD other bump:2.51902 Ang L14.O and K39.CD other bump:1.94455 Ang L14.CA and K39.CD other bump:1.51814 Ang L14.CB and K39.CD other bump:1.75693 Ang L14.C and K39.CD other bump:3.0843 Ang D15.CA and K39.CD other bump:2.10043 Ang D15.N and K39.CD other bump:2.9058 Ang L14.CB and K39.CG other bump:2.58549 Ang L14.C and K39.CG other bump:2.49827 Ang D15.CA and K39.CG other bump:2.11939 Ang D15.N and K39.CG other bump:3.04697 Ang D15.CB and K39.CG other bump:1.67603 Ang I32.O and P36.CD other bump:2.89863 Ang I32.C and P36.CD other bump:3.08794 Ang D33.C and P36.CD other bump:2.47197 Ang I32.O and P36.CG self-bump: 1.39825 Ang D33.CA and D33.CB other bump:2.45711 Ang D13.O and V17.CG2 other bump:2.68119 Ang V5.CG2 and D13.OD2 other bump:2.80762 Ang G9.C and D13.OD1 other bump:2.0717 Ang G9.O and D13.OD1 T0191 117 :EDMVVMDLIYNPLETVLLKEAKKVNAKTINGLGMLIYQGAVAF 1gpjA 258 :SPILIIDIANPRDVEEGVENIEDVEVRTIDDLRVIARENLERR Fragment has 22 clashes (null) has 22 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 45 residues other bump:2.83524 Ang M7.SD and L33.CD1 other bump:2.96977 Ang K20.CG and A27.CB neighbor-bump: 2.17254 Ang V17.O and L18.CB neighbor-bump: 2.59256 Ang V17.C and L18.CB other bump:1.52281 Ang V6.CG2 and E15.OE2 other bump:2.68992 Ang V6.CB and E15.OE2 other bump:2.32514 Ang V6.CG2 and E15.CD other bump:2.77381 Ang I10.CG1 and L14.CD2 other bump:1.65862 Ang I10.CD1 and L14.CD2 other bump:2.57874 Ang I10.CG2 and L14.CD1 other bump:2.87153 Ang I10.CB and L14.CG other bump:2.00364 Ang I10.CG1 and L14.CG other bump:2.74877 Ang I10.CG2 and L14.CG other bump:1.505 Ang I10.CD1 and L14.CG other bump:2.79244 Ang I10.CG1 and L14.CB other bump:2.19287 Ang I10.CD1 and L14.CB other bump:3.09048 Ang I10.CG1 and L14.CA other bump:2.23387 Ang I10.CD1 and L14.CA other bump:2.55671 Ang I10.CG1 and L14.N other bump:2.30715 Ang I10.CD1 and L14.N other bump:2.96953 Ang I10.CD1 and P13.C other bump:2.76002 Ang M7.CE and L9.CD1 Number of specific fragments= 5 total=555 Number of alignments=100 # Reading fragments from alignment file # T0191 read from T0191-1gpjA-2track-protein-STR-local-adpstyle5.pw.a2m.gz # 1gpjA read from T0191-1gpjA-2track-protein-STR-local-adpstyle5.pw.a2m.gz # found chain 1gpjA in template set T0191 1 :IGYNTDGIGARMALEEEIGRVKDKNIVIYGAGGAARAVAFELAK 1gpjA 145 :EGAVSIGSAAVELAERELGSLHDKTVLVVGAGEMGKTVAKSLVD Fragment has 76 clashes (null) has 76 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 45 residues other bump:2.32562 Ang L14.CD1 and L42.CD2 other bump:2.26175 Ang R11.NH1 and E41.C other bump:2.70446 Ang R11.CD and E41.O other bump:2.20049 Ang R11.NH1 and E41.O other bump:1.16878 Ang A37.O and E41.OE1 other bump:2.12325 Ang A37.C and E41.OE1 other bump:2.71002 Ang V38.CA and E41.OE1 other bump:3.06491 Ang G7.CA and E41.CD other bump:2.03305 Ang A37.O and E41.CD other bump:2.97567 Ang A37.C and E41.CD other bump:3.08232 Ang G7.CA and E41.CG other bump:3.24563 Ang G7.C and E41.CG other bump:2.83406 Ang R11.CZ and E41.CB other bump:1.98869 Ang R11.NH1 and E41.CB other bump:1.91041 Ang R11.NH1 and E41.CA other bump:2.71694 Ang Y3.CB and M12.SD other bump:1.83398 Ang I8.CD1 and R11.NH2 other bump:2.88577 Ang Y3.CG and G9.CA other bump:2.27855 Ang Y3.CD2 and G9.CA other bump:2.62641 Ang Y3.CE2 and G9.CA other bump:2.16413 Ang Y3.CG and G9.N other bump:1.652 Ang Y3.CD2 and G9.N other bump:2.49919 Ang Y3.CD1 and G9.N other bump:2.44228 Ang Y3.CE1 and G9.N other bump:1.55884 Ang Y3.CE2 and G9.N other bump:2.00811 Ang Y3.CZ and G9.N other bump:2.1123 Ang Y3.CG and I8.C other bump:2.42046 Ang Y3.CD2 and I8.C other bump:3.29349 Ang Y3.CB and I8.C other bump:1.75321 Ang Y3.CD1 and I8.C other bump:1.78431 Ang Y3.CE1 and I8.C other bump:2.44556 Ang Y3.CE2 and I8.C other bump:2.14011 Ang Y3.CZ and I8.C other bump:2.61852 Ang Y3.CG and I8.O other bump:2.31189 Ang Y3.CD1 and I8.O other bump:3.14929 Ang Y3.CA and I8.CG2 other bump:2.30031 Ang Y3.CG and I8.CG2 other bump:2.78818 Ang Y3.CB and I8.CG2 other bump:1.35201 Ang Y3.CD1 and I8.CG2 other bump:2.34648 Ang Y3.CE1 and I8.CG2 other bump:2.74217 Ang Y3.CD1 and I8.CG1 other bump:2.23779 Ang Y3.CE1 and I8.CG1 other bump:2.40368 Ang Y3.CG and I8.CB other bump:3.10444 Ang Y3.CD2 and I8.CB other bump:1.23883 Ang Y3.CD1 and I8.CB other bump:1.12483 Ang Y3.CE1 and I8.CB other bump:3.069 Ang Y3.CE2 and I8.CB other bump:2.26274 Ang Y3.CZ and I8.CB other bump:2.71932 Ang Y3.CG and I8.CA other bump:3.12305 Ang Y3.CD2 and I8.CA other bump:2.512 Ang Y3.OH and I8.CA other bump:1.62932 Ang Y3.CD1 and I8.CA other bump:0.665591 Ang Y3.CE1 and I8.CA other bump:2.75622 Ang Y3.CE2 and I8.CA other bump:1.68541 Ang Y3.CZ and I8.CA other bump:1.15168 Ang Y3.OH and I8.N other bump:2.83655 Ang Y3.CD1 and I8.N other bump:1.48594 Ang Y3.CE1 and I8.N other bump:2.57477 Ang Y3.CE2 and I8.N other bump:1.20467 Ang Y3.CZ and I8.N other bump:1.5461 Ang Y3.OH and G7.C other bump:2.68496 Ang Y3.CE1 and G7.C other bump:3.2778 Ang Y3.CE2 and G7.C other bump:2.19595 Ang Y3.CZ and G7.C other bump:1.81848 Ang Y3.OH and G7.CA other bump:3.05225 Ang Y3.CZ and G7.CA other bump:1.8189 Ang Y3.OH and G7.N other bump:2.96188 Ang Y3.CZ and G7.N other bump:2.54751 Ang Y3.OH and D6.C other bump:3.11491 Ang Y3.CE2 and D6.C other bump:3.21493 Ang Y3.CZ and D6.C other bump:2.49392 Ang Y3.CE2 and T5.C other bump:3.13648 Ang Y3.CZ and T5.C other bump:2.21115 Ang Y3.CD2 and T5.O other bump:1.32678 Ang Y3.CE2 and T5.O other bump:2.27616 Ang Y3.CZ and T5.O T0191 45 :DN 1gpjA 190 :GV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues T0191 47 :NIIIANRTVEKAEALAKEIA 1gpjA 193 :AVLVANRTYERAVELARDLG Fragment has 19 clashes (null) has 19 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 22 residues other bump:3.28619 Ang I3.CG1 and G22.CA neighbor-bump: 2.2506 Ang I20.O and A21.CB neighbor-bump: 2.53375 Ang I20.C and A21.CB other bump:1.44539 Ang I3.CD1 and I20.CG2 other bump:2.89365 Ang I3.CG1 and I20.CG2 other bump:2.80691 Ang I3.CD1 and I20.CB other bump:2.49571 Ang I5.CD1 and A17.CB other bump:2.9766 Ang I5.CG1 and A17.CB other bump:2.28293 Ang I5.CD1 and A17.CA other bump:1.97413 Ang I5.CD1 and A17.N other bump:2.87382 Ang I5.CD1 and L16.C other bump:2.00721 Ang V10.CG1 and E14.OE2 other bump:2.40763 Ang E11.CA and E14.OE1 other bump:1.64561 Ang V10.O and E14.OE1 other bump:2.29284 Ang V10.C and E14.OE1 other bump:2.41272 Ang V10.O and E14.CD other bump:2.99826 Ang V10.CG1 and E14.CD other bump:3.1113 Ang V10.C and E14.CD other bump:2.66759 Ang I5.CD1 and A13.O T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLR 1gpjA 213 :GEAVRFDELVDHLARSDVVVSATAAPHPVIHVDDVREALRKRD Fragment has 44 clashes (null) has 44 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 45 residues other bump:2.86372 Ang D15.CG and L43.CD2 other bump:2.2607 Ang D15.OD2 and L43.CD2 other bump:2.76557 Ang D15.C and L43.CD1 other bump:1.73614 Ang D15.O and L43.CD1 other bump:2.79188 Ang D15.OD1 and L43.CD1 other bump:2.34312 Ang D15.CG and L43.CG other bump:2.41345 Ang D15.OD2 and L43.CG other bump:2.13139 Ang D15.OD1 and L43.CG other bump:1.94768 Ang D15.OD1 and K39.O other bump:0.500343 Ang L14.O and K39.NZ other bump:2.52873 Ang L14.CA and K39.NZ other bump:1.14865 Ang L14.C and K39.NZ other bump:2.20145 Ang D15.CA and K39.NZ other bump:2.34434 Ang D15.C and K39.NZ other bump:1.87788 Ang D15.N and K39.NZ other bump:2.89342 Ang D13.C and K39.CE other bump:2.22774 Ang L14.N and K39.CE other bump:1.51092 Ang L14.O and K39.CE other bump:1.18933 Ang L14.CA and K39.CE other bump:2.11486 Ang L14.CB and K39.CE other bump:0.373084 Ang L14.C and K39.CE other bump:2.63342 Ang D15.CA and K39.CE other bump:1.44807 Ang D15.N and K39.CE other bump:3.02821 Ang L14.CG and K39.CD other bump:2.51902 Ang L14.O and K39.CD other bump:1.94455 Ang L14.CA and K39.CD other bump:1.51814 Ang L14.CB and K39.CD other bump:1.75693 Ang L14.C and K39.CD other bump:3.0843 Ang D15.CA and K39.CD other bump:2.10043 Ang D15.N and K39.CD other bump:2.9058 Ang L14.CB and K39.CG other bump:2.58549 Ang L14.C and K39.CG other bump:2.49827 Ang D15.CA and K39.CG other bump:2.11939 Ang D15.N and K39.CG other bump:3.04697 Ang D15.CB and K39.CG other bump:1.67603 Ang I32.O and P36.CD other bump:2.89863 Ang I32.C and P36.CD other bump:3.08794 Ang D33.C and P36.CD other bump:2.47197 Ang I32.O and P36.CG self-bump: 1.39825 Ang D33.CA and D33.CB other bump:2.45711 Ang D13.O and V17.CG2 other bump:2.68119 Ang V5.CG2 and D13.OD2 other bump:2.80762 Ang G9.C and D13.OD1 other bump:2.0717 Ang G9.O and D13.OD1 T0191 117 :EDMVVMDLIYNPLETVLLKEAKKVNAKTINGLGMLIYQGAVAF 1gpjA 258 :SPILIIDIANPRDVEEGVENIEDVEVRTIDDLRVIARENLERR Fragment has 22 clashes (null) has 22 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 45 residues other bump:2.83524 Ang M7.SD and L33.CD1 other bump:2.96977 Ang K20.CG and A27.CB neighbor-bump: 2.17254 Ang V17.O and L18.CB neighbor-bump: 2.59256 Ang V17.C and L18.CB other bump:1.52281 Ang V6.CG2 and E15.OE2 other bump:2.68992 Ang V6.CB and E15.OE2 other bump:2.32514 Ang V6.CG2 and E15.CD other bump:2.77381 Ang I10.CG1 and L14.CD2 other bump:1.65862 Ang I10.CD1 and L14.CD2 other bump:2.57874 Ang I10.CG2 and L14.CD1 other bump:2.87153 Ang I10.CB and L14.CG other bump:2.00364 Ang I10.CG1 and L14.CG other bump:2.74877 Ang I10.CG2 and L14.CG other bump:1.505 Ang I10.CD1 and L14.CG other bump:2.79244 Ang I10.CG1 and L14.CB other bump:2.19287 Ang I10.CD1 and L14.CB other bump:3.09048 Ang I10.CG1 and L14.CA other bump:2.23387 Ang I10.CD1 and L14.CA other bump:2.55671 Ang I10.CG1 and L14.N other bump:2.30715 Ang I10.CD1 and L14.N other bump:2.96953 Ang I10.CD1 and P13.C other bump:2.76002 Ang M7.CE and L9.CD1 Number of specific fragments= 5 total=560 Number of alignments=101 # Reading fragments from alignment file # T0191 read from T0191-1gpjA-local-adpstyle1.pw.a2m.gz # 1gpjA read from T0191-1gpjA-local-adpstyle1.pw.a2m.gz # found chain 1gpjA in template set T0191 2 :GYNTDGIGARMALEEEIGRVKDKNIVIYGAGGAARAVAFELAK 1gpjA 146 :GAVSIGSAAVELAERELGSLHDKTVLVVGAGEMGKTVAKSLVD Fragment has 76 clashes (null) has 76 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 45 residues other bump:2.32562 Ang L14.CD1 and L42.CD2 other bump:2.26175 Ang R11.NH1 and E41.C other bump:2.70446 Ang R11.CD and E41.O other bump:2.20049 Ang R11.NH1 and E41.O other bump:1.16878 Ang A37.O and E41.OE1 other bump:2.12325 Ang A37.C and E41.OE1 other bump:2.71002 Ang V38.CA and E41.OE1 other bump:3.06491 Ang G7.CA and E41.CD other bump:2.03305 Ang A37.O and E41.CD other bump:2.97567 Ang A37.C and E41.CD other bump:3.08232 Ang G7.CA and E41.CG other bump:3.24563 Ang G7.C and E41.CG other bump:2.83406 Ang R11.CZ and E41.CB other bump:1.98869 Ang R11.NH1 and E41.CB other bump:1.91041 Ang R11.NH1 and E41.CA other bump:2.71694 Ang Y3.CB and M12.SD other bump:1.83398 Ang I8.CD1 and R11.NH2 other bump:2.88577 Ang Y3.CG and G9.CA other bump:2.27855 Ang Y3.CD2 and G9.CA other bump:2.62641 Ang Y3.CE2 and G9.CA other bump:2.49919 Ang Y3.CD1 and G9.N other bump:2.16413 Ang Y3.CG and G9.N other bump:1.652 Ang Y3.CD2 and G9.N other bump:1.55884 Ang Y3.CE2 and G9.N other bump:2.44228 Ang Y3.CE1 and G9.N other bump:2.00811 Ang Y3.CZ and G9.N other bump:1.75321 Ang Y3.CD1 and I8.C other bump:2.1123 Ang Y3.CG and I8.C other bump:2.42046 Ang Y3.CD2 and I8.C other bump:2.44556 Ang Y3.CE2 and I8.C other bump:3.29349 Ang Y3.CB and I8.C other bump:1.78431 Ang Y3.CE1 and I8.C other bump:2.14011 Ang Y3.CZ and I8.C other bump:2.31189 Ang Y3.CD1 and I8.O other bump:2.61852 Ang Y3.CG and I8.O other bump:3.14929 Ang Y3.CA and I8.CG2 other bump:1.35201 Ang Y3.CD1 and I8.CG2 other bump:2.30031 Ang Y3.CG and I8.CG2 other bump:2.78818 Ang Y3.CB and I8.CG2 other bump:2.34648 Ang Y3.CE1 and I8.CG2 other bump:2.74217 Ang Y3.CD1 and I8.CG1 other bump:2.23779 Ang Y3.CE1 and I8.CG1 other bump:1.23883 Ang Y3.CD1 and I8.CB other bump:2.40368 Ang Y3.CG and I8.CB other bump:3.10444 Ang Y3.CD2 and I8.CB other bump:3.069 Ang Y3.CE2 and I8.CB other bump:1.12483 Ang Y3.CE1 and I8.CB other bump:2.26274 Ang Y3.CZ and I8.CB other bump:1.62932 Ang Y3.CD1 and I8.CA other bump:2.71932 Ang Y3.CG and I8.CA other bump:3.12305 Ang Y3.CD2 and I8.CA other bump:2.75622 Ang Y3.CE2 and I8.CA other bump:2.512 Ang Y3.OH and I8.CA other bump:0.665591 Ang Y3.CE1 and I8.CA other bump:1.68541 Ang Y3.CZ and I8.CA other bump:2.83655 Ang Y3.CD1 and I8.N other bump:2.57477 Ang Y3.CE2 and I8.N other bump:1.15168 Ang Y3.OH and I8.N other bump:1.48594 Ang Y3.CE1 and I8.N other bump:1.20467 Ang Y3.CZ and I8.N other bump:3.2778 Ang Y3.CE2 and G7.C other bump:1.5461 Ang Y3.OH and G7.C other bump:2.68496 Ang Y3.CE1 and G7.C other bump:2.19595 Ang Y3.CZ and G7.C other bump:1.81848 Ang Y3.OH and G7.CA other bump:3.05225 Ang Y3.CZ and G7.CA other bump:1.8189 Ang Y3.OH and G7.N other bump:2.96188 Ang Y3.CZ and G7.N other bump:3.11491 Ang Y3.CE2 and D6.C other bump:2.54751 Ang Y3.OH and D6.C other bump:3.21493 Ang Y3.CZ and D6.C other bump:2.49392 Ang Y3.CE2 and T5.C other bump:3.13648 Ang Y3.CZ and T5.C other bump:2.21115 Ang Y3.CD2 and T5.O other bump:1.32678 Ang Y3.CE2 and T5.O other bump:2.27616 Ang Y3.CZ and T5.O T0191 45 :DN 1gpjA 190 :GV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues T0191 47 :NIIIANRTVEKAEALAKEIA 1gpjA 193 :AVLVANRTYERAVELARDLG Fragment has 19 clashes (null) has 19 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 22 residues other bump:3.28619 Ang I3.CG1 and G22.CA neighbor-bump: 2.2506 Ang I20.O and A21.CB neighbor-bump: 2.53375 Ang I20.C and A21.CB other bump:1.44539 Ang I3.CD1 and I20.CG2 other bump:2.89365 Ang I3.CG1 and I20.CG2 other bump:2.80691 Ang I3.CD1 and I20.CB other bump:2.49571 Ang I5.CD1 and A17.CB other bump:2.9766 Ang I5.CG1 and A17.CB other bump:2.28293 Ang I5.CD1 and A17.CA other bump:1.97413 Ang I5.CD1 and A17.N other bump:2.87382 Ang I5.CD1 and L16.C other bump:2.00721 Ang V10.CG1 and E14.OE2 other bump:2.40763 Ang E11.CA and E14.OE1 other bump:1.64561 Ang V10.O and E14.OE1 other bump:2.29284 Ang V10.C and E14.OE1 other bump:2.41272 Ang V10.O and E14.CD other bump:2.99826 Ang V10.CG1 and E14.CD other bump:3.1113 Ang V10.C and E14.CD other bump:2.66759 Ang I5.CD1 and A13.O T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLR 1gpjA 213 :GEAVRFDELVDHLARSDVVVSATAAPHPVIHVDDVREALRKRD Fragment has 44 clashes (null) has 44 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 45 residues other bump:2.86372 Ang D15.CG and L43.CD2 other bump:2.2607 Ang D15.OD2 and L43.CD2 other bump:2.76557 Ang D15.C and L43.CD1 other bump:1.73614 Ang D15.O and L43.CD1 other bump:2.79188 Ang D15.OD1 and L43.CD1 other bump:2.34312 Ang D15.CG and L43.CG other bump:2.41345 Ang D15.OD2 and L43.CG other bump:2.13139 Ang D15.OD1 and L43.CG other bump:1.94768 Ang D15.OD1 and K39.O other bump:0.500343 Ang L14.O and K39.NZ other bump:2.52873 Ang L14.CA and K39.NZ other bump:1.14865 Ang L14.C and K39.NZ other bump:2.20145 Ang D15.CA and K39.NZ other bump:2.34434 Ang D15.C and K39.NZ other bump:1.87788 Ang D15.N and K39.NZ other bump:2.89342 Ang D13.C and K39.CE other bump:2.22774 Ang L14.N and K39.CE other bump:1.51092 Ang L14.O and K39.CE other bump:1.18933 Ang L14.CA and K39.CE other bump:2.11486 Ang L14.CB and K39.CE other bump:0.373084 Ang L14.C and K39.CE other bump:2.63342 Ang D15.CA and K39.CE other bump:1.44807 Ang D15.N and K39.CE other bump:3.02821 Ang L14.CG and K39.CD other bump:2.51902 Ang L14.O and K39.CD other bump:1.94455 Ang L14.CA and K39.CD other bump:1.51814 Ang L14.CB and K39.CD other bump:1.75693 Ang L14.C and K39.CD other bump:3.0843 Ang D15.CA and K39.CD other bump:2.10043 Ang D15.N and K39.CD other bump:2.9058 Ang L14.CB and K39.CG other bump:2.58549 Ang L14.C and K39.CG other bump:2.49827 Ang D15.CA and K39.CG other bump:2.11939 Ang D15.N and K39.CG other bump:3.04697 Ang D15.CB and K39.CG other bump:1.67603 Ang I32.O and P36.CD other bump:2.89863 Ang I32.C and P36.CD other bump:3.08794 Ang D33.C and P36.CD other bump:2.47197 Ang I32.O and P36.CG self-bump: 1.39825 Ang D33.CA and D33.CB other bump:2.45711 Ang D13.O and V17.CG2 other bump:2.68119 Ang V5.CG2 and D13.OD2 other bump:2.80762 Ang G9.C and D13.OD1 other bump:2.0717 Ang G9.O and D13.OD1 T0191 117 :EDMVVMDLIYNPLETVLLKEAKKVNAKTINGLGMLIYQGAVAFK 1gpjA 258 :SPILIIDIANPRDVEEGVENIEDVEVRTIDDLRVIARENLERRR Fragment has 22 clashes (null) has 22 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 45 residues other bump:2.83524 Ang M7.SD and L33.CD1 other bump:2.96977 Ang K20.CG and A27.CB neighbor-bump: 2.17254 Ang V17.O and L18.CB neighbor-bump: 2.59256 Ang V17.C and L18.CB other bump:1.52281 Ang V6.CG2 and E15.OE2 other bump:2.68992 Ang V6.CB and E15.OE2 other bump:2.32514 Ang V6.CG2 and E15.CD other bump:2.77381 Ang I10.CG1 and L14.CD2 other bump:1.65862 Ang I10.CD1 and L14.CD2 other bump:2.57874 Ang I10.CG2 and L14.CD1 other bump:2.87153 Ang I10.CB and L14.CG other bump:2.00364 Ang I10.CG1 and L14.CG other bump:2.74877 Ang I10.CG2 and L14.CG other bump:1.505 Ang I10.CD1 and L14.CG other bump:2.79244 Ang I10.CG1 and L14.CB other bump:2.19287 Ang I10.CD1 and L14.CB other bump:3.09048 Ang I10.CG1 and L14.CA other bump:2.23387 Ang I10.CD1 and L14.CA other bump:2.55671 Ang I10.CG1 and L14.N other bump:2.30715 Ang I10.CD1 and L14.N other bump:2.96953 Ang I10.CD1 and P13.C other bump:2.76002 Ang M7.CE and L9.CD1 Number of specific fragments= 5 total=565 Number of alignments=102 # Reading fragments from alignment file # T0191 read from T0191-1gpjA-local-adpstyle5.pw.a2m.gz # 1gpjA read from T0191-1gpjA-local-adpstyle5.pw.a2m.gz # found chain 1gpjA in template set T0191 2 :GYNTDGIGARMALEEEIGRVKDKNIVIYGAGGAARAVAFELAK 1gpjA 146 :GAVSIGSAAVELAERELGSLHDKTVLVVGAGEMGKTVAKSLVD Fragment has 76 clashes (null) has 76 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 45 residues other bump:2.32562 Ang L14.CD1 and L42.CD2 other bump:2.26175 Ang R11.NH1 and E41.C other bump:2.70446 Ang R11.CD and E41.O other bump:2.20049 Ang R11.NH1 and E41.O other bump:1.16878 Ang A37.O and E41.OE1 other bump:2.12325 Ang A37.C and E41.OE1 other bump:2.71002 Ang V38.CA and E41.OE1 other bump:3.06491 Ang G7.CA and E41.CD other bump:2.03305 Ang A37.O and E41.CD other bump:2.97567 Ang A37.C and E41.CD other bump:3.08232 Ang G7.CA and E41.CG other bump:3.24563 Ang G7.C and E41.CG other bump:2.83406 Ang R11.CZ and E41.CB other bump:1.98869 Ang R11.NH1 and E41.CB other bump:1.91041 Ang R11.NH1 and E41.CA other bump:2.71694 Ang Y3.CB and M12.SD other bump:1.83398 Ang I8.CD1 and R11.NH2 other bump:2.88577 Ang Y3.CG and G9.CA other bump:2.27855 Ang Y3.CD2 and G9.CA other bump:2.62641 Ang Y3.CE2 and G9.CA other bump:2.49919 Ang Y3.CD1 and G9.N other bump:2.16413 Ang Y3.CG and G9.N other bump:1.652 Ang Y3.CD2 and G9.N other bump:1.55884 Ang Y3.CE2 and G9.N other bump:2.44228 Ang Y3.CE1 and G9.N other bump:2.00811 Ang Y3.CZ and G9.N other bump:1.75321 Ang Y3.CD1 and I8.C other bump:2.1123 Ang Y3.CG and I8.C other bump:2.42046 Ang Y3.CD2 and I8.C other bump:2.44556 Ang Y3.CE2 and I8.C other bump:3.29349 Ang Y3.CB and I8.C other bump:1.78431 Ang Y3.CE1 and I8.C other bump:2.14011 Ang Y3.CZ and I8.C other bump:2.31189 Ang Y3.CD1 and I8.O other bump:2.61852 Ang Y3.CG and I8.O other bump:3.14929 Ang Y3.CA and I8.CG2 other bump:1.35201 Ang Y3.CD1 and I8.CG2 other bump:2.30031 Ang Y3.CG and I8.CG2 other bump:2.78818 Ang Y3.CB and I8.CG2 other bump:2.34648 Ang Y3.CE1 and I8.CG2 other bump:2.74217 Ang Y3.CD1 and I8.CG1 other bump:2.23779 Ang Y3.CE1 and I8.CG1 other bump:1.23883 Ang Y3.CD1 and I8.CB other bump:2.40368 Ang Y3.CG and I8.CB other bump:3.10444 Ang Y3.CD2 and I8.CB other bump:3.069 Ang Y3.CE2 and I8.CB other bump:1.12483 Ang Y3.CE1 and I8.CB other bump:2.26274 Ang Y3.CZ and I8.CB other bump:1.62932 Ang Y3.CD1 and I8.CA other bump:2.71932 Ang Y3.CG and I8.CA other bump:3.12305 Ang Y3.CD2 and I8.CA other bump:2.75622 Ang Y3.CE2 and I8.CA other bump:2.512 Ang Y3.OH and I8.CA other bump:0.665591 Ang Y3.CE1 and I8.CA other bump:1.68541 Ang Y3.CZ and I8.CA other bump:2.83655 Ang Y3.CD1 and I8.N other bump:2.57477 Ang Y3.CE2 and I8.N other bump:1.15168 Ang Y3.OH and I8.N other bump:1.48594 Ang Y3.CE1 and I8.N other bump:1.20467 Ang Y3.CZ and I8.N other bump:3.2778 Ang Y3.CE2 and G7.C other bump:1.5461 Ang Y3.OH and G7.C other bump:2.68496 Ang Y3.CE1 and G7.C other bump:2.19595 Ang Y3.CZ and G7.C other bump:1.81848 Ang Y3.OH and G7.CA other bump:3.05225 Ang Y3.CZ and G7.CA other bump:1.8189 Ang Y3.OH and G7.N other bump:2.96188 Ang Y3.CZ and G7.N other bump:3.11491 Ang Y3.CE2 and D6.C other bump:2.54751 Ang Y3.OH and D6.C other bump:3.21493 Ang Y3.CZ and D6.C other bump:2.49392 Ang Y3.CE2 and T5.C other bump:3.13648 Ang Y3.CZ and T5.C other bump:2.21115 Ang Y3.CD2 and T5.O other bump:1.32678 Ang Y3.CE2 and T5.O other bump:2.27616 Ang Y3.CZ and T5.O T0191 45 :DN 1gpjA 190 :GV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues T0191 47 :NIIIANRTVEKAEALAKEIA 1gpjA 193 :AVLVANRTYERAVELARDLG Fragment has 19 clashes (null) has 19 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 22 residues other bump:3.28619 Ang I3.CG1 and G22.CA neighbor-bump: 2.2506 Ang I20.O and A21.CB neighbor-bump: 2.53375 Ang I20.C and A21.CB other bump:1.44539 Ang I3.CD1 and I20.CG2 other bump:2.89365 Ang I3.CG1 and I20.CG2 other bump:2.80691 Ang I3.CD1 and I20.CB other bump:2.49571 Ang I5.CD1 and A17.CB other bump:2.9766 Ang I5.CG1 and A17.CB other bump:2.28293 Ang I5.CD1 and A17.CA other bump:1.97413 Ang I5.CD1 and A17.N other bump:2.87382 Ang I5.CD1 and L16.C other bump:2.00721 Ang V10.CG1 and E14.OE2 other bump:2.40763 Ang E11.CA and E14.OE1 other bump:1.64561 Ang V10.O and E14.OE1 other bump:2.29284 Ang V10.C and E14.OE1 other bump:2.41272 Ang V10.O and E14.CD other bump:2.99826 Ang V10.CG1 and E14.CD other bump:3.1113 Ang V10.C and E14.CD other bump:2.66759 Ang I5.CD1 and A13.O T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLR 1gpjA 213 :GEAVRFDELVDHLARSDVVVSATAAPHPVIHVDDVREALRKRD Fragment has 44 clashes (null) has 44 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 45 residues other bump:2.86372 Ang D15.CG and L43.CD2 other bump:2.2607 Ang D15.OD2 and L43.CD2 other bump:2.76557 Ang D15.C and L43.CD1 other bump:1.73614 Ang D15.O and L43.CD1 other bump:2.79188 Ang D15.OD1 and L43.CD1 other bump:2.34312 Ang D15.CG and L43.CG other bump:2.41345 Ang D15.OD2 and L43.CG other bump:2.13139 Ang D15.OD1 and L43.CG other bump:1.94768 Ang D15.OD1 and K39.O other bump:0.500343 Ang L14.O and K39.NZ other bump:2.52873 Ang L14.CA and K39.NZ other bump:1.14865 Ang L14.C and K39.NZ other bump:2.20145 Ang D15.CA and K39.NZ other bump:2.34434 Ang D15.C and K39.NZ other bump:1.87788 Ang D15.N and K39.NZ other bump:2.89342 Ang D13.C and K39.CE other bump:2.22774 Ang L14.N and K39.CE other bump:1.51092 Ang L14.O and K39.CE other bump:1.18933 Ang L14.CA and K39.CE other bump:2.11486 Ang L14.CB and K39.CE other bump:0.373084 Ang L14.C and K39.CE other bump:2.63342 Ang D15.CA and K39.CE other bump:1.44807 Ang D15.N and K39.CE other bump:3.02821 Ang L14.CG and K39.CD other bump:2.51902 Ang L14.O and K39.CD other bump:1.94455 Ang L14.CA and K39.CD other bump:1.51814 Ang L14.CB and K39.CD other bump:1.75693 Ang L14.C and K39.CD other bump:3.0843 Ang D15.CA and K39.CD other bump:2.10043 Ang D15.N and K39.CD other bump:2.9058 Ang L14.CB and K39.CG other bump:2.58549 Ang L14.C and K39.CG other bump:2.49827 Ang D15.CA and K39.CG other bump:2.11939 Ang D15.N and K39.CG other bump:3.04697 Ang D15.CB and K39.CG other bump:1.67603 Ang I32.O and P36.CD other bump:2.89863 Ang I32.C and P36.CD other bump:3.08794 Ang D33.C and P36.CD other bump:2.47197 Ang I32.O and P36.CG self-bump: 1.39825 Ang D33.CA and D33.CB other bump:2.45711 Ang D13.O and V17.CG2 other bump:2.68119 Ang V5.CG2 and D13.OD2 other bump:2.80762 Ang G9.C and D13.OD1 other bump:2.0717 Ang G9.O and D13.OD1 T0191 117 :EDMVVMDLIYNPLETVLLKEAKKVNAKTINGLGMLIYQGAVAFK 1gpjA 258 :SPILIIDIANPRDVEEGVENIEDVEVRTIDDLRVIARENLERRR Fragment has 22 clashes (null) has 22 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 45 residues other bump:2.83524 Ang M7.SD and L33.CD1 other bump:2.96977 Ang K20.CG and A27.CB neighbor-bump: 2.17254 Ang V17.O and L18.CB neighbor-bump: 2.59256 Ang V17.C and L18.CB other bump:1.52281 Ang V6.CG2 and E15.OE2 other bump:2.68992 Ang V6.CB and E15.OE2 other bump:2.32514 Ang V6.CG2 and E15.CD other bump:2.77381 Ang I10.CG1 and L14.CD2 other bump:1.65862 Ang I10.CD1 and L14.CD2 other bump:2.57874 Ang I10.CG2 and L14.CD1 other bump:2.87153 Ang I10.CB and L14.CG other bump:2.00364 Ang I10.CG1 and L14.CG other bump:2.74877 Ang I10.CG2 and L14.CG other bump:1.505 Ang I10.CD1 and L14.CG other bump:2.79244 Ang I10.CG1 and L14.CB other bump:2.19287 Ang I10.CD1 and L14.CB other bump:3.09048 Ang I10.CG1 and L14.CA other bump:2.23387 Ang I10.CD1 and L14.CA other bump:2.55671 Ang I10.CG1 and L14.N other bump:2.30715 Ang I10.CD1 and L14.N other bump:2.96953 Ang I10.CD1 and P13.C other bump:2.76002 Ang M7.CE and L9.CD1 Number of specific fragments= 5 total=570 Number of alignments=103 # Reading fragments from alignment file # T0191 read from T0191-1gpjA-simpleSW-adpstyle1.pw.a2m.gz # 1gpjA read from T0191-1gpjA-simpleSW-adpstyle1.pw.a2m.gz # found chain 1gpjA in template set T0191 15 :EEEIGRVKDKNIVIYGAGGAARAVAFELAKDN 1gpjA 159 :ERELGSLHDKTVLVVGAGEMGKTVAKSLVDRG Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 34 residues neighbor-bump: 1.97845 Ang D32.O and N33.CB neighbor-bump: 2.41571 Ang D32.C and N33.CB neighbor-bump: 2.15522 Ang D32.OD1 and N33.N other bump:2.29182 Ang L29.O and D32.OD1 self-bump: 1.3945 Ang D32.CA and D32.CB other bump:1.16878 Ang A24.O and E28.OE1 other bump:2.12325 Ang A24.C and E28.OE1 other bump:2.71002 Ang V25.CA and E28.OE1 other bump:2.03305 Ang A24.O and E28.CD other bump:2.97567 Ang A24.C and E28.CD T0191 47 :NIIIANRTVEKAEALAKEIA 1gpjA 193 :AVLVANRTYERAVELARDLG Fragment has 19 clashes (null) has 19 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 22 residues other bump:3.28619 Ang I3.CG1 and G22.CA neighbor-bump: 2.2506 Ang I20.O and A21.CB neighbor-bump: 2.53375 Ang I20.C and A21.CB other bump:1.44539 Ang I3.CD1 and I20.CG2 other bump:2.89365 Ang I3.CG1 and I20.CG2 other bump:2.80691 Ang I3.CD1 and I20.CB other bump:2.49571 Ang I5.CD1 and A17.CB other bump:2.9766 Ang I5.CG1 and A17.CB other bump:2.28293 Ang I5.CD1 and A17.CA other bump:1.97413 Ang I5.CD1 and A17.N other bump:2.87382 Ang I5.CD1 and L16.C other bump:2.00721 Ang V10.CG1 and E14.OE2 other bump:2.40763 Ang E11.CA and E14.OE1 other bump:1.64561 Ang V10.O and E14.OE1 other bump:2.29284 Ang V10.C and E14.OE1 other bump:2.41272 Ang V10.O and E14.CD other bump:2.99826 Ang V10.CG1 and E14.CD other bump:3.1113 Ang V10.C and E14.CD other bump:2.66759 Ang I5.CD1 and A13.O T0191 74 :GEEVKFSGLDVDLDGVDIIINAT 1gpjA 213 :GEAVRFDELVDHLARSDVVVSAT Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 25 residues other bump:2.45711 Ang D13.O and V17.CG2 other bump:2.68119 Ang V5.CG2 and D13.OD2 other bump:2.0717 Ang G9.O and D13.OD1 other bump:2.80762 Ang G9.C and D13.OD1 Number of specific fragments= 3 total=573 Number of alignments=104 # Reading fragments from alignment file # T0191 read from T0191-1gpjA-simpleSW-adpstyle5.pw.a2m.gz # 1gpjA read from T0191-1gpjA-simpleSW-adpstyle5.pw.a2m.gz # found chain 1gpjA in template set T0191 10 :ARMALEEEIGRVKDKNIVIYGAGGAARAVAFELAKDN 1gpjA 154 :AVELAERELGSLHDKTVLVVGAGEMGKTVAKSLVDRG Fragment has 17 clashes (null) has 17 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 39 residues neighbor-bump: 2.41571 Ang D37.C and N38.CB neighbor-bump: 1.97845 Ang D37.O and N38.CB neighbor-bump: 2.15522 Ang D37.OD1 and N38.N other bump:2.29182 Ang L34.O and D37.OD1 self-bump: 1.3945 Ang D37.CA and D37.CB other bump:2.32562 Ang L6.CD1 and L34.CD2 other bump:2.26175 Ang R3.NH1 and E33.C other bump:2.70446 Ang R3.CD and E33.O other bump:2.20049 Ang R3.NH1 and E33.O other bump:1.16878 Ang A29.O and E33.OE1 other bump:2.12325 Ang A29.C and E33.OE1 other bump:2.71002 Ang V30.CA and E33.OE1 other bump:2.03305 Ang A29.O and E33.CD other bump:2.97567 Ang A29.C and E33.CD other bump:2.83406 Ang R3.CZ and E33.CB other bump:1.98869 Ang R3.NH1 and E33.CB other bump:1.91041 Ang R3.NH1 and E33.CA T0191 47 :NIIIANRTVEKAEALAKEIA 1gpjA 193 :AVLVANRTYERAVELARDLG Fragment has 19 clashes (null) has 19 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 22 residues other bump:3.28619 Ang I3.CG1 and G22.CA neighbor-bump: 2.2506 Ang I20.O and A21.CB neighbor-bump: 2.53375 Ang I20.C and A21.CB other bump:1.44539 Ang I3.CD1 and I20.CG2 other bump:2.89365 Ang I3.CG1 and I20.CG2 other bump:2.80691 Ang I3.CD1 and I20.CB other bump:2.49571 Ang I5.CD1 and A17.CB other bump:2.9766 Ang I5.CG1 and A17.CB other bump:2.28293 Ang I5.CD1 and A17.CA other bump:1.97413 Ang I5.CD1 and A17.N other bump:2.87382 Ang I5.CD1 and L16.C other bump:2.00721 Ang V10.CG1 and E14.OE2 other bump:2.40763 Ang E11.CA and E14.OE1 other bump:1.64561 Ang V10.O and E14.OE1 other bump:2.29284 Ang V10.C and E14.OE1 other bump:2.41272 Ang V10.O and E14.CD other bump:2.99826 Ang V10.CG1 and E14.CD other bump:3.1113 Ang V10.C and E14.CD other bump:2.66759 Ang I5.CD1 and A13.O T0191 74 :GEEVKFSGLDVDLDGVDIIINATPI 1gpjA 213 :GEAVRFDELVDHLARSDVVVSATAA Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 27 residues other bump:2.45711 Ang D13.O and V17.CG2 other bump:2.68119 Ang V5.CG2 and D13.OD2 other bump:2.0717 Ang G9.O and D13.OD1 other bump:2.80762 Ang G9.C and D13.OD1 T0191 100 :MYPNIDVEPIVKAEKLRE 1gpjA 238 :PHPVIHVDDVREALRKRD Fragment has 8 clashes (null) has 8 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 20 residues other bump:2.64259 Ang V12.CG1 and K16.NZ other bump:1.09426 Ang I11.O and E15.OE1 other bump:1.96316 Ang I11.C and E15.OE1 other bump:2.07082 Ang I11.O and E15.CD other bump:2.91678 Ang I11.C and E15.CD other bump:2.6059 Ang D7.O and P10.CD other bump:3.05742 Ang D7.C and P10.CD other bump:3.06475 Ang D7.CB and P10.CD T0191 118 :DMVVMDLIYNPLETVLLKEAKKVNAKTINGL 1gpjA 259 :PILIIDIANPRDVEEGVENIEDVEVRTIDDL Fragment has 22 clashes (null) has 22 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 33 residues other bump:2.83524 Ang M6.SD and L32.CD1 other bump:2.96977 Ang K19.CG and A26.CB neighbor-bump: 2.17254 Ang V16.O and L17.CB neighbor-bump: 2.59256 Ang V16.C and L17.CB other bump:1.52281 Ang V5.CG2 and E14.OE2 other bump:2.68992 Ang V5.CB and E14.OE2 other bump:2.32514 Ang V5.CG2 and E14.CD other bump:2.77381 Ang I9.CG1 and L13.CD2 other bump:1.65862 Ang I9.CD1 and L13.CD2 other bump:2.57874 Ang I9.CG2 and L13.CD1 other bump:2.87153 Ang I9.CB and L13.CG other bump:2.00364 Ang I9.CG1 and L13.CG other bump:2.74877 Ang I9.CG2 and L13.CG other bump:1.505 Ang I9.CD1 and L13.CG other bump:2.79244 Ang I9.CG1 and L13.CB other bump:2.19287 Ang I9.CD1 and L13.CB other bump:3.09048 Ang I9.CG1 and L13.CA other bump:2.23387 Ang I9.CD1 and L13.CA other bump:2.55671 Ang I9.CG1 and L13.N other bump:2.30715 Ang I9.CD1 and L13.N other bump:2.96953 Ang I9.CD1 and P12.C other bump:2.76002 Ang M6.CE and L8.CD1 Number of specific fragments= 5 total=578 Number of alignments=105 # Reading fragments from alignment file # T0191 read from T0191-1gpjA-vit-adpstyle1.pw.a2m.gz # 1gpjA read from T0191-1gpjA-vit-adpstyle1.pw.a2m.gz # found chain 1gpjA in template set T0191 2 :GYNTDGIGARMALEEEIGRVKDKNIVIYGAGGAARAVAFELAK 1gpjA 146 :GAVSIGSAAVELAERELGSLHDKTVLVVGAGEMGKTVAKSLVD Fragment has 76 clashes (null) has 76 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 45 residues other bump:2.32562 Ang L14.CD1 and L42.CD2 other bump:2.26175 Ang R11.NH1 and E41.C other bump:2.70446 Ang R11.CD and E41.O other bump:2.20049 Ang R11.NH1 and E41.O other bump:1.16878 Ang A37.O and E41.OE1 other bump:2.12325 Ang A37.C and E41.OE1 other bump:2.71002 Ang V38.CA and E41.OE1 other bump:3.06491 Ang G7.CA and E41.CD other bump:2.03305 Ang A37.O and E41.CD other bump:2.97567 Ang A37.C and E41.CD other bump:3.08232 Ang G7.CA and E41.CG other bump:3.24563 Ang G7.C and E41.CG other bump:2.83406 Ang R11.CZ and E41.CB other bump:1.98869 Ang R11.NH1 and E41.CB other bump:1.91041 Ang R11.NH1 and E41.CA other bump:2.71694 Ang Y3.CB and M12.SD other bump:1.83398 Ang I8.CD1 and R11.NH2 other bump:2.88577 Ang Y3.CG and G9.CA other bump:2.27855 Ang Y3.CD2 and G9.CA other bump:2.62641 Ang Y3.CE2 and G9.CA other bump:2.49919 Ang Y3.CD1 and G9.N other bump:2.16413 Ang Y3.CG and G9.N other bump:1.652 Ang Y3.CD2 and G9.N other bump:1.55884 Ang Y3.CE2 and G9.N other bump:2.44228 Ang Y3.CE1 and G9.N other bump:2.00811 Ang Y3.CZ and G9.N other bump:1.75321 Ang Y3.CD1 and I8.C other bump:2.1123 Ang Y3.CG and I8.C other bump:2.42046 Ang Y3.CD2 and I8.C other bump:2.44556 Ang Y3.CE2 and I8.C other bump:3.29349 Ang Y3.CB and I8.C other bump:1.78431 Ang Y3.CE1 and I8.C other bump:2.14011 Ang Y3.CZ and I8.C other bump:2.31189 Ang Y3.CD1 and I8.O other bump:2.61852 Ang Y3.CG and I8.O other bump:3.14929 Ang Y3.CA and I8.CG2 other bump:1.35201 Ang Y3.CD1 and I8.CG2 other bump:2.30031 Ang Y3.CG and I8.CG2 other bump:2.78818 Ang Y3.CB and I8.CG2 other bump:2.34648 Ang Y3.CE1 and I8.CG2 other bump:2.74217 Ang Y3.CD1 and I8.CG1 other bump:2.23779 Ang Y3.CE1 and I8.CG1 other bump:1.23883 Ang Y3.CD1 and I8.CB other bump:2.40368 Ang Y3.CG and I8.CB other bump:3.10444 Ang Y3.CD2 and I8.CB other bump:3.069 Ang Y3.CE2 and I8.CB other bump:1.12483 Ang Y3.CE1 and I8.CB other bump:2.26274 Ang Y3.CZ and I8.CB other bump:1.62932 Ang Y3.CD1 and I8.CA other bump:2.71932 Ang Y3.CG and I8.CA other bump:3.12305 Ang Y3.CD2 and I8.CA other bump:2.75622 Ang Y3.CE2 and I8.CA other bump:2.512 Ang Y3.OH and I8.CA other bump:0.665591 Ang Y3.CE1 and I8.CA other bump:1.68541 Ang Y3.CZ and I8.CA other bump:2.83655 Ang Y3.CD1 and I8.N other bump:2.57477 Ang Y3.CE2 and I8.N other bump:1.15168 Ang Y3.OH and I8.N other bump:1.48594 Ang Y3.CE1 and I8.N other bump:1.20467 Ang Y3.CZ and I8.N other bump:3.2778 Ang Y3.CE2 and G7.C other bump:1.5461 Ang Y3.OH and G7.C other bump:2.68496 Ang Y3.CE1 and G7.C other bump:2.19595 Ang Y3.CZ and G7.C other bump:1.81848 Ang Y3.OH and G7.CA other bump:3.05225 Ang Y3.CZ and G7.CA other bump:1.8189 Ang Y3.OH and G7.N other bump:2.96188 Ang Y3.CZ and G7.N other bump:3.11491 Ang Y3.CE2 and D6.C other bump:2.54751 Ang Y3.OH and D6.C other bump:3.21493 Ang Y3.CZ and D6.C other bump:2.49392 Ang Y3.CE2 and T5.C other bump:3.13648 Ang Y3.CZ and T5.C other bump:2.21115 Ang Y3.CD2 and T5.O other bump:1.32678 Ang Y3.CE2 and T5.O other bump:2.27616 Ang Y3.CZ and T5.O T0191 45 :DN 1gpjA 190 :GV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues T0191 47 :NIIIANRTVEKAEALAKEIA 1gpjA 193 :AVLVANRTYERAVELARDLG Fragment has 19 clashes (null) has 19 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 22 residues other bump:3.28619 Ang I3.CG1 and G22.CA neighbor-bump: 2.2506 Ang I20.O and A21.CB neighbor-bump: 2.53375 Ang I20.C and A21.CB other bump:1.44539 Ang I3.CD1 and I20.CG2 other bump:2.89365 Ang I3.CG1 and I20.CG2 other bump:2.80691 Ang I3.CD1 and I20.CB other bump:2.49571 Ang I5.CD1 and A17.CB other bump:2.9766 Ang I5.CG1 and A17.CB other bump:2.28293 Ang I5.CD1 and A17.CA other bump:1.97413 Ang I5.CD1 and A17.N other bump:2.87382 Ang I5.CD1 and L16.C other bump:2.00721 Ang V10.CG1 and E14.OE2 other bump:2.40763 Ang E11.CA and E14.OE1 other bump:1.64561 Ang V10.O and E14.OE1 other bump:2.29284 Ang V10.C and E14.OE1 other bump:2.41272 Ang V10.O and E14.CD other bump:2.99826 Ang V10.CG1 and E14.CD other bump:3.1113 Ang V10.C and E14.CD other bump:2.66759 Ang I5.CD1 and A13.O T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLR 1gpjA 213 :GEAVRFDELVDHLARSDVVVSATAAPHPVIHVDDVREALRKRD Fragment has 44 clashes (null) has 44 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 45 residues other bump:2.86372 Ang D15.CG and L43.CD2 other bump:2.2607 Ang D15.OD2 and L43.CD2 other bump:2.76557 Ang D15.C and L43.CD1 other bump:1.73614 Ang D15.O and L43.CD1 other bump:2.79188 Ang D15.OD1 and L43.CD1 other bump:2.34312 Ang D15.CG and L43.CG other bump:2.41345 Ang D15.OD2 and L43.CG other bump:2.13139 Ang D15.OD1 and L43.CG other bump:1.94768 Ang D15.OD1 and K39.O other bump:0.500343 Ang L14.O and K39.NZ other bump:2.52873 Ang L14.CA and K39.NZ other bump:1.14865 Ang L14.C and K39.NZ other bump:2.20145 Ang D15.CA and K39.NZ other bump:2.34434 Ang D15.C and K39.NZ other bump:1.87788 Ang D15.N and K39.NZ other bump:2.89342 Ang D13.C and K39.CE other bump:2.22774 Ang L14.N and K39.CE other bump:1.51092 Ang L14.O and K39.CE other bump:1.18933 Ang L14.CA and K39.CE other bump:2.11486 Ang L14.CB and K39.CE other bump:0.373084 Ang L14.C and K39.CE other bump:2.63342 Ang D15.CA and K39.CE other bump:1.44807 Ang D15.N and K39.CE other bump:3.02821 Ang L14.CG and K39.CD other bump:2.51902 Ang L14.O and K39.CD other bump:1.94455 Ang L14.CA and K39.CD other bump:1.51814 Ang L14.CB and K39.CD other bump:1.75693 Ang L14.C and K39.CD other bump:3.0843 Ang D15.CA and K39.CD other bump:2.10043 Ang D15.N and K39.CD other bump:2.9058 Ang L14.CB and K39.CG other bump:2.58549 Ang L14.C and K39.CG other bump:2.49827 Ang D15.CA and K39.CG other bump:2.11939 Ang D15.N and K39.CG other bump:3.04697 Ang D15.CB and K39.CG other bump:1.67603 Ang I32.O and P36.CD other bump:2.89863 Ang I32.C and P36.CD other bump:3.08794 Ang D33.C and P36.CD other bump:2.47197 Ang I32.O and P36.CG self-bump: 1.39825 Ang D33.CA and D33.CB other bump:2.45711 Ang D13.O and V17.CG2 other bump:2.68119 Ang V5.CG2 and D13.OD2 other bump:2.80762 Ang G9.C and D13.OD1 other bump:2.0717 Ang G9.O and D13.OD1 T0191 117 :EDMVVMDLIYNPLETVLLKEAKKVNAKTINGLGMLIYQGAVAFK 1gpjA 258 :SPILIIDIANPRDVEEGVENIEDVEVRTIDDLRVIARENLERRR Fragment has 22 clashes (null) has 22 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 45 residues other bump:2.83524 Ang M7.SD and L33.CD1 other bump:2.96977 Ang K20.CG and A27.CB neighbor-bump: 2.17254 Ang V17.O and L18.CB neighbor-bump: 2.59256 Ang V17.C and L18.CB other bump:1.52281 Ang V6.CG2 and E15.OE2 other bump:2.68992 Ang V6.CB and E15.OE2 other bump:2.32514 Ang V6.CG2 and E15.CD other bump:2.77381 Ang I10.CG1 and L14.CD2 other bump:1.65862 Ang I10.CD1 and L14.CD2 other bump:2.57874 Ang I10.CG2 and L14.CD1 other bump:2.87153 Ang I10.CB and L14.CG other bump:2.00364 Ang I10.CG1 and L14.CG other bump:2.74877 Ang I10.CG2 and L14.CG other bump:1.505 Ang I10.CD1 and L14.CG other bump:2.79244 Ang I10.CG1 and L14.CB other bump:2.19287 Ang I10.CD1 and L14.CB other bump:3.09048 Ang I10.CG1 and L14.CA other bump:2.23387 Ang I10.CD1 and L14.CA other bump:2.55671 Ang I10.CG1 and L14.N other bump:2.30715 Ang I10.CD1 and L14.N other bump:2.96953 Ang I10.CD1 and P13.C other bump:2.76002 Ang M7.CE and L9.CD1 Number of specific fragments= 5 total=583 Number of alignments=106 # Reading fragments from alignment file # T0191 read from T0191-1gpjA-vit-adpstyle5.pw.a2m.gz # 1gpjA read from T0191-1gpjA-vit-adpstyle5.pw.a2m.gz # found chain 1gpjA in template set T0191 2 :GYNTDGIGARMALEEEIGRVKDKNIVIYGAGGAARAVAFELAK 1gpjA 146 :GAVSIGSAAVELAERELGSLHDKTVLVVGAGEMGKTVAKSLVD Fragment has 76 clashes (null) has 76 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 45 residues other bump:2.32562 Ang L14.CD1 and L42.CD2 other bump:2.26175 Ang R11.NH1 and E41.C other bump:2.70446 Ang R11.CD and E41.O other bump:2.20049 Ang R11.NH1 and E41.O other bump:1.16878 Ang A37.O and E41.OE1 other bump:2.12325 Ang A37.C and E41.OE1 other bump:2.71002 Ang V38.CA and E41.OE1 other bump:3.06491 Ang G7.CA and E41.CD other bump:2.03305 Ang A37.O and E41.CD other bump:2.97567 Ang A37.C and E41.CD other bump:3.08232 Ang G7.CA and E41.CG other bump:3.24563 Ang G7.C and E41.CG other bump:2.83406 Ang R11.CZ and E41.CB other bump:1.98869 Ang R11.NH1 and E41.CB other bump:1.91041 Ang R11.NH1 and E41.CA other bump:2.71694 Ang Y3.CB and M12.SD other bump:1.83398 Ang I8.CD1 and R11.NH2 other bump:2.88577 Ang Y3.CG and G9.CA other bump:2.27855 Ang Y3.CD2 and G9.CA other bump:2.62641 Ang Y3.CE2 and G9.CA other bump:2.49919 Ang Y3.CD1 and G9.N other bump:2.16413 Ang Y3.CG and G9.N other bump:1.652 Ang Y3.CD2 and G9.N other bump:1.55884 Ang Y3.CE2 and G9.N other bump:2.44228 Ang Y3.CE1 and G9.N other bump:2.00811 Ang Y3.CZ and G9.N other bump:1.75321 Ang Y3.CD1 and I8.C other bump:2.1123 Ang Y3.CG and I8.C other bump:2.42046 Ang Y3.CD2 and I8.C other bump:2.44556 Ang Y3.CE2 and I8.C other bump:3.29349 Ang Y3.CB and I8.C other bump:1.78431 Ang Y3.CE1 and I8.C other bump:2.14011 Ang Y3.CZ and I8.C other bump:2.31189 Ang Y3.CD1 and I8.O other bump:2.61852 Ang Y3.CG and I8.O other bump:3.14929 Ang Y3.CA and I8.CG2 other bump:1.35201 Ang Y3.CD1 and I8.CG2 other bump:2.30031 Ang Y3.CG and I8.CG2 other bump:2.78818 Ang Y3.CB and I8.CG2 other bump:2.34648 Ang Y3.CE1 and I8.CG2 other bump:2.74217 Ang Y3.CD1 and I8.CG1 other bump:2.23779 Ang Y3.CE1 and I8.CG1 other bump:1.23883 Ang Y3.CD1 and I8.CB other bump:2.40368 Ang Y3.CG and I8.CB other bump:3.10444 Ang Y3.CD2 and I8.CB other bump:3.069 Ang Y3.CE2 and I8.CB other bump:1.12483 Ang Y3.CE1 and I8.CB other bump:2.26274 Ang Y3.CZ and I8.CB other bump:1.62932 Ang Y3.CD1 and I8.CA other bump:2.71932 Ang Y3.CG and I8.CA other bump:3.12305 Ang Y3.CD2 and I8.CA other bump:2.75622 Ang Y3.CE2 and I8.CA other bump:2.512 Ang Y3.OH and I8.CA other bump:0.665591 Ang Y3.CE1 and I8.CA other bump:1.68541 Ang Y3.CZ and I8.CA other bump:2.83655 Ang Y3.CD1 and I8.N other bump:2.57477 Ang Y3.CE2 and I8.N other bump:1.15168 Ang Y3.OH and I8.N other bump:1.48594 Ang Y3.CE1 and I8.N other bump:1.20467 Ang Y3.CZ and I8.N other bump:3.2778 Ang Y3.CE2 and G7.C other bump:1.5461 Ang Y3.OH and G7.C other bump:2.68496 Ang Y3.CE1 and G7.C other bump:2.19595 Ang Y3.CZ and G7.C other bump:1.81848 Ang Y3.OH and G7.CA other bump:3.05225 Ang Y3.CZ and G7.CA other bump:1.8189 Ang Y3.OH and G7.N other bump:2.96188 Ang Y3.CZ and G7.N other bump:3.11491 Ang Y3.CE2 and D6.C other bump:2.54751 Ang Y3.OH and D6.C other bump:3.21493 Ang Y3.CZ and D6.C other bump:2.49392 Ang Y3.CE2 and T5.C other bump:3.13648 Ang Y3.CZ and T5.C other bump:2.21115 Ang Y3.CD2 and T5.O other bump:1.32678 Ang Y3.CE2 and T5.O other bump:2.27616 Ang Y3.CZ and T5.O T0191 45 :DN 1gpjA 190 :GV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues T0191 47 :NIIIANRTVEKAEALAKEIA 1gpjA 193 :AVLVANRTYERAVELARDLG Fragment has 19 clashes (null) has 19 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 22 residues other bump:3.28619 Ang I3.CG1 and G22.CA neighbor-bump: 2.2506 Ang I20.O and A21.CB neighbor-bump: 2.53375 Ang I20.C and A21.CB other bump:1.44539 Ang I3.CD1 and I20.CG2 other bump:2.89365 Ang I3.CG1 and I20.CG2 other bump:2.80691 Ang I3.CD1 and I20.CB other bump:2.49571 Ang I5.CD1 and A17.CB other bump:2.9766 Ang I5.CG1 and A17.CB other bump:2.28293 Ang I5.CD1 and A17.CA other bump:1.97413 Ang I5.CD1 and A17.N other bump:2.87382 Ang I5.CD1 and L16.C other bump:2.00721 Ang V10.CG1 and E14.OE2 other bump:2.40763 Ang E11.CA and E14.OE1 other bump:1.64561 Ang V10.O and E14.OE1 other bump:2.29284 Ang V10.C and E14.OE1 other bump:2.41272 Ang V10.O and E14.CD other bump:2.99826 Ang V10.CG1 and E14.CD other bump:3.1113 Ang V10.C and E14.CD other bump:2.66759 Ang I5.CD1 and A13.O T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLR 1gpjA 213 :GEAVRFDELVDHLARSDVVVSATAAPHPVIHVDDVREALRKRD Fragment has 44 clashes (null) has 44 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 45 residues other bump:2.86372 Ang D15.CG and L43.CD2 other bump:2.2607 Ang D15.OD2 and L43.CD2 other bump:2.76557 Ang D15.C and L43.CD1 other bump:1.73614 Ang D15.O and L43.CD1 other bump:2.79188 Ang D15.OD1 and L43.CD1 other bump:2.34312 Ang D15.CG and L43.CG other bump:2.41345 Ang D15.OD2 and L43.CG other bump:2.13139 Ang D15.OD1 and L43.CG other bump:1.94768 Ang D15.OD1 and K39.O other bump:0.500343 Ang L14.O and K39.NZ other bump:2.52873 Ang L14.CA and K39.NZ other bump:1.14865 Ang L14.C and K39.NZ other bump:2.20145 Ang D15.CA and K39.NZ other bump:2.34434 Ang D15.C and K39.NZ other bump:1.87788 Ang D15.N and K39.NZ other bump:2.89342 Ang D13.C and K39.CE other bump:2.22774 Ang L14.N and K39.CE other bump:1.51092 Ang L14.O and K39.CE other bump:1.18933 Ang L14.CA and K39.CE other bump:2.11486 Ang L14.CB and K39.CE other bump:0.373084 Ang L14.C and K39.CE other bump:2.63342 Ang D15.CA and K39.CE other bump:1.44807 Ang D15.N and K39.CE other bump:3.02821 Ang L14.CG and K39.CD other bump:2.51902 Ang L14.O and K39.CD other bump:1.94455 Ang L14.CA and K39.CD other bump:1.51814 Ang L14.CB and K39.CD other bump:1.75693 Ang L14.C and K39.CD other bump:3.0843 Ang D15.CA and K39.CD other bump:2.10043 Ang D15.N and K39.CD other bump:2.9058 Ang L14.CB and K39.CG other bump:2.58549 Ang L14.C and K39.CG other bump:2.49827 Ang D15.CA and K39.CG other bump:2.11939 Ang D15.N and K39.CG other bump:3.04697 Ang D15.CB and K39.CG other bump:1.67603 Ang I32.O and P36.CD other bump:2.89863 Ang I32.C and P36.CD other bump:3.08794 Ang D33.C and P36.CD other bump:2.47197 Ang I32.O and P36.CG self-bump: 1.39825 Ang D33.CA and D33.CB other bump:2.45711 Ang D13.O and V17.CG2 other bump:2.68119 Ang V5.CG2 and D13.OD2 other bump:2.80762 Ang G9.C and D13.OD1 other bump:2.0717 Ang G9.O and D13.OD1 T0191 117 :EDMVVMDLIYNPLETVLLKEAKKVNAKTINGLGMLIYQGAVAFK 1gpjA 258 :SPILIIDIANPRDVEEGVENIEDVEVRTIDDLRVIARENLERRR Fragment has 22 clashes (null) has 22 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 45 residues other bump:2.83524 Ang M7.SD and L33.CD1 other bump:2.96977 Ang K20.CG and A27.CB neighbor-bump: 2.17254 Ang V17.O and L18.CB neighbor-bump: 2.59256 Ang V17.C and L18.CB other bump:1.52281 Ang V6.CG2 and E15.OE2 other bump:2.68992 Ang V6.CB and E15.OE2 other bump:2.32514 Ang V6.CG2 and E15.CD other bump:2.77381 Ang I10.CG1 and L14.CD2 other bump:1.65862 Ang I10.CD1 and L14.CD2 other bump:2.57874 Ang I10.CG2 and L14.CD1 other bump:2.87153 Ang I10.CB and L14.CG other bump:2.00364 Ang I10.CG1 and L14.CG other bump:2.74877 Ang I10.CG2 and L14.CG other bump:1.505 Ang I10.CD1 and L14.CG other bump:2.79244 Ang I10.CG1 and L14.CB other bump:2.19287 Ang I10.CD1 and L14.CB other bump:3.09048 Ang I10.CG1 and L14.CA other bump:2.23387 Ang I10.CD1 and L14.CA other bump:2.55671 Ang I10.CG1 and L14.N other bump:2.30715 Ang I10.CD1 and L14.N other bump:2.96953 Ang I10.CD1 and P13.C other bump:2.76002 Ang M7.CE and L9.CD1 Number of specific fragments= 5 total=588 Number of alignments=107 # command:# Prefix for input files set to 1ff9A/ # command:# reading script from file read-alignments.under # Reading fragments from alignment file # T0191 read from 1ff9A-T0191-fssp-global-adpstyle1.pw.a2m.gz # 1ff9A read from 1ff9A-T0191-fssp-global-adpstyle1.pw.a2m.gz # found chain 1ff9A in template set T0191 23 :DKNIVIYGAGGAARAVAFEL 1ff9A 3 :TKSVLMLGSGFVTRPTLDVL Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 22 residues other bump:2.47698 Ang I5.CD1 and L21.CD1 other bump:2.82716 Ang R15.CG and F19.CZ other bump:2.38157 Ang R15.NE and F19.CZ other bump:2.87952 Ang R15.CG and F19.CE2 other bump:2.99735 Ang R15.CD and F19.CE2 other bump:2.27429 Ang R15.NE and F19.CE2 other bump:3.12943 Ang R15.CZ and F19.CE2 other bump:2.44894 Ang V6.CG1 and Y8.OH other bump:2.57918 Ang V6.CG1 and Y8.CZ other bump:2.81169 Ang V6.CG1 and Y8.CE1 T0191 43 :AKDNNIIIANRTVEKAEALAKEI 1ff9A 24 :DSGIKVTVACRTLESAKKLSAGV Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 25 residues other bump:2.50739 Ang E18.O and K22.CG other bump:2.94247 Ang I9.CD1 and A21.CB other bump:2.39144 Ang N11.ND2 and K16.NZ other bump:2.20145 Ang N11.ND2 and K16.CE other bump:1.44098 Ang N11.ND2 and K16.CD other bump:2.27746 Ang N11.CG and K16.CD other bump:2.57192 Ang N11.OD1 and K16.CD other bump:2.17406 Ang N11.ND2 and K16.CG other bump:2.75282 Ang N11.CG and K16.CG other bump:2.80008 Ang N11.CG and K16.CB T0191 75 :EEVKFSGLDV 1ff9A 47 :QHSTPISLDV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 12 residues T0191 85 :DLDGVDIIINAT 1ff9A 65 :EVAKHDLVISLI Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:2.58717 Ang V6.CG1 and I8.O neighbor-bump: 2.44145 Ang D7.O and I8.CG2 other bump:2.8004 Ang V6.CG1 and I8.N T0191 106 :VEPIVKAEKLRE 1ff9A 81 :HATVIKSAIRQK Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:2.39354 Ang I5.O and E9.OE2 other bump:1.85571 Ang I5.C and E9.OE1 other bump:2.57732 Ang V6.CA and E9.OE1 other bump:0.955899 Ang I5.O and E9.OE1 other bump:2.75978 Ang I5.C and E9.CD other bump:1.86853 Ang I5.O and E9.CD other bump:2.98279 Ang E3.CG and K7.CE T0191 119 :MVVMDLIYNPLETVLLKEAKKVNAKTINGL 1ff9A 93 :KHVVTTSYVSPAMMELDQAAKDAGITVMNE Fragment has 27 clashes (null) has 27 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 32 residues other bump:3.0069 Ang Y9.CA and L31.CD2 other bump:2.3818 Ang T27.CG2 and N29.ND2 other bump:2.99348 Ang T27.CG2 and N29.CG other bump:2.79355 Ang K21.CD and I28.CD1 other bump:2.18137 Ang K21.CE and I28.CD1 other bump:3.19987 Ang K21.CD and I28.CG2 other bump:1.77335 Ang K21.CE and I28.CG2 other bump:1.25168 Ang K21.NZ and I28.CG2 other bump:2.41539 Ang K21.CD and I28.CG1 other bump:1.87651 Ang K21.CE and I28.CG1 other bump:2.68146 Ang K21.NZ and I28.CG1 other bump:2.2003 Ang K21.CE and I28.CB other bump:2.18065 Ang K21.NZ and I28.CB other bump:2.67921 Ang K21.NZ and I28.CA other bump:2.51036 Ang K21.NZ and I28.N other bump:2.5775 Ang K21.NZ and T27.C other bump:2.17251 Ang M2.N and K26.CE other bump:2.257 Ang G1.C and K26.CE other bump:2.47479 Ang M2.O and K26.CD neighbor-bump: 2.56904 Ang N24.C and A25.CB other bump:2.47401 Ang P11.CG and T14.OG1 other bump:3.02743 Ang P11.CD and T14.OG1 other bump:2.58451 Ang D6.CG and I8.CG2 other bump:1.4707 Ang D6.OD2 and I8.CG2 other bump:2.10743 Ang D6.OD2 and I8.CB other bump:2.70708 Ang D6.OD2 and I8.CA other bump:2.98682 Ang D6.CG and I8.N T0191 149 :GMLIYQGAVAFK 1ff9A 420 :VLAPMNSKINDP Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 13 residues self-bump: 1.38145 Ang K13.CA and K13.CB other bump:2.04041 Ang L4.CD1 and Y6.OH other bump:2.27636 Ang L4.CD1 and Y6.CZ other bump:1.72694 Ang L4.CB and Y6.CE2 other bump:2.27535 Ang L4.CG and Y6.CE2 other bump:2.10042 Ang L4.CD1 and Y6.CE2 other bump:3.11238 Ang L4.CA and Y6.CE2 other bump:2.88144 Ang L4.C and Y6.CD2 other bump:2.14012 Ang L4.CB and Y6.CD2 other bump:2.98155 Ang L4.CA and Y6.CD2 Number of specific fragments= 7 total=595 Number of alignments=108 # Reading fragments from alignment file # T0191 read from 1ff9A-T0191-fssp-global-adpstyle5.pw.a2m.gz # 1ff9A read from 1ff9A-T0191-fssp-global-adpstyle5.pw.a2m.gz # found chain 1ff9A in template set T0191 23 :DKNIVIYGAGGAARAVAFELAKD 1ff9A 3 :TKSVLMLGSGFVTRPTLDVLTDS Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 25 residues other bump:2.47698 Ang I5.CD1 and L21.CD1 other bump:2.82716 Ang R15.CG and F19.CZ other bump:2.38157 Ang R15.NE and F19.CZ other bump:2.87952 Ang R15.CG and F19.CE2 other bump:2.99735 Ang R15.CD and F19.CE2 other bump:2.27429 Ang R15.NE and F19.CE2 other bump:3.12943 Ang R15.CZ and F19.CE2 other bump:2.44894 Ang V6.CG1 and Y8.OH other bump:2.57918 Ang V6.CG1 and Y8.CZ other bump:2.81169 Ang V6.CG1 and Y8.CE1 T0191 46 :NNIIIANRTVEKAEALAKEI 1ff9A 27 :IKVTVACRTLESAKKLSAGV Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 22 residues other bump:2.50739 Ang E15.O and K19.CG other bump:2.94247 Ang I6.CD1 and A18.CB other bump:2.39144 Ang N8.ND2 and K13.NZ other bump:2.20145 Ang N8.ND2 and K13.CE other bump:2.27746 Ang N8.CG and K13.CD other bump:1.44098 Ang N8.ND2 and K13.CD other bump:2.57192 Ang N8.OD1 and K13.CD other bump:2.75282 Ang N8.CG and K13.CG other bump:2.17406 Ang N8.ND2 and K13.CG other bump:2.80008 Ang N8.CG and K13.CB T0191 75 :EEVKFSG 1ff9A 47 :QHSTPIS Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 9 residues T0191 82 :LDVDLDGVDIIINAT 1ff9A 62 :LDAEVAKHDLVISLI Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 17 residues other bump:2.58717 Ang V9.CG1 and I11.O neighbor-bump: 2.44145 Ang D10.O and I11.CG2 other bump:2.8004 Ang V9.CG1 and I11.N T0191 106 :VEPIVKAEKLR 1ff9A 81 :HATVIKSAIRQ Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 13 residues other bump:2.39354 Ang I5.O and E9.OE2 other bump:0.955899 Ang I5.O and E9.OE1 other bump:1.85571 Ang I5.C and E9.OE1 other bump:2.57732 Ang V6.CA and E9.OE1 other bump:1.86853 Ang I5.O and E9.CD other bump:2.75978 Ang I5.C and E9.CD other bump:2.98279 Ang E3.CG and K7.CE T0191 118 :DMVVMDLIYNPLETVLL 1ff9A 92 :KKHVVTTSYVSPAMMEL Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 19 residues other bump:2.47401 Ang P12.CG and T15.OG1 other bump:3.02743 Ang P12.CD and T15.OG1 other bump:2.58451 Ang D7.CG and I9.CG2 other bump:1.4707 Ang D7.OD2 and I9.CG2 other bump:2.10743 Ang D7.OD2 and I9.CB other bump:2.70708 Ang D7.OD2 and I9.CA other bump:2.98682 Ang D7.CG and I9.N T0191 135 :KEAKKVNAKTING 1ff9A 110 :QAAKDAGITVMNE Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues T0191 148 :LG 1ff9A 125 :LD Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues T0191 150 :ML 1ff9A 129 :ID Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues T0191 152 :IY 1ff9A 352 :EG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues T0191 154 :QG 1ff9A 394 :AM Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues T0191 156 :A 1ff9A 414 :T Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 3 residues Number of specific fragments= 12 total=607 Number of alignments=109 # Reading fragments from alignment file # T0191 read from 1ff9A-T0191-local-adpstyle1.pw.a2m.gz # 1ff9A read from 1ff9A-T0191-local-adpstyle1.pw.a2m.gz # found chain 1ff9A in template set T0191 24 :KNIVIYGAGGAARAVAFELAKDN 1ff9A 4 :KSVLMLGSGFVTRPTLDVLTDSG Fragment has 14 clashes (null) has 14 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 25 residues other bump:1.39572 Ang L20.O and D23.OD2 other bump:2.48796 Ang L20.C and D23.OD2 other bump:2.37155 Ang L20.O and D23.CG other bump:3.21368 Ang L20.C and D23.CG other bump:2.47698 Ang I4.CD1 and L20.CD1 other bump:2.82716 Ang R14.CG and F18.CZ other bump:2.38157 Ang R14.NE and F18.CZ other bump:2.87952 Ang R14.CG and F18.CE2 other bump:2.99735 Ang R14.CD and F18.CE2 other bump:2.27429 Ang R14.NE and F18.CE2 other bump:3.12943 Ang R14.CZ and F18.CE2 other bump:2.44894 Ang V5.CG1 and Y7.OH other bump:2.57918 Ang V5.CG1 and Y7.CZ other bump:2.81169 Ang V5.CG1 and Y7.CE1 T0191 47 :NIIIANRTVEKAEALAKEIA 1ff9A 28 :KVTVACRTLESAKKLSAGVQ Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 22 residues other bump:2.50739 Ang E14.O and K18.CG other bump:2.94247 Ang I5.CD1 and A17.CB other bump:2.39144 Ang N7.ND2 and K12.NZ other bump:2.20145 Ang N7.ND2 and K12.CE other bump:1.44098 Ang N7.ND2 and K12.CD other bump:2.27746 Ang N7.CG and K12.CD other bump:2.57192 Ang N7.OD1 and K12.CD other bump:2.17406 Ang N7.ND2 and K12.CG other bump:2.75282 Ang N7.CG and K12.CG other bump:2.80008 Ang N7.CG and K12.CB T0191 68 :KLNKKFGEEVKFSGLDVDLDGVDIIINAT 1ff9A 48 :HSTPISLDVNDDAALDAEVAKHDLVISLI Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 31 residues other bump:2.58717 Ang V23.CG1 and I25.O neighbor-bump: 2.44145 Ang D24.O and I25.CG2 other bump:2.8004 Ang V23.CG1 and I25.N other bump:2.75038 Ang E10.OE1 and L16.CD1 T0191 105 :DVEPIVKAEKLREDMVVMDLIYNP 1ff9A 81 :HATVIKSAIRQKKHVVTTSYVSPA Fragment has 13 clashes (null) has 13 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 26 residues neighbor-bump: 1.91618 Ang N24.ND2 and P25.CD self-bump: 1.38941 Ang N24.CA and N24.CB other bump:2.84708 Ang D2.CG and D20.OD2 other bump:3.00628 Ang V18.CG1 and D20.CB other bump:2.76959 Ang V18.CG1 and D20.N other bump:2.59984 Ang I6.CG1 and M16.CE other bump:3.24629 Ang I6.CD1 and M16.SD other bump:2.51855 Ang I6.CG1 and M16.SD other bump:3.00296 Ang D2.C and P5.CD other bump:1.51824 Ang G1.O and P5.CD other bump:2.73363 Ang G1.C and P5.CD other bump:2.10884 Ang G1.O and P5.CG other bump:3.15324 Ang G1.C and P5.CG T0191 130 :ETVLLKEAKKVNAKTINGLGM 1ff9A 105 :MMELDQAAKDAGITVMNEIGL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 23 residues Number of specific fragments= 5 total=612 Number of alignments=110 # Reading fragments from alignment file # T0191 read from 1ff9A-T0191-local-adpstyle5.pw.a2m.gz # 1ff9A read from 1ff9A-T0191-local-adpstyle5.pw.a2m.gz # found chain 1ff9A in template set T0191 24 :KNIVIYGAGGAARAVAFELAKD 1ff9A 4 :KSVLMLGSGFVTRPTLDVLTDS Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 24 residues other bump:2.47698 Ang I4.CD1 and L20.CD1 other bump:2.82716 Ang R14.CG and F18.CZ other bump:2.38157 Ang R14.NE and F18.CZ other bump:2.87952 Ang R14.CG and F18.CE2 other bump:2.99735 Ang R14.CD and F18.CE2 other bump:2.27429 Ang R14.NE and F18.CE2 other bump:3.12943 Ang R14.CZ and F18.CE2 other bump:2.44894 Ang V5.CG1 and Y7.OH other bump:2.57918 Ang V5.CG1 and Y7.CZ other bump:2.81169 Ang V5.CG1 and Y7.CE1 T0191 46 :NNIIIANRTVEKAEALAKEIA 1ff9A 27 :IKVTVACRTLESAKKLSAGVQ Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 23 residues other bump:2.50739 Ang E15.O and K19.CG other bump:2.94247 Ang I6.CD1 and A18.CB other bump:2.39144 Ang N8.ND2 and K13.NZ other bump:2.20145 Ang N8.ND2 and K13.CE other bump:2.27746 Ang N8.CG and K13.CD other bump:1.44098 Ang N8.ND2 and K13.CD other bump:2.57192 Ang N8.OD1 and K13.CD other bump:2.75282 Ang N8.CG and K13.CG other bump:2.17406 Ang N8.ND2 and K13.CG other bump:2.80008 Ang N8.CG and K13.CB T0191 68 :KLNKKFGEEVKFSGLDVDLDGVDIIINAT 1ff9A 48 :HSTPISLDVNDDAALDAEVAKHDLVISLI Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 31 residues other bump:2.58717 Ang V23.CG1 and I25.O neighbor-bump: 2.44145 Ang D24.O and I25.CG2 other bump:2.8004 Ang V23.CG1 and I25.N other bump:2.75038 Ang E10.OE1 and L16.CD1 T0191 105 :DVEPIVKAEKLREDMVVMDLIYNP 1ff9A 81 :HATVIKSAIRQKKHVVTTSYVSPA Fragment has 13 clashes (null) has 13 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 26 residues neighbor-bump: 1.91618 Ang N24.ND2 and P25.CD self-bump: 1.38941 Ang N24.CA and N24.CB other bump:2.84708 Ang D2.CG and D20.OD2 other bump:3.00628 Ang V18.CG1 and D20.CB other bump:2.76959 Ang V18.CG1 and D20.N other bump:2.59984 Ang I6.CG1 and M16.CE other bump:3.24629 Ang I6.CD1 and M16.SD other bump:2.51855 Ang I6.CG1 and M16.SD other bump:3.00296 Ang D2.C and P5.CD other bump:1.51824 Ang G1.O and P5.CD other bump:2.73363 Ang G1.C and P5.CD other bump:2.10884 Ang G1.O and P5.CG other bump:3.15324 Ang G1.C and P5.CG T0191 130 :ETVLLKEAKKVNAKTINGLG 1ff9A 105 :MMELDQAAKDAGITVMNEIG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 22 residues Number of specific fragments= 5 total=617 Number of alignments=111 # Reading fragments from alignment file # T0191 read from 1ff9A-T0191-vit-adpstyle1.pw.a2m.gz # 1ff9A read from 1ff9A-T0191-vit-adpstyle1.pw.a2m.gz # found chain 1ff9A in template set T0191 24 :KNIVIYGAGGAARAVAFELAKDN 1ff9A 4 :KSVLMLGSGFVTRPTLDVLTDSG Fragment has 14 clashes (null) has 14 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 25 residues other bump:1.39572 Ang L20.O and D23.OD2 other bump:2.48796 Ang L20.C and D23.OD2 other bump:2.37155 Ang L20.O and D23.CG other bump:3.21368 Ang L20.C and D23.CG other bump:2.47698 Ang I4.CD1 and L20.CD1 other bump:2.82716 Ang R14.CG and F18.CZ other bump:2.38157 Ang R14.NE and F18.CZ other bump:2.87952 Ang R14.CG and F18.CE2 other bump:2.99735 Ang R14.CD and F18.CE2 other bump:2.27429 Ang R14.NE and F18.CE2 other bump:3.12943 Ang R14.CZ and F18.CE2 other bump:2.44894 Ang V5.CG1 and Y7.OH other bump:2.57918 Ang V5.CG1 and Y7.CZ other bump:2.81169 Ang V5.CG1 and Y7.CE1 T0191 47 :NIIIANRTVEKAEALAKEIA 1ff9A 28 :KVTVACRTLESAKKLSAGVQ Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 22 residues other bump:2.50739 Ang E14.O and K18.CG other bump:2.94247 Ang I5.CD1 and A17.CB other bump:2.39144 Ang N7.ND2 and K12.NZ other bump:2.20145 Ang N7.ND2 and K12.CE other bump:1.44098 Ang N7.ND2 and K12.CD other bump:2.27746 Ang N7.CG and K12.CD other bump:2.57192 Ang N7.OD1 and K12.CD other bump:2.17406 Ang N7.ND2 and K12.CG other bump:2.75282 Ang N7.CG and K12.CG other bump:2.80008 Ang N7.CG and K12.CB T0191 68 :KLNKKFGEEVKFSGLDVDLDGVDIIINAT 1ff9A 48 :HSTPISLDVNDDAALDAEVAKHDLVISLI Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 31 residues other bump:2.58717 Ang V23.CG1 and I25.O neighbor-bump: 2.44145 Ang D24.O and I25.CG2 other bump:2.8004 Ang V23.CG1 and I25.N other bump:2.75038 Ang E10.OE1 and L16.CD1 T0191 105 :DVEPIVKAEKLREDMVVMDLIYNP 1ff9A 81 :HATVIKSAIRQKKHVVTTSYVSPA Fragment has 13 clashes (null) has 13 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 26 residues neighbor-bump: 1.91618 Ang N24.ND2 and P25.CD self-bump: 1.38941 Ang N24.CA and N24.CB other bump:2.84708 Ang D2.CG and D20.OD2 other bump:3.00628 Ang V18.CG1 and D20.CB other bump:2.76959 Ang V18.CG1 and D20.N other bump:2.59984 Ang I6.CG1 and M16.CE other bump:3.24629 Ang I6.CD1 and M16.SD other bump:2.51855 Ang I6.CG1 and M16.SD other bump:3.00296 Ang D2.C and P5.CD other bump:1.51824 Ang G1.O and P5.CD other bump:2.73363 Ang G1.C and P5.CD other bump:2.10884 Ang G1.O and P5.CG other bump:3.15324 Ang G1.C and P5.CG T0191 130 :ETVLLKEAKKVNAKTINGLGM 1ff9A 105 :MMELDQAAKDAGITVMNEIGL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 23 residues Number of specific fragments= 5 total=622 Number of alignments=112 # Reading fragments from alignment file # T0191 read from 1ff9A-T0191-vit-adpstyle5.pw.a2m.gz # 1ff9A read from 1ff9A-T0191-vit-adpstyle5.pw.a2m.gz # found chain 1ff9A in template set T0191 24 :KNIVIYGAGGAARAVAFELAKD 1ff9A 4 :KSVLMLGSGFVTRPTLDVLTDS Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 24 residues other bump:2.47698 Ang I4.CD1 and L20.CD1 other bump:2.82716 Ang R14.CG and F18.CZ other bump:2.38157 Ang R14.NE and F18.CZ other bump:2.87952 Ang R14.CG and F18.CE2 other bump:2.99735 Ang R14.CD and F18.CE2 other bump:2.27429 Ang R14.NE and F18.CE2 other bump:3.12943 Ang R14.CZ and F18.CE2 other bump:2.44894 Ang V5.CG1 and Y7.OH other bump:2.57918 Ang V5.CG1 and Y7.CZ other bump:2.81169 Ang V5.CG1 and Y7.CE1 T0191 46 :NNIIIANRTVEKAEALAKEIA 1ff9A 27 :IKVTVACRTLESAKKLSAGVQ Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 23 residues other bump:2.50739 Ang E15.O and K19.CG other bump:2.94247 Ang I6.CD1 and A18.CB other bump:2.39144 Ang N8.ND2 and K13.NZ other bump:2.20145 Ang N8.ND2 and K13.CE other bump:2.27746 Ang N8.CG and K13.CD other bump:1.44098 Ang N8.ND2 and K13.CD other bump:2.57192 Ang N8.OD1 and K13.CD other bump:2.75282 Ang N8.CG and K13.CG other bump:2.17406 Ang N8.ND2 and K13.CG other bump:2.80008 Ang N8.CG and K13.CB T0191 68 :KLNKKFGEEVKFSGLDVDLDGVDIIINAT 1ff9A 48 :HSTPISLDVNDDAALDAEVAKHDLVISLI Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 31 residues other bump:2.58717 Ang V23.CG1 and I25.O neighbor-bump: 2.44145 Ang D24.O and I25.CG2 other bump:2.8004 Ang V23.CG1 and I25.N other bump:2.75038 Ang E10.OE1 and L16.CD1 T0191 105 :DVEPIVKAEKLREDMVVMDLIYNP 1ff9A 81 :HATVIKSAIRQKKHVVTTSYVSPA Fragment has 13 clashes (null) has 13 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 26 residues neighbor-bump: 1.91618 Ang N24.ND2 and P25.CD self-bump: 1.38941 Ang N24.CA and N24.CB other bump:2.84708 Ang D2.CG and D20.OD2 other bump:3.00628 Ang V18.CG1 and D20.CB other bump:2.76959 Ang V18.CG1 and D20.N other bump:2.59984 Ang I6.CG1 and M16.CE other bump:3.24629 Ang I6.CD1 and M16.SD other bump:2.51855 Ang I6.CG1 and M16.SD other bump:3.00296 Ang D2.C and P5.CD other bump:1.51824 Ang G1.O and P5.CD other bump:2.73363 Ang G1.C and P5.CD other bump:2.10884 Ang G1.O and P5.CG other bump:3.15324 Ang G1.C and P5.CG T0191 130 :ETVLLKEAKKVNAKTINGLG 1ff9A 105 :MMELDQAAKDAGITVMNEIG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 22 residues Number of specific fragments= 5 total=627 Number of alignments=113 # Reading fragments from alignment file # T0191 read from T0191-1ff9A-2track-protein-EBGHSTL-global-adpstyle1.pw.a2m.gz # 1ff9A read from T0191-1ff9A-2track-protein-EBGHSTL-global-adpstyle1.pw.a2m.gz # found chain 1ff9A in template set T0191 23 :DKNIVIYGAGGAARAVAFELAK 1ff9A 3 :TKSVLMLGSGFVTRPTLDVLTD Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 24 residues other bump:2.47698 Ang I5.CD1 and L21.CD1 other bump:2.82716 Ang R15.CG and F19.CZ other bump:2.38157 Ang R15.NE and F19.CZ other bump:2.87952 Ang R15.CG and F19.CE2 other bump:2.99735 Ang R15.CD and F19.CE2 other bump:2.27429 Ang R15.NE and F19.CE2 other bump:3.12943 Ang R15.CZ and F19.CE2 other bump:2.44894 Ang V6.CG1 and Y8.OH other bump:2.57918 Ang V6.CG1 and Y8.CZ other bump:2.81169 Ang V6.CG1 and Y8.CE1 T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKK 1ff9A 26 :GIKVTVACRTLESAKKLSAGVQHSTPIS Fragment has 33 clashes (null) has 33 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 30 residues other bump:3.08149 Ang T11.C and K29.CD other bump:2.61092 Ang R10.O and K29.CD other bump:2.96438 Ang T11.CA and K29.CD other bump:2.72308 Ang V12.N and K29.CD other bump:2.85131 Ang V12.N and K29.CG other bump:2.1743 Ang V12.CG2 and K29.CG other bump:2.31532 Ang I7.CG1 and N27.OD1 other bump:2.59361 Ang I7.CD1 and N27.OD1 other bump:2.4925 Ang A19.CB and N27.OD1 other bump:2.5622 Ang A19.CB and N27.ND2 other bump:2.84903 Ang A19.CB and N27.CG other bump:2.50901 Ang A15.O and N27.CG other bump:2.93406 Ang A15.C and N27.CG other bump:2.70886 Ang I7.CB and K25.NZ other bump:1.44641 Ang I7.CG1 and K25.NZ other bump:1.84148 Ang I7.CD1 and K25.NZ other bump:2.44083 Ang A19.CB and K25.NZ other bump:2.59486 Ang I7.CG1 and K25.CE other bump:1.96902 Ang I7.CD1 and K25.CE other bump:2.3557 Ang A19.CA and K25.CE other bump:1.50683 Ang A19.CB and K25.CE other bump:2.579 Ang A19.CA and K25.CD other bump:1.92171 Ang A19.CB and K25.CD other bump:2.50739 Ang E16.O and K20.CG other bump:2.94247 Ang I7.CD1 and A19.CB other bump:2.39144 Ang N9.ND2 and K14.NZ other bump:2.20145 Ang N9.ND2 and K14.CE other bump:1.44098 Ang N9.ND2 and K14.CD other bump:2.27746 Ang N9.CG and K14.CD other bump:2.57192 Ang N9.OD1 and K14.CD other bump:2.17406 Ang N9.ND2 and K14.CG other bump:2.75282 Ang N9.CG and K14.CG other bump:2.80008 Ang N9.CG and K14.CB T0191 74 :GEEVKFSGLDVDLDGVDIIINAT 1ff9A 54 :LDVNDDAALDAEVAKHDLVISLI Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 25 residues other bump:2.58717 Ang V17.CG1 and I19.O neighbor-bump: 2.44145 Ang D18.O and I19.CG2 other bump:2.8004 Ang V17.CG1 and I19.N other bump:2.75038 Ang E4.OE1 and L10.CD1 T0191 101 :YP 1ff9A 81 :HA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues T0191 108 :PIVKAEKLREDMVVMDLIYNPLETVLLKEAKKVNAKTINGL 1ff9A 83 :TVIKSAIRQKKHVVTTSYVSPAMMELDQAAKDAGITVMNEI Fragment has 34 clashes (null) has 34 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 43 residues other bump:3.03577 Ang M16.SD and N40.OD1 other bump:2.11026 Ang Y20.CD1 and N40.ND2 other bump:0.90171 Ang Y20.CE1 and N40.ND2 other bump:3.1025 Ang Y20.CE2 and N40.ND2 other bump:1.83973 Ang Y20.CZ and N40.ND2 other bump:2.3193 Ang Y20.OH and N40.ND2 other bump:2.66217 Ang Y20.CD1 and N40.CG other bump:1.70604 Ang Y20.CE1 and N40.CG other bump:2.6386 Ang Y20.OH and N40.CG other bump:3.03911 Ang Y20.CD1 and N40.CB other bump:2.28734 Ang Y20.CE1 and N40.CB other bump:2.93095 Ang Y20.CE2 and N40.CB other bump:2.21507 Ang Y20.CZ and N40.CB other bump:2.55247 Ang Y20.OH and N40.CB other bump:2.91574 Ang Y20.CZ and N40.CA other bump:2.51191 Ang Y20.OH and N40.CA other bump:2.70621 Ang Y20.CZ and N40.N other bump:1.65958 Ang Y20.OH and N40.N other bump:2.63681 Ang Y20.OH and I39.C other bump:2.6489 Ang K8.NZ and L27.CD2 other bump:2.87968 Ang K8.NZ and L27.CD1 other bump:2.30564 Ang K8.NZ and L27.CG other bump:2.76483 Ang K8.CE and L27.CB other bump:1.42576 Ang K8.NZ and L27.CB other bump:2.4554 Ang K8.NZ and L27.CA other bump:2.54715 Ang P22.O and V26.CG2 other bump:2.88229 Ang M16.CE and L18.CD1 other bump:2.76847 Ang E7.CG and V14.CG2 other bump:2.39354 Ang I3.O and E7.OE2 other bump:0.955899 Ang I3.O and E7.OE1 other bump:1.85571 Ang I3.C and E7.OE1 other bump:2.57732 Ang V4.CA and E7.OE1 other bump:1.86853 Ang I3.O and E7.CD other bump:2.75978 Ang I3.C and E7.CD T0191 149 :GMLIYQGAVAF 1ff9A 131 :HLYAIKTIEEV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 13 residues Number of specific fragments= 6 total=633 Number of alignments=114 # Reading fragments from alignment file # T0191 read from T0191-1ff9A-2track-protein-EBGHSTL-global-adpstyle5.pw.a2m.gz # 1ff9A read from T0191-1ff9A-2track-protein-EBGHSTL-global-adpstyle5.pw.a2m.gz # found chain 1ff9A in template set T0191 23 :DKNIVIYGAGGAARAVAFELAK 1ff9A 3 :TKSVLMLGSGFVTRPTLDVLTD Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 24 residues other bump:2.47698 Ang I5.CD1 and L21.CD1 other bump:2.82716 Ang R15.CG and F19.CZ other bump:2.38157 Ang R15.NE and F19.CZ other bump:2.87952 Ang R15.CG and F19.CE2 other bump:2.99735 Ang R15.CD and F19.CE2 other bump:2.27429 Ang R15.NE and F19.CE2 other bump:3.12943 Ang R15.CZ and F19.CE2 other bump:2.44894 Ang V6.CG1 and Y8.OH other bump:2.57918 Ang V6.CG1 and Y8.CZ other bump:2.81169 Ang V6.CG1 and Y8.CE1 T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKK 1ff9A 26 :GIKVTVACRTLESAKKLSAGVQHSTPIS Fragment has 33 clashes (null) has 33 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 30 residues other bump:3.08149 Ang T11.C and K29.CD other bump:2.61092 Ang R10.O and K29.CD other bump:2.96438 Ang T11.CA and K29.CD other bump:2.72308 Ang V12.N and K29.CD other bump:2.85131 Ang V12.N and K29.CG other bump:2.1743 Ang V12.CG2 and K29.CG other bump:2.31532 Ang I7.CG1 and N27.OD1 other bump:2.59361 Ang I7.CD1 and N27.OD1 other bump:2.4925 Ang A19.CB and N27.OD1 other bump:2.5622 Ang A19.CB and N27.ND2 other bump:2.84903 Ang A19.CB and N27.CG other bump:2.50901 Ang A15.O and N27.CG other bump:2.93406 Ang A15.C and N27.CG other bump:2.70886 Ang I7.CB and K25.NZ other bump:1.44641 Ang I7.CG1 and K25.NZ other bump:1.84148 Ang I7.CD1 and K25.NZ other bump:2.44083 Ang A19.CB and K25.NZ other bump:2.59486 Ang I7.CG1 and K25.CE other bump:1.96902 Ang I7.CD1 and K25.CE other bump:2.3557 Ang A19.CA and K25.CE other bump:1.50683 Ang A19.CB and K25.CE other bump:2.579 Ang A19.CA and K25.CD other bump:1.92171 Ang A19.CB and K25.CD other bump:2.50739 Ang E16.O and K20.CG other bump:2.94247 Ang I7.CD1 and A19.CB other bump:2.39144 Ang N9.ND2 and K14.NZ other bump:2.20145 Ang N9.ND2 and K14.CE other bump:1.44098 Ang N9.ND2 and K14.CD other bump:2.27746 Ang N9.CG and K14.CD other bump:2.57192 Ang N9.OD1 and K14.CD other bump:2.17406 Ang N9.ND2 and K14.CG other bump:2.75282 Ang N9.CG and K14.CG other bump:2.80008 Ang N9.CG and K14.CB T0191 74 :GEEVKFSGLDVDLDGVDIIINAT 1ff9A 54 :LDVNDDAALDAEVAKHDLVISLI Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 25 residues other bump:2.58717 Ang V17.CG1 and I19.O neighbor-bump: 2.44145 Ang D18.O and I19.CG2 other bump:2.8004 Ang V17.CG1 and I19.N other bump:2.75038 Ang E4.OE1 and L10.CD1 T0191 101 :YP 1ff9A 81 :HA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues T0191 108 :PIVKAEKLREDMVVMDLIYNPLETVLLKEAKKVNAKTIN 1ff9A 83 :TVIKSAIRQKKHVVTTSYVSPAMMELDQAAKDAGITVMN Fragment has 34 clashes (null) has 34 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 41 residues other bump:3.03577 Ang M16.SD and N40.OD1 other bump:2.11026 Ang Y20.CD1 and N40.ND2 other bump:0.90171 Ang Y20.CE1 and N40.ND2 other bump:3.1025 Ang Y20.CE2 and N40.ND2 other bump:1.83973 Ang Y20.CZ and N40.ND2 other bump:2.3193 Ang Y20.OH and N40.ND2 other bump:2.66217 Ang Y20.CD1 and N40.CG other bump:1.70604 Ang Y20.CE1 and N40.CG other bump:2.6386 Ang Y20.OH and N40.CG other bump:3.03911 Ang Y20.CD1 and N40.CB other bump:2.28734 Ang Y20.CE1 and N40.CB other bump:2.93095 Ang Y20.CE2 and N40.CB other bump:2.21507 Ang Y20.CZ and N40.CB other bump:2.55247 Ang Y20.OH and N40.CB other bump:2.91574 Ang Y20.CZ and N40.CA other bump:2.51191 Ang Y20.OH and N40.CA other bump:2.70621 Ang Y20.CZ and N40.N other bump:1.65958 Ang Y20.OH and N40.N other bump:2.63681 Ang Y20.OH and I39.C other bump:2.6489 Ang K8.NZ and L27.CD2 other bump:2.87968 Ang K8.NZ and L27.CD1 other bump:2.30564 Ang K8.NZ and L27.CG other bump:2.76483 Ang K8.CE and L27.CB other bump:1.42576 Ang K8.NZ and L27.CB other bump:2.4554 Ang K8.NZ and L27.CA other bump:2.54715 Ang P22.O and V26.CG2 other bump:2.88229 Ang M16.CE and L18.CD1 other bump:2.76847 Ang E7.CG and V14.CG2 other bump:2.39354 Ang I3.O and E7.OE2 other bump:0.955899 Ang I3.O and E7.OE1 other bump:1.85571 Ang I3.C and E7.OE1 other bump:2.57732 Ang V4.CA and E7.OE1 other bump:1.86853 Ang I3.O and E7.CD other bump:2.75978 Ang I3.C and E7.CD T0191 147 :GLGMLIY 1ff9A 128 :GIDHLYA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 9 residues T0191 154 :QGAV 1ff9A 136 :KTIE Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 6 residues Number of specific fragments= 7 total=640 Number of alignments=115 # Reading fragments from alignment file # T0191 read from T0191-1ff9A-2track-protein-EBGHSTL-local-adpstyle1.pw.a2m.gz # 1ff9A read from T0191-1ff9A-2track-protein-EBGHSTL-local-adpstyle1.pw.a2m.gz # found chain 1ff9A in template set T0191 24 :KNIVIYGAGGAARAVAFELAK 1ff9A 4 :KSVLMLGSGFVTRPTLDVLTD Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 23 residues other bump:2.47698 Ang I4.CD1 and L20.CD1 other bump:2.82716 Ang R14.CG and F18.CZ other bump:2.38157 Ang R14.NE and F18.CZ other bump:2.87952 Ang R14.CG and F18.CE2 other bump:2.99735 Ang R14.CD and F18.CE2 other bump:2.27429 Ang R14.NE and F18.CE2 other bump:3.12943 Ang R14.CZ and F18.CE2 other bump:2.44894 Ang V5.CG1 and Y7.OH other bump:2.57918 Ang V5.CG1 and Y7.CZ other bump:2.81169 Ang V5.CG1 and Y7.CE1 T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKK 1ff9A 26 :GIKVTVACRTLESAKKLSAGVQHSTPIS Fragment has 33 clashes (null) has 33 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 30 residues other bump:3.08149 Ang T11.C and K29.CD other bump:2.61092 Ang R10.O and K29.CD other bump:2.96438 Ang T11.CA and K29.CD other bump:2.72308 Ang V12.N and K29.CD other bump:2.85131 Ang V12.N and K29.CG other bump:2.1743 Ang V12.CG2 and K29.CG other bump:2.31532 Ang I7.CG1 and N27.OD1 other bump:2.59361 Ang I7.CD1 and N27.OD1 other bump:2.4925 Ang A19.CB and N27.OD1 other bump:2.5622 Ang A19.CB and N27.ND2 other bump:2.84903 Ang A19.CB and N27.CG other bump:2.50901 Ang A15.O and N27.CG other bump:2.93406 Ang A15.C and N27.CG other bump:2.70886 Ang I7.CB and K25.NZ other bump:1.44641 Ang I7.CG1 and K25.NZ other bump:1.84148 Ang I7.CD1 and K25.NZ other bump:2.44083 Ang A19.CB and K25.NZ other bump:2.59486 Ang I7.CG1 and K25.CE other bump:1.96902 Ang I7.CD1 and K25.CE other bump:2.3557 Ang A19.CA and K25.CE other bump:1.50683 Ang A19.CB and K25.CE other bump:2.579 Ang A19.CA and K25.CD other bump:1.92171 Ang A19.CB and K25.CD other bump:2.50739 Ang E16.O and K20.CG other bump:2.94247 Ang I7.CD1 and A19.CB other bump:2.39144 Ang N9.ND2 and K14.NZ other bump:2.20145 Ang N9.ND2 and K14.CE other bump:1.44098 Ang N9.ND2 and K14.CD other bump:2.27746 Ang N9.CG and K14.CD other bump:2.57192 Ang N9.OD1 and K14.CD other bump:2.17406 Ang N9.ND2 and K14.CG other bump:2.75282 Ang N9.CG and K14.CG other bump:2.80008 Ang N9.CG and K14.CB T0191 74 :GEEVKFSGLDVDLDGVDIIINAT 1ff9A 54 :LDVNDDAALDAEVAKHDLVISLI Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 25 residues other bump:2.58717 Ang V17.CG1 and I19.O neighbor-bump: 2.44145 Ang D18.O and I19.CG2 other bump:2.8004 Ang V17.CG1 and I19.N other bump:2.75038 Ang E4.OE1 and L10.CD1 T0191 101 :YP 1ff9A 81 :HA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues T0191 108 :PIVKAEKLREDMVVMDLIYNPLETVLLKEAKKVNAKTINGLG 1ff9A 83 :TVIKSAIRQKKHVVTTSYVSPAMMELDQAAKDAGITVMNEIG Fragment has 34 clashes (null) has 34 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 44 residues other bump:3.03577 Ang M16.SD and N40.OD1 other bump:2.11026 Ang Y20.CD1 and N40.ND2 other bump:0.90171 Ang Y20.CE1 and N40.ND2 other bump:3.1025 Ang Y20.CE2 and N40.ND2 other bump:1.83973 Ang Y20.CZ and N40.ND2 other bump:2.3193 Ang Y20.OH and N40.ND2 other bump:2.66217 Ang Y20.CD1 and N40.CG other bump:1.70604 Ang Y20.CE1 and N40.CG other bump:2.6386 Ang Y20.OH and N40.CG other bump:3.03911 Ang Y20.CD1 and N40.CB other bump:2.28734 Ang Y20.CE1 and N40.CB other bump:2.93095 Ang Y20.CE2 and N40.CB other bump:2.21507 Ang Y20.CZ and N40.CB other bump:2.55247 Ang Y20.OH and N40.CB other bump:2.91574 Ang Y20.CZ and N40.CA other bump:2.51191 Ang Y20.OH and N40.CA other bump:2.70621 Ang Y20.CZ and N40.N other bump:1.65958 Ang Y20.OH and N40.N other bump:2.63681 Ang Y20.OH and I39.C other bump:2.6489 Ang K8.NZ and L27.CD2 other bump:2.87968 Ang K8.NZ and L27.CD1 other bump:2.30564 Ang K8.NZ and L27.CG other bump:2.76483 Ang K8.CE and L27.CB other bump:1.42576 Ang K8.NZ and L27.CB other bump:2.4554 Ang K8.NZ and L27.CA other bump:2.54715 Ang P22.O and V26.CG2 other bump:2.88229 Ang M16.CE and L18.CD1 other bump:2.76847 Ang E7.CG and V14.CG2 other bump:2.39354 Ang I3.O and E7.OE2 other bump:0.955899 Ang I3.O and E7.OE1 other bump:1.85571 Ang I3.C and E7.OE1 other bump:2.57732 Ang V4.CA and E7.OE1 other bump:1.86853 Ang I3.O and E7.CD other bump:2.75978 Ang I3.C and E7.CD Number of specific fragments= 5 total=645 Number of alignments=116 # Reading fragments from alignment file # T0191 read from T0191-1ff9A-2track-protein-EBGHSTL-local-adpstyle5.pw.a2m.gz # 1ff9A read from T0191-1ff9A-2track-protein-EBGHSTL-local-adpstyle5.pw.a2m.gz # found chain 1ff9A in template set T0191 24 :KNIVIYGAGGAARAVAFELAK 1ff9A 4 :KSVLMLGSGFVTRPTLDVLTD Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 23 residues other bump:2.47698 Ang I4.CD1 and L20.CD1 other bump:2.82716 Ang R14.CG and F18.CZ other bump:2.38157 Ang R14.NE and F18.CZ other bump:2.87952 Ang R14.CG and F18.CE2 other bump:2.99735 Ang R14.CD and F18.CE2 other bump:2.27429 Ang R14.NE and F18.CE2 other bump:3.12943 Ang R14.CZ and F18.CE2 other bump:2.44894 Ang V5.CG1 and Y7.OH other bump:2.57918 Ang V5.CG1 and Y7.CZ other bump:2.81169 Ang V5.CG1 and Y7.CE1 T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKK 1ff9A 26 :GIKVTVACRTLESAKKLSAGVQHSTPIS Fragment has 33 clashes (null) has 33 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 30 residues other bump:3.08149 Ang T11.C and K29.CD other bump:2.61092 Ang R10.O and K29.CD other bump:2.96438 Ang T11.CA and K29.CD other bump:2.72308 Ang V12.N and K29.CD other bump:2.85131 Ang V12.N and K29.CG other bump:2.1743 Ang V12.CG2 and K29.CG other bump:2.31532 Ang I7.CG1 and N27.OD1 other bump:2.59361 Ang I7.CD1 and N27.OD1 other bump:2.4925 Ang A19.CB and N27.OD1 other bump:2.5622 Ang A19.CB and N27.ND2 other bump:2.84903 Ang A19.CB and N27.CG other bump:2.50901 Ang A15.O and N27.CG other bump:2.93406 Ang A15.C and N27.CG other bump:2.70886 Ang I7.CB and K25.NZ other bump:1.44641 Ang I7.CG1 and K25.NZ other bump:1.84148 Ang I7.CD1 and K25.NZ other bump:2.44083 Ang A19.CB and K25.NZ other bump:2.59486 Ang I7.CG1 and K25.CE other bump:1.96902 Ang I7.CD1 and K25.CE other bump:2.3557 Ang A19.CA and K25.CE other bump:1.50683 Ang A19.CB and K25.CE other bump:2.579 Ang A19.CA and K25.CD other bump:1.92171 Ang A19.CB and K25.CD other bump:2.50739 Ang E16.O and K20.CG other bump:2.94247 Ang I7.CD1 and A19.CB other bump:2.39144 Ang N9.ND2 and K14.NZ other bump:2.20145 Ang N9.ND2 and K14.CE other bump:1.44098 Ang N9.ND2 and K14.CD other bump:2.27746 Ang N9.CG and K14.CD other bump:2.57192 Ang N9.OD1 and K14.CD other bump:2.17406 Ang N9.ND2 and K14.CG other bump:2.75282 Ang N9.CG and K14.CG other bump:2.80008 Ang N9.CG and K14.CB T0191 74 :GEEVKFSGLDVDLDGVDIIINAT 1ff9A 54 :LDVNDDAALDAEVAKHDLVISLI Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 25 residues other bump:2.58717 Ang V17.CG1 and I19.O neighbor-bump: 2.44145 Ang D18.O and I19.CG2 other bump:2.8004 Ang V17.CG1 and I19.N other bump:2.75038 Ang E4.OE1 and L10.CD1 T0191 101 :YP 1ff9A 81 :HA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues T0191 108 :PIVKAEKLREDMVVMDLIYNPLETVLLKEAKKVNAKTINGL 1ff9A 83 :TVIKSAIRQKKHVVTTSYVSPAMMELDQAAKDAGITVMNEI Fragment has 34 clashes (null) has 34 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 43 residues other bump:3.03577 Ang M16.SD and N40.OD1 other bump:2.11026 Ang Y20.CD1 and N40.ND2 other bump:0.90171 Ang Y20.CE1 and N40.ND2 other bump:3.1025 Ang Y20.CE2 and N40.ND2 other bump:1.83973 Ang Y20.CZ and N40.ND2 other bump:2.3193 Ang Y20.OH and N40.ND2 other bump:2.66217 Ang Y20.CD1 and N40.CG other bump:1.70604 Ang Y20.CE1 and N40.CG other bump:2.6386 Ang Y20.OH and N40.CG other bump:3.03911 Ang Y20.CD1 and N40.CB other bump:2.28734 Ang Y20.CE1 and N40.CB other bump:2.93095 Ang Y20.CE2 and N40.CB other bump:2.21507 Ang Y20.CZ and N40.CB other bump:2.55247 Ang Y20.OH and N40.CB other bump:2.91574 Ang Y20.CZ and N40.CA other bump:2.51191 Ang Y20.OH and N40.CA other bump:2.70621 Ang Y20.CZ and N40.N other bump:1.65958 Ang Y20.OH and N40.N other bump:2.63681 Ang Y20.OH and I39.C other bump:2.6489 Ang K8.NZ and L27.CD2 other bump:2.87968 Ang K8.NZ and L27.CD1 other bump:2.30564 Ang K8.NZ and L27.CG other bump:2.76483 Ang K8.CE and L27.CB other bump:1.42576 Ang K8.NZ and L27.CB other bump:2.4554 Ang K8.NZ and L27.CA other bump:2.54715 Ang P22.O and V26.CG2 other bump:2.88229 Ang M16.CE and L18.CD1 other bump:2.76847 Ang E7.CG and V14.CG2 other bump:2.39354 Ang I3.O and E7.OE2 other bump:0.955899 Ang I3.O and E7.OE1 other bump:1.85571 Ang I3.C and E7.OE1 other bump:2.57732 Ang V4.CA and E7.OE1 other bump:1.86853 Ang I3.O and E7.CD other bump:2.75978 Ang I3.C and E7.CD Number of specific fragments= 5 total=650 Number of alignments=117 # Reading fragments from alignment file # T0191 read from T0191-1ff9A-2track-protein-EBGHTL-global-adpstyle1.pw.a2m.gz # 1ff9A read from T0191-1ff9A-2track-protein-EBGHTL-global-adpstyle1.pw.a2m.gz # found chain 1ff9A in template set T0191 23 :DKNIVIYGAGGAARAVAFELAK 1ff9A 3 :TKSVLMLGSGFVTRPTLDVLTD Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 24 residues other bump:2.47698 Ang I5.CD1 and L21.CD1 other bump:2.82716 Ang R15.CG and F19.CZ other bump:2.38157 Ang R15.NE and F19.CZ other bump:2.87952 Ang R15.CG and F19.CE2 other bump:2.99735 Ang R15.CD and F19.CE2 other bump:2.27429 Ang R15.NE and F19.CE2 other bump:3.12943 Ang R15.CZ and F19.CE2 other bump:2.44894 Ang V6.CG1 and Y8.OH other bump:2.57918 Ang V6.CG1 and Y8.CZ other bump:2.81169 Ang V6.CG1 and Y8.CE1 T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKK 1ff9A 26 :GIKVTVACRTLESAKKLSAGVQHSTPIS Fragment has 33 clashes (null) has 33 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 30 residues other bump:3.08149 Ang T11.C and K29.CD other bump:2.61092 Ang R10.O and K29.CD other bump:2.96438 Ang T11.CA and K29.CD other bump:2.72308 Ang V12.N and K29.CD other bump:2.85131 Ang V12.N and K29.CG other bump:2.1743 Ang V12.CG2 and K29.CG other bump:2.31532 Ang I7.CG1 and N27.OD1 other bump:2.59361 Ang I7.CD1 and N27.OD1 other bump:2.4925 Ang A19.CB and N27.OD1 other bump:2.5622 Ang A19.CB and N27.ND2 other bump:2.84903 Ang A19.CB and N27.CG other bump:2.50901 Ang A15.O and N27.CG other bump:2.93406 Ang A15.C and N27.CG other bump:2.70886 Ang I7.CB and K25.NZ other bump:1.44641 Ang I7.CG1 and K25.NZ other bump:1.84148 Ang I7.CD1 and K25.NZ other bump:2.44083 Ang A19.CB and K25.NZ other bump:2.59486 Ang I7.CG1 and K25.CE other bump:1.96902 Ang I7.CD1 and K25.CE other bump:2.3557 Ang A19.CA and K25.CE other bump:1.50683 Ang A19.CB and K25.CE other bump:2.579 Ang A19.CA and K25.CD other bump:1.92171 Ang A19.CB and K25.CD other bump:2.50739 Ang E16.O and K20.CG other bump:2.94247 Ang I7.CD1 and A19.CB other bump:2.39144 Ang N9.ND2 and K14.NZ other bump:2.20145 Ang N9.ND2 and K14.CE other bump:1.44098 Ang N9.ND2 and K14.CD other bump:2.27746 Ang N9.CG and K14.CD other bump:2.57192 Ang N9.OD1 and K14.CD other bump:2.17406 Ang N9.ND2 and K14.CG other bump:2.75282 Ang N9.CG and K14.CG other bump:2.80008 Ang N9.CG and K14.CB T0191 74 :GEEVKFSGLDVDLDGVDIIINAT 1ff9A 54 :LDVNDDAALDAEVAKHDLVISLI Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 25 residues other bump:2.58717 Ang V17.CG1 and I19.O neighbor-bump: 2.44145 Ang D18.O and I19.CG2 other bump:2.8004 Ang V17.CG1 and I19.N other bump:2.75038 Ang E4.OE1 and L10.CD1 T0191 101 :YP 1ff9A 81 :HA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues T0191 108 :PIVKAEKLREDMVVMDLIYNPLETVLLKEAKKVNAKTI 1ff9A 83 :TVIKSAIRQKKHVVTTSYVSPAMMELDQAAKDAGITVM Fragment has 20 clashes (null) has 20 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 40 residues other bump:2.91574 Ang Y20.CZ and G40.CA other bump:2.51191 Ang Y20.OH and G40.CA other bump:2.70621 Ang Y20.CZ and G40.N other bump:1.65958 Ang Y20.OH and G40.N other bump:2.63681 Ang Y20.OH and I39.C other bump:2.6489 Ang K8.NZ and L27.CD2 other bump:2.87968 Ang K8.NZ and L27.CD1 other bump:2.30564 Ang K8.NZ and L27.CG other bump:2.76483 Ang K8.CE and L27.CB other bump:1.42576 Ang K8.NZ and L27.CB other bump:2.4554 Ang K8.NZ and L27.CA other bump:2.54715 Ang P22.O and V26.CG2 other bump:2.88229 Ang M16.CE and L18.CD1 other bump:2.76847 Ang E7.CG and V14.CG2 other bump:2.39354 Ang I3.O and E7.OE2 other bump:0.955899 Ang I3.O and E7.OE1 other bump:1.85571 Ang I3.C and E7.OE1 other bump:2.57732 Ang V4.CA and E7.OE1 other bump:1.86853 Ang I3.O and E7.CD other bump:2.75978 Ang I3.C and E7.CD T0191 146 :NGLGMLIYQGAVAF 1ff9A 127 :PGIDHLYAIKTIEE Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 16 residues Number of specific fragments= 6 total=656 Number of alignments=118 # Reading fragments from alignment file # T0191 read from T0191-1ff9A-2track-protein-EBGHTL-global-adpstyle5.pw.a2m.gz # 1ff9A read from T0191-1ff9A-2track-protein-EBGHTL-global-adpstyle5.pw.a2m.gz # found chain 1ff9A in template set T0191 23 :DKNIVIYGAGGAARAVAFELAK 1ff9A 3 :TKSVLMLGSGFVTRPTLDVLTD Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 24 residues other bump:2.47698 Ang I5.CD1 and L21.CD1 other bump:2.82716 Ang R15.CG and F19.CZ other bump:2.38157 Ang R15.NE and F19.CZ other bump:2.87952 Ang R15.CG and F19.CE2 other bump:2.99735 Ang R15.CD and F19.CE2 other bump:2.27429 Ang R15.NE and F19.CE2 other bump:3.12943 Ang R15.CZ and F19.CE2 other bump:2.44894 Ang V6.CG1 and Y8.OH other bump:2.57918 Ang V6.CG1 and Y8.CZ other bump:2.81169 Ang V6.CG1 and Y8.CE1 T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKK 1ff9A 26 :GIKVTVACRTLESAKKLSAGVQHSTPIS Fragment has 33 clashes (null) has 33 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 30 residues other bump:3.08149 Ang T11.C and K29.CD other bump:2.61092 Ang R10.O and K29.CD other bump:2.96438 Ang T11.CA and K29.CD other bump:2.72308 Ang V12.N and K29.CD other bump:2.85131 Ang V12.N and K29.CG other bump:2.1743 Ang V12.CG2 and K29.CG other bump:2.31532 Ang I7.CG1 and N27.OD1 other bump:2.59361 Ang I7.CD1 and N27.OD1 other bump:2.4925 Ang A19.CB and N27.OD1 other bump:2.5622 Ang A19.CB and N27.ND2 other bump:2.84903 Ang A19.CB and N27.CG other bump:2.50901 Ang A15.O and N27.CG other bump:2.93406 Ang A15.C and N27.CG other bump:2.70886 Ang I7.CB and K25.NZ other bump:1.44641 Ang I7.CG1 and K25.NZ other bump:1.84148 Ang I7.CD1 and K25.NZ other bump:2.44083 Ang A19.CB and K25.NZ other bump:2.59486 Ang I7.CG1 and K25.CE other bump:1.96902 Ang I7.CD1 and K25.CE other bump:2.3557 Ang A19.CA and K25.CE other bump:1.50683 Ang A19.CB and K25.CE other bump:2.579 Ang A19.CA and K25.CD other bump:1.92171 Ang A19.CB and K25.CD other bump:2.50739 Ang E16.O and K20.CG other bump:2.94247 Ang I7.CD1 and A19.CB other bump:2.39144 Ang N9.ND2 and K14.NZ other bump:2.20145 Ang N9.ND2 and K14.CE other bump:1.44098 Ang N9.ND2 and K14.CD other bump:2.27746 Ang N9.CG and K14.CD other bump:2.57192 Ang N9.OD1 and K14.CD other bump:2.17406 Ang N9.ND2 and K14.CG other bump:2.75282 Ang N9.CG and K14.CG other bump:2.80008 Ang N9.CG and K14.CB T0191 74 :GEEVKFSGLDVDLDGVDIIINAT 1ff9A 54 :LDVNDDAALDAEVAKHDLVISLI Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 25 residues other bump:2.58717 Ang V17.CG1 and I19.O neighbor-bump: 2.44145 Ang D18.O and I19.CG2 other bump:2.8004 Ang V17.CG1 and I19.N other bump:2.75038 Ang E4.OE1 and L10.CD1 T0191 101 :YP 1ff9A 81 :HA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues T0191 108 :PIVKAEKLREDMVVMDLIYNPLETVLLKEAKKVNAKTIN 1ff9A 83 :TVIKSAIRQKKHVVTTSYVSPAMMELDQAAKDAGITVMN Fragment has 34 clashes (null) has 34 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 41 residues other bump:3.03577 Ang M16.SD and N40.OD1 other bump:2.11026 Ang Y20.CD1 and N40.ND2 other bump:0.90171 Ang Y20.CE1 and N40.ND2 other bump:3.1025 Ang Y20.CE2 and N40.ND2 other bump:1.83973 Ang Y20.CZ and N40.ND2 other bump:2.3193 Ang Y20.OH and N40.ND2 other bump:2.66217 Ang Y20.CD1 and N40.CG other bump:1.70604 Ang Y20.CE1 and N40.CG other bump:2.6386 Ang Y20.OH and N40.CG other bump:3.03911 Ang Y20.CD1 and N40.CB other bump:2.28734 Ang Y20.CE1 and N40.CB other bump:2.93095 Ang Y20.CE2 and N40.CB other bump:2.21507 Ang Y20.CZ and N40.CB other bump:2.55247 Ang Y20.OH and N40.CB other bump:2.91574 Ang Y20.CZ and N40.CA other bump:2.51191 Ang Y20.OH and N40.CA other bump:2.70621 Ang Y20.CZ and N40.N other bump:1.65958 Ang Y20.OH and N40.N other bump:2.63681 Ang Y20.OH and I39.C other bump:2.6489 Ang K8.NZ and L27.CD2 other bump:2.87968 Ang K8.NZ and L27.CD1 other bump:2.30564 Ang K8.NZ and L27.CG other bump:2.76483 Ang K8.CE and L27.CB other bump:1.42576 Ang K8.NZ and L27.CB other bump:2.4554 Ang K8.NZ and L27.CA other bump:2.54715 Ang P22.O and V26.CG2 other bump:2.88229 Ang M16.CE and L18.CD1 other bump:2.76847 Ang E7.CG and V14.CG2 other bump:2.39354 Ang I3.O and E7.OE2 other bump:0.955899 Ang I3.O and E7.OE1 other bump:1.85571 Ang I3.C and E7.OE1 other bump:2.57732 Ang V4.CA and E7.OE1 other bump:1.86853 Ang I3.O and E7.CD other bump:2.75978 Ang I3.C and E7.CD T0191 147 :GLGMLIYQGAVA 1ff9A 128 :GIDHLYAIKTIE Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues Number of specific fragments= 6 total=662 Number of alignments=119 # Reading fragments from alignment file # T0191 read from T0191-1ff9A-2track-protein-EBGHTL-local-adpstyle1.pw.a2m.gz # 1ff9A read from T0191-1ff9A-2track-protein-EBGHTL-local-adpstyle1.pw.a2m.gz # found chain 1ff9A in template set T0191 24 :KNIVIYGAGGAARAVAFELAK 1ff9A 4 :KSVLMLGSGFVTRPTLDVLTD Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 23 residues other bump:2.47698 Ang I4.CD1 and L20.CD1 other bump:2.82716 Ang R14.CG and F18.CZ other bump:2.38157 Ang R14.NE and F18.CZ other bump:2.87952 Ang R14.CG and F18.CE2 other bump:2.99735 Ang R14.CD and F18.CE2 other bump:2.27429 Ang R14.NE and F18.CE2 other bump:3.12943 Ang R14.CZ and F18.CE2 other bump:2.44894 Ang V5.CG1 and Y7.OH other bump:2.57918 Ang V5.CG1 and Y7.CZ other bump:2.81169 Ang V5.CG1 and Y7.CE1 T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKK 1ff9A 26 :GIKVTVACRTLESAKKLSAGVQHSTPIS Fragment has 33 clashes (null) has 33 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 30 residues other bump:3.08149 Ang T11.C and K29.CD other bump:2.61092 Ang R10.O and K29.CD other bump:2.96438 Ang T11.CA and K29.CD other bump:2.72308 Ang V12.N and K29.CD other bump:2.85131 Ang V12.N and K29.CG other bump:2.1743 Ang V12.CG2 and K29.CG other bump:2.31532 Ang I7.CG1 and N27.OD1 other bump:2.59361 Ang I7.CD1 and N27.OD1 other bump:2.4925 Ang A19.CB and N27.OD1 other bump:2.5622 Ang A19.CB and N27.ND2 other bump:2.84903 Ang A19.CB and N27.CG other bump:2.50901 Ang A15.O and N27.CG other bump:2.93406 Ang A15.C and N27.CG other bump:2.70886 Ang I7.CB and K25.NZ other bump:1.44641 Ang I7.CG1 and K25.NZ other bump:1.84148 Ang I7.CD1 and K25.NZ other bump:2.44083 Ang A19.CB and K25.NZ other bump:2.59486 Ang I7.CG1 and K25.CE other bump:1.96902 Ang I7.CD1 and K25.CE other bump:2.3557 Ang A19.CA and K25.CE other bump:1.50683 Ang A19.CB and K25.CE other bump:2.579 Ang A19.CA and K25.CD other bump:1.92171 Ang A19.CB and K25.CD other bump:2.50739 Ang E16.O and K20.CG other bump:2.94247 Ang I7.CD1 and A19.CB other bump:2.39144 Ang N9.ND2 and K14.NZ other bump:2.20145 Ang N9.ND2 and K14.CE other bump:1.44098 Ang N9.ND2 and K14.CD other bump:2.27746 Ang N9.CG and K14.CD other bump:2.57192 Ang N9.OD1 and K14.CD other bump:2.17406 Ang N9.ND2 and K14.CG other bump:2.75282 Ang N9.CG and K14.CG other bump:2.80008 Ang N9.CG and K14.CB T0191 74 :GEEVKFSGLDVDLDGVDIIINAT 1ff9A 54 :LDVNDDAALDAEVAKHDLVISLI Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 25 residues other bump:2.58717 Ang V17.CG1 and I19.O neighbor-bump: 2.44145 Ang D18.O and I19.CG2 other bump:2.8004 Ang V17.CG1 and I19.N other bump:2.75038 Ang E4.OE1 and L10.CD1 T0191 101 :YP 1ff9A 81 :HA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues T0191 108 :PIVKAEKLREDMVVMDLIYNPLETVLLKEAKKVNAKTIN 1ff9A 83 :TVIKSAIRQKKHVVTTSYVSPAMMELDQAAKDAGITVMN Fragment has 34 clashes (null) has 34 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 41 residues other bump:3.03577 Ang M16.SD and N40.OD1 other bump:2.11026 Ang Y20.CD1 and N40.ND2 other bump:0.90171 Ang Y20.CE1 and N40.ND2 other bump:3.1025 Ang Y20.CE2 and N40.ND2 other bump:1.83973 Ang Y20.CZ and N40.ND2 other bump:2.3193 Ang Y20.OH and N40.ND2 other bump:2.66217 Ang Y20.CD1 and N40.CG other bump:1.70604 Ang Y20.CE1 and N40.CG other bump:2.6386 Ang Y20.OH and N40.CG other bump:3.03911 Ang Y20.CD1 and N40.CB other bump:2.28734 Ang Y20.CE1 and N40.CB other bump:2.93095 Ang Y20.CE2 and N40.CB other bump:2.21507 Ang Y20.CZ and N40.CB other bump:2.55247 Ang Y20.OH and N40.CB other bump:2.91574 Ang Y20.CZ and N40.CA other bump:2.51191 Ang Y20.OH and N40.CA other bump:2.70621 Ang Y20.CZ and N40.N other bump:1.65958 Ang Y20.OH and N40.N other bump:2.63681 Ang Y20.OH and I39.C other bump:2.6489 Ang K8.NZ and L27.CD2 other bump:2.87968 Ang K8.NZ and L27.CD1 other bump:2.30564 Ang K8.NZ and L27.CG other bump:2.76483 Ang K8.CE and L27.CB other bump:1.42576 Ang K8.NZ and L27.CB other bump:2.4554 Ang K8.NZ and L27.CA other bump:2.54715 Ang P22.O and V26.CG2 other bump:2.88229 Ang M16.CE and L18.CD1 other bump:2.76847 Ang E7.CG and V14.CG2 other bump:2.39354 Ang I3.O and E7.OE2 other bump:0.955899 Ang I3.O and E7.OE1 other bump:1.85571 Ang I3.C and E7.OE1 other bump:2.57732 Ang V4.CA and E7.OE1 other bump:1.86853 Ang I3.O and E7.CD other bump:2.75978 Ang I3.C and E7.CD Number of specific fragments= 5 total=667 Number of alignments=120 # Reading fragments from alignment file # T0191 read from T0191-1ff9A-2track-protein-EBGHTL-local-adpstyle5.pw.a2m.gz # 1ff9A read from T0191-1ff9A-2track-protein-EBGHTL-local-adpstyle5.pw.a2m.gz # found chain 1ff9A in template set T0191 24 :KNIVIYGAGGAARAVAFELAK 1ff9A 4 :KSVLMLGSGFVTRPTLDVLTD Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 23 residues other bump:2.47698 Ang I4.CD1 and L20.CD1 other bump:2.82716 Ang R14.CG and F18.CZ other bump:2.38157 Ang R14.NE and F18.CZ other bump:2.87952 Ang R14.CG and F18.CE2 other bump:2.99735 Ang R14.CD and F18.CE2 other bump:2.27429 Ang R14.NE and F18.CE2 other bump:3.12943 Ang R14.CZ and F18.CE2 other bump:2.44894 Ang V5.CG1 and Y7.OH other bump:2.57918 Ang V5.CG1 and Y7.CZ other bump:2.81169 Ang V5.CG1 and Y7.CE1 T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKK 1ff9A 26 :GIKVTVACRTLESAKKLSAGVQHSTPIS Fragment has 33 clashes (null) has 33 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 30 residues other bump:3.08149 Ang T11.C and K29.CD other bump:2.61092 Ang R10.O and K29.CD other bump:2.96438 Ang T11.CA and K29.CD other bump:2.72308 Ang V12.N and K29.CD other bump:2.85131 Ang V12.N and K29.CG other bump:2.1743 Ang V12.CG2 and K29.CG other bump:2.31532 Ang I7.CG1 and N27.OD1 other bump:2.59361 Ang I7.CD1 and N27.OD1 other bump:2.4925 Ang A19.CB and N27.OD1 other bump:2.5622 Ang A19.CB and N27.ND2 other bump:2.84903 Ang A19.CB and N27.CG other bump:2.50901 Ang A15.O and N27.CG other bump:2.93406 Ang A15.C and N27.CG other bump:2.70886 Ang I7.CB and K25.NZ other bump:1.44641 Ang I7.CG1 and K25.NZ other bump:1.84148 Ang I7.CD1 and K25.NZ other bump:2.44083 Ang A19.CB and K25.NZ other bump:2.59486 Ang I7.CG1 and K25.CE other bump:1.96902 Ang I7.CD1 and K25.CE other bump:2.3557 Ang A19.CA and K25.CE other bump:1.50683 Ang A19.CB and K25.CE other bump:2.579 Ang A19.CA and K25.CD other bump:1.92171 Ang A19.CB and K25.CD other bump:2.50739 Ang E16.O and K20.CG other bump:2.94247 Ang I7.CD1 and A19.CB other bump:2.39144 Ang N9.ND2 and K14.NZ other bump:2.20145 Ang N9.ND2 and K14.CE other bump:1.44098 Ang N9.ND2 and K14.CD other bump:2.27746 Ang N9.CG and K14.CD other bump:2.57192 Ang N9.OD1 and K14.CD other bump:2.17406 Ang N9.ND2 and K14.CG other bump:2.75282 Ang N9.CG and K14.CG other bump:2.80008 Ang N9.CG and K14.CB T0191 74 :GEEVKFSGLDVDLDGVDIIINAT 1ff9A 54 :LDVNDDAALDAEVAKHDLVISLI Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 25 residues other bump:2.58717 Ang V17.CG1 and I19.O neighbor-bump: 2.44145 Ang D18.O and I19.CG2 other bump:2.8004 Ang V17.CG1 and I19.N other bump:2.75038 Ang E4.OE1 and L10.CD1 T0191 101 :YP 1ff9A 81 :HA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues T0191 108 :PIVKAEKLREDMVVMDLIYNPLETVLLKEAKKVNAKTING 1ff9A 83 :TVIKSAIRQKKHVVTTSYVSPAMMELDQAAKDAGITVMNE Fragment has 34 clashes (null) has 34 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 42 residues other bump:3.03577 Ang M16.SD and N40.OD1 other bump:2.11026 Ang Y20.CD1 and N40.ND2 other bump:0.90171 Ang Y20.CE1 and N40.ND2 other bump:3.1025 Ang Y20.CE2 and N40.ND2 other bump:1.83973 Ang Y20.CZ and N40.ND2 other bump:2.3193 Ang Y20.OH and N40.ND2 other bump:2.66217 Ang Y20.CD1 and N40.CG other bump:1.70604 Ang Y20.CE1 and N40.CG other bump:2.6386 Ang Y20.OH and N40.CG other bump:3.03911 Ang Y20.CD1 and N40.CB other bump:2.28734 Ang Y20.CE1 and N40.CB other bump:2.93095 Ang Y20.CE2 and N40.CB other bump:2.21507 Ang Y20.CZ and N40.CB other bump:2.55247 Ang Y20.OH and N40.CB other bump:2.91574 Ang Y20.CZ and N40.CA other bump:2.51191 Ang Y20.OH and N40.CA other bump:2.70621 Ang Y20.CZ and N40.N other bump:1.65958 Ang Y20.OH and N40.N other bump:2.63681 Ang Y20.OH and I39.C other bump:2.6489 Ang K8.NZ and L27.CD2 other bump:2.87968 Ang K8.NZ and L27.CD1 other bump:2.30564 Ang K8.NZ and L27.CG other bump:2.76483 Ang K8.CE and L27.CB other bump:1.42576 Ang K8.NZ and L27.CB other bump:2.4554 Ang K8.NZ and L27.CA other bump:2.54715 Ang P22.O and V26.CG2 other bump:2.88229 Ang M16.CE and L18.CD1 other bump:2.76847 Ang E7.CG and V14.CG2 other bump:2.39354 Ang I3.O and E7.OE2 other bump:0.955899 Ang I3.O and E7.OE1 other bump:1.85571 Ang I3.C and E7.OE1 other bump:2.57732 Ang V4.CA and E7.OE1 other bump:1.86853 Ang I3.O and E7.CD other bump:2.75978 Ang I3.C and E7.CD Number of specific fragments= 5 total=672 Number of alignments=121 # Reading fragments from alignment file # T0191 read from T0191-1ff9A-2track-protein-STR-global-adpstyle1.pw.a2m.gz # 1ff9A read from T0191-1ff9A-2track-protein-STR-global-adpstyle1.pw.a2m.gz # found chain 1ff9A in template set T0191 23 :DKNIVIYGAGGAARAVAFELAK 1ff9A 3 :TKSVLMLGSGFVTRPTLDVLTD Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 24 residues other bump:2.47698 Ang I5.CD1 and L21.CD1 other bump:2.82716 Ang R15.CG and F19.CZ other bump:2.38157 Ang R15.NE and F19.CZ other bump:2.87952 Ang R15.CG and F19.CE2 other bump:2.99735 Ang R15.CD and F19.CE2 other bump:2.27429 Ang R15.NE and F19.CE2 other bump:3.12943 Ang R15.CZ and F19.CE2 other bump:2.44894 Ang V6.CG1 and Y8.OH other bump:2.57918 Ang V6.CG1 and Y8.CZ other bump:2.81169 Ang V6.CG1 and Y8.CE1 T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKK 1ff9A 26 :GIKVTVACRTLESAKKLSAGVQHSTPIS Fragment has 33 clashes (null) has 33 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 30 residues other bump:3.08149 Ang T11.C and K29.CD other bump:2.61092 Ang R10.O and K29.CD other bump:2.96438 Ang T11.CA and K29.CD other bump:2.72308 Ang V12.N and K29.CD other bump:2.85131 Ang V12.N and K29.CG other bump:2.1743 Ang V12.CG2 and K29.CG other bump:2.31532 Ang I7.CG1 and N27.OD1 other bump:2.59361 Ang I7.CD1 and N27.OD1 other bump:2.4925 Ang A19.CB and N27.OD1 other bump:2.5622 Ang A19.CB and N27.ND2 other bump:2.84903 Ang A19.CB and N27.CG other bump:2.50901 Ang A15.O and N27.CG other bump:2.93406 Ang A15.C and N27.CG other bump:2.70886 Ang I7.CB and K25.NZ other bump:1.44641 Ang I7.CG1 and K25.NZ other bump:1.84148 Ang I7.CD1 and K25.NZ other bump:2.44083 Ang A19.CB and K25.NZ other bump:2.59486 Ang I7.CG1 and K25.CE other bump:1.96902 Ang I7.CD1 and K25.CE other bump:2.3557 Ang A19.CA and K25.CE other bump:1.50683 Ang A19.CB and K25.CE other bump:2.579 Ang A19.CA and K25.CD other bump:1.92171 Ang A19.CB and K25.CD other bump:2.50739 Ang E16.O and K20.CG other bump:2.94247 Ang I7.CD1 and A19.CB other bump:2.39144 Ang N9.ND2 and K14.NZ other bump:2.20145 Ang N9.ND2 and K14.CE other bump:1.44098 Ang N9.ND2 and K14.CD other bump:2.27746 Ang N9.CG and K14.CD other bump:2.57192 Ang N9.OD1 and K14.CD other bump:2.17406 Ang N9.ND2 and K14.CG other bump:2.75282 Ang N9.CG and K14.CG other bump:2.80008 Ang N9.CG and K14.CB T0191 74 :GEEVKFSGLDVDLDGVDIIINAT 1ff9A 54 :LDVNDDAALDAEVAKHDLVISLI Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 25 residues other bump:2.58717 Ang V17.CG1 and I19.O neighbor-bump: 2.44145 Ang D18.O and I19.CG2 other bump:2.8004 Ang V17.CG1 and I19.N other bump:2.75038 Ang E4.OE1 and L10.CD1 T0191 101 :YP 1ff9A 81 :HA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues T0191 108 :PIVKAEKLREDMVVMDLIYNPLETVLLKEAKKVNAKTINGL 1ff9A 83 :TVIKSAIRQKKHVVTTSYVSPAMMELDQAAKDAGITVMNEI Fragment has 34 clashes (null) has 34 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 43 residues other bump:3.03577 Ang M16.SD and N40.OD1 other bump:2.11026 Ang Y20.CD1 and N40.ND2 other bump:0.90171 Ang Y20.CE1 and N40.ND2 other bump:3.1025 Ang Y20.CE2 and N40.ND2 other bump:1.83973 Ang Y20.CZ and N40.ND2 other bump:2.3193 Ang Y20.OH and N40.ND2 other bump:2.66217 Ang Y20.CD1 and N40.CG other bump:1.70604 Ang Y20.CE1 and N40.CG other bump:2.6386 Ang Y20.OH and N40.CG other bump:3.03911 Ang Y20.CD1 and N40.CB other bump:2.28734 Ang Y20.CE1 and N40.CB other bump:2.93095 Ang Y20.CE2 and N40.CB other bump:2.21507 Ang Y20.CZ and N40.CB other bump:2.55247 Ang Y20.OH and N40.CB other bump:2.91574 Ang Y20.CZ and N40.CA other bump:2.51191 Ang Y20.OH and N40.CA other bump:2.70621 Ang Y20.CZ and N40.N other bump:1.65958 Ang Y20.OH and N40.N other bump:2.63681 Ang Y20.OH and I39.C other bump:2.6489 Ang K8.NZ and L27.CD2 other bump:2.87968 Ang K8.NZ and L27.CD1 other bump:2.30564 Ang K8.NZ and L27.CG other bump:2.76483 Ang K8.CE and L27.CB other bump:1.42576 Ang K8.NZ and L27.CB other bump:2.4554 Ang K8.NZ and L27.CA other bump:2.54715 Ang P22.O and V26.CG2 other bump:2.88229 Ang M16.CE and L18.CD1 other bump:2.76847 Ang E7.CG and V14.CG2 other bump:2.39354 Ang I3.O and E7.OE2 other bump:0.955899 Ang I3.O and E7.OE1 other bump:1.85571 Ang I3.C and E7.OE1 other bump:2.57732 Ang V4.CA and E7.OE1 other bump:1.86853 Ang I3.O and E7.CD other bump:2.75978 Ang I3.C and E7.CD T0191 149 :GMLIYQGAVAF 1ff9A 131 :HLYAIKTIEEV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 13 residues Number of specific fragments= 6 total=678 Number of alignments=122 # Reading fragments from alignment file # T0191 read from T0191-1ff9A-2track-protein-STR-global-adpstyle5.pw.a2m.gz # 1ff9A read from T0191-1ff9A-2track-protein-STR-global-adpstyle5.pw.a2m.gz # found chain 1ff9A in template set T0191 23 :DKNIVIYGAGGAARAVAFELAK 1ff9A 3 :TKSVLMLGSGFVTRPTLDVLTD Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 24 residues other bump:2.47698 Ang I5.CD1 and L21.CD1 other bump:2.82716 Ang R15.CG and F19.CZ other bump:2.38157 Ang R15.NE and F19.CZ other bump:2.87952 Ang R15.CG and F19.CE2 other bump:2.99735 Ang R15.CD and F19.CE2 other bump:2.27429 Ang R15.NE and F19.CE2 other bump:3.12943 Ang R15.CZ and F19.CE2 other bump:2.44894 Ang V6.CG1 and Y8.OH other bump:2.57918 Ang V6.CG1 and Y8.CZ other bump:2.81169 Ang V6.CG1 and Y8.CE1 T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKK 1ff9A 26 :GIKVTVACRTLESAKKLSAGVQHSTPIS Fragment has 33 clashes (null) has 33 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 30 residues other bump:3.08149 Ang T11.C and K29.CD other bump:2.61092 Ang R10.O and K29.CD other bump:2.96438 Ang T11.CA and K29.CD other bump:2.72308 Ang V12.N and K29.CD other bump:2.85131 Ang V12.N and K29.CG other bump:2.1743 Ang V12.CG2 and K29.CG other bump:2.31532 Ang I7.CG1 and N27.OD1 other bump:2.59361 Ang I7.CD1 and N27.OD1 other bump:2.4925 Ang A19.CB and N27.OD1 other bump:2.5622 Ang A19.CB and N27.ND2 other bump:2.84903 Ang A19.CB and N27.CG other bump:2.50901 Ang A15.O and N27.CG other bump:2.93406 Ang A15.C and N27.CG other bump:2.70886 Ang I7.CB and K25.NZ other bump:1.44641 Ang I7.CG1 and K25.NZ other bump:1.84148 Ang I7.CD1 and K25.NZ other bump:2.44083 Ang A19.CB and K25.NZ other bump:2.59486 Ang I7.CG1 and K25.CE other bump:1.96902 Ang I7.CD1 and K25.CE other bump:2.3557 Ang A19.CA and K25.CE other bump:1.50683 Ang A19.CB and K25.CE other bump:2.579 Ang A19.CA and K25.CD other bump:1.92171 Ang A19.CB and K25.CD other bump:2.50739 Ang E16.O and K20.CG other bump:2.94247 Ang I7.CD1 and A19.CB other bump:2.39144 Ang N9.ND2 and K14.NZ other bump:2.20145 Ang N9.ND2 and K14.CE other bump:1.44098 Ang N9.ND2 and K14.CD other bump:2.27746 Ang N9.CG and K14.CD other bump:2.57192 Ang N9.OD1 and K14.CD other bump:2.17406 Ang N9.ND2 and K14.CG other bump:2.75282 Ang N9.CG and K14.CG other bump:2.80008 Ang N9.CG and K14.CB T0191 74 :GEEVKFSGLDVDLDGVDIIINAT 1ff9A 54 :LDVNDDAALDAEVAKHDLVISLI Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 25 residues other bump:2.58717 Ang V17.CG1 and I19.O neighbor-bump: 2.44145 Ang D18.O and I19.CG2 other bump:2.8004 Ang V17.CG1 and I19.N other bump:2.75038 Ang E4.OE1 and L10.CD1 T0191 101 :YP 1ff9A 81 :HA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues T0191 108 :PIVKAEKLREDMVVMDLIYNPLETVLLKEAKKVNAKTINGL 1ff9A 83 :TVIKSAIRQKKHVVTTSYVSPAMMELDQAAKDAGITVMNEI Fragment has 34 clashes (null) has 34 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 43 residues other bump:3.03577 Ang M16.SD and N40.OD1 other bump:2.11026 Ang Y20.CD1 and N40.ND2 other bump:0.90171 Ang Y20.CE1 and N40.ND2 other bump:3.1025 Ang Y20.CE2 and N40.ND2 other bump:1.83973 Ang Y20.CZ and N40.ND2 other bump:2.3193 Ang Y20.OH and N40.ND2 other bump:2.66217 Ang Y20.CD1 and N40.CG other bump:1.70604 Ang Y20.CE1 and N40.CG other bump:2.6386 Ang Y20.OH and N40.CG other bump:3.03911 Ang Y20.CD1 and N40.CB other bump:2.28734 Ang Y20.CE1 and N40.CB other bump:2.93095 Ang Y20.CE2 and N40.CB other bump:2.21507 Ang Y20.CZ and N40.CB other bump:2.55247 Ang Y20.OH and N40.CB other bump:2.91574 Ang Y20.CZ and N40.CA other bump:2.51191 Ang Y20.OH and N40.CA other bump:2.70621 Ang Y20.CZ and N40.N other bump:1.65958 Ang Y20.OH and N40.N other bump:2.63681 Ang Y20.OH and I39.C other bump:2.6489 Ang K8.NZ and L27.CD2 other bump:2.87968 Ang K8.NZ and L27.CD1 other bump:2.30564 Ang K8.NZ and L27.CG other bump:2.76483 Ang K8.CE and L27.CB other bump:1.42576 Ang K8.NZ and L27.CB other bump:2.4554 Ang K8.NZ and L27.CA other bump:2.54715 Ang P22.O and V26.CG2 other bump:2.88229 Ang M16.CE and L18.CD1 other bump:2.76847 Ang E7.CG and V14.CG2 other bump:2.39354 Ang I3.O and E7.OE2 other bump:0.955899 Ang I3.O and E7.OE1 other bump:1.85571 Ang I3.C and E7.OE1 other bump:2.57732 Ang V4.CA and E7.OE1 other bump:1.86853 Ang I3.O and E7.CD other bump:2.75978 Ang I3.C and E7.CD T0191 149 :G 1ff9A 130 :D Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 3 residues T0191 150 :MLIYQGAV 1ff9A 132 :LYAIKTIE Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 10 residues Number of specific fragments= 7 total=685 Number of alignments=123 # Reading fragments from alignment file # T0191 read from T0191-1ff9A-2track-protein-STR-local-adpstyle1.pw.a2m.gz # 1ff9A read from T0191-1ff9A-2track-protein-STR-local-adpstyle1.pw.a2m.gz # found chain 1ff9A in template set T0191 24 :KNIVIYGAGGAARAVAFELAK 1ff9A 4 :KSVLMLGSGFVTRPTLDVLTD Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 23 residues other bump:2.47698 Ang I4.CD1 and L20.CD1 other bump:2.82716 Ang R14.CG and F18.CZ other bump:2.38157 Ang R14.NE and F18.CZ other bump:2.87952 Ang R14.CG and F18.CE2 other bump:2.99735 Ang R14.CD and F18.CE2 other bump:2.27429 Ang R14.NE and F18.CE2 other bump:3.12943 Ang R14.CZ and F18.CE2 other bump:2.44894 Ang V5.CG1 and Y7.OH other bump:2.57918 Ang V5.CG1 and Y7.CZ other bump:2.81169 Ang V5.CG1 and Y7.CE1 T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKK 1ff9A 26 :GIKVTVACRTLESAKKLSAGVQHSTPIS Fragment has 33 clashes (null) has 33 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 30 residues other bump:3.08149 Ang T11.C and K29.CD other bump:2.61092 Ang R10.O and K29.CD other bump:2.96438 Ang T11.CA and K29.CD other bump:2.72308 Ang V12.N and K29.CD other bump:2.85131 Ang V12.N and K29.CG other bump:2.1743 Ang V12.CG2 and K29.CG other bump:2.31532 Ang I7.CG1 and N27.OD1 other bump:2.59361 Ang I7.CD1 and N27.OD1 other bump:2.4925 Ang A19.CB and N27.OD1 other bump:2.5622 Ang A19.CB and N27.ND2 other bump:2.84903 Ang A19.CB and N27.CG other bump:2.50901 Ang A15.O and N27.CG other bump:2.93406 Ang A15.C and N27.CG other bump:2.70886 Ang I7.CB and K25.NZ other bump:1.44641 Ang I7.CG1 and K25.NZ other bump:1.84148 Ang I7.CD1 and K25.NZ other bump:2.44083 Ang A19.CB and K25.NZ other bump:2.59486 Ang I7.CG1 and K25.CE other bump:1.96902 Ang I7.CD1 and K25.CE other bump:2.3557 Ang A19.CA and K25.CE other bump:1.50683 Ang A19.CB and K25.CE other bump:2.579 Ang A19.CA and K25.CD other bump:1.92171 Ang A19.CB and K25.CD other bump:2.50739 Ang E16.O and K20.CG other bump:2.94247 Ang I7.CD1 and A19.CB other bump:2.39144 Ang N9.ND2 and K14.NZ other bump:2.20145 Ang N9.ND2 and K14.CE other bump:1.44098 Ang N9.ND2 and K14.CD other bump:2.27746 Ang N9.CG and K14.CD other bump:2.57192 Ang N9.OD1 and K14.CD other bump:2.17406 Ang N9.ND2 and K14.CG other bump:2.75282 Ang N9.CG and K14.CG other bump:2.80008 Ang N9.CG and K14.CB T0191 74 :GEEVKFSGLDVDLDGVDIIINAT 1ff9A 54 :LDVNDDAALDAEVAKHDLVISLI Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 25 residues other bump:2.58717 Ang V17.CG1 and I19.O neighbor-bump: 2.44145 Ang D18.O and I19.CG2 other bump:2.8004 Ang V17.CG1 and I19.N other bump:2.75038 Ang E4.OE1 and L10.CD1 T0191 101 :YP 1ff9A 81 :HA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues T0191 108 :PIVKAEKLREDMVVMDLIYNPLETVLLKEAKKVNAKTINGLG 1ff9A 83 :TVIKSAIRQKKHVVTTSYVSPAMMELDQAAKDAGITVMNEIG Fragment has 34 clashes (null) has 34 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 44 residues other bump:3.03577 Ang M16.SD and N40.OD1 other bump:2.11026 Ang Y20.CD1 and N40.ND2 other bump:0.90171 Ang Y20.CE1 and N40.ND2 other bump:3.1025 Ang Y20.CE2 and N40.ND2 other bump:1.83973 Ang Y20.CZ and N40.ND2 other bump:2.3193 Ang Y20.OH and N40.ND2 other bump:2.66217 Ang Y20.CD1 and N40.CG other bump:1.70604 Ang Y20.CE1 and N40.CG other bump:2.6386 Ang Y20.OH and N40.CG other bump:3.03911 Ang Y20.CD1 and N40.CB other bump:2.28734 Ang Y20.CE1 and N40.CB other bump:2.93095 Ang Y20.CE2 and N40.CB other bump:2.21507 Ang Y20.CZ and N40.CB other bump:2.55247 Ang Y20.OH and N40.CB other bump:2.91574 Ang Y20.CZ and N40.CA other bump:2.51191 Ang Y20.OH and N40.CA other bump:2.70621 Ang Y20.CZ and N40.N other bump:1.65958 Ang Y20.OH and N40.N other bump:2.63681 Ang Y20.OH and I39.C other bump:2.6489 Ang K8.NZ and L27.CD2 other bump:2.87968 Ang K8.NZ and L27.CD1 other bump:2.30564 Ang K8.NZ and L27.CG other bump:2.76483 Ang K8.CE and L27.CB other bump:1.42576 Ang K8.NZ and L27.CB other bump:2.4554 Ang K8.NZ and L27.CA other bump:2.54715 Ang P22.O and V26.CG2 other bump:2.88229 Ang M16.CE and L18.CD1 other bump:2.76847 Ang E7.CG and V14.CG2 other bump:2.39354 Ang I3.O and E7.OE2 other bump:0.955899 Ang I3.O and E7.OE1 other bump:1.85571 Ang I3.C and E7.OE1 other bump:2.57732 Ang V4.CA and E7.OE1 other bump:1.86853 Ang I3.O and E7.CD other bump:2.75978 Ang I3.C and E7.CD Number of specific fragments= 5 total=690 Number of alignments=124 # Reading fragments from alignment file # T0191 read from T0191-1ff9A-2track-protein-STR-local-adpstyle5.pw.a2m.gz # 1ff9A read from T0191-1ff9A-2track-protein-STR-local-adpstyle5.pw.a2m.gz # found chain 1ff9A in template set T0191 23 :DKNIVIYGAGGAARAVAFELAK 1ff9A 3 :TKSVLMLGSGFVTRPTLDVLTD Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 24 residues other bump:2.47698 Ang I5.CD1 and L21.CD1 other bump:2.82716 Ang R15.CG and F19.CZ other bump:2.38157 Ang R15.NE and F19.CZ other bump:2.87952 Ang R15.CG and F19.CE2 other bump:2.99735 Ang R15.CD and F19.CE2 other bump:2.27429 Ang R15.NE and F19.CE2 other bump:3.12943 Ang R15.CZ and F19.CE2 other bump:2.44894 Ang V6.CG1 and Y8.OH other bump:2.57918 Ang V6.CG1 and Y8.CZ other bump:2.81169 Ang V6.CG1 and Y8.CE1 T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKK 1ff9A 26 :GIKVTVACRTLESAKKLSAGVQHSTPIS Fragment has 33 clashes (null) has 33 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 30 residues other bump:3.08149 Ang T11.C and K29.CD other bump:2.61092 Ang R10.O and K29.CD other bump:2.96438 Ang T11.CA and K29.CD other bump:2.72308 Ang V12.N and K29.CD other bump:2.85131 Ang V12.N and K29.CG other bump:2.1743 Ang V12.CG2 and K29.CG other bump:2.31532 Ang I7.CG1 and N27.OD1 other bump:2.59361 Ang I7.CD1 and N27.OD1 other bump:2.4925 Ang A19.CB and N27.OD1 other bump:2.5622 Ang A19.CB and N27.ND2 other bump:2.84903 Ang A19.CB and N27.CG other bump:2.50901 Ang A15.O and N27.CG other bump:2.93406 Ang A15.C and N27.CG other bump:2.70886 Ang I7.CB and K25.NZ other bump:1.44641 Ang I7.CG1 and K25.NZ other bump:1.84148 Ang I7.CD1 and K25.NZ other bump:2.44083 Ang A19.CB and K25.NZ other bump:2.59486 Ang I7.CG1 and K25.CE other bump:1.96902 Ang I7.CD1 and K25.CE other bump:2.3557 Ang A19.CA and K25.CE other bump:1.50683 Ang A19.CB and K25.CE other bump:2.579 Ang A19.CA and K25.CD other bump:1.92171 Ang A19.CB and K25.CD other bump:2.50739 Ang E16.O and K20.CG other bump:2.94247 Ang I7.CD1 and A19.CB other bump:2.39144 Ang N9.ND2 and K14.NZ other bump:2.20145 Ang N9.ND2 and K14.CE other bump:1.44098 Ang N9.ND2 and K14.CD other bump:2.27746 Ang N9.CG and K14.CD other bump:2.57192 Ang N9.OD1 and K14.CD other bump:2.17406 Ang N9.ND2 and K14.CG other bump:2.75282 Ang N9.CG and K14.CG other bump:2.80008 Ang N9.CG and K14.CB T0191 74 :GEEVKFSGLDVDLDGVDIIINAT 1ff9A 54 :LDVNDDAALDAEVAKHDLVISLI Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 25 residues other bump:2.58717 Ang V17.CG1 and I19.O neighbor-bump: 2.44145 Ang D18.O and I19.CG2 other bump:2.8004 Ang V17.CG1 and I19.N other bump:2.75038 Ang E4.OE1 and L10.CD1 T0191 101 :YP 1ff9A 81 :HA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues T0191 108 :PIVKAEKLREDMVVMDLIYNPLETVLLKEAKKVNAKTINGLG 1ff9A 83 :TVIKSAIRQKKHVVTTSYVSPAMMELDQAAKDAGITVMNEIG Fragment has 34 clashes (null) has 34 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 44 residues other bump:3.03577 Ang M16.SD and N40.OD1 other bump:2.11026 Ang Y20.CD1 and N40.ND2 other bump:0.90171 Ang Y20.CE1 and N40.ND2 other bump:3.1025 Ang Y20.CE2 and N40.ND2 other bump:1.83973 Ang Y20.CZ and N40.ND2 other bump:2.3193 Ang Y20.OH and N40.ND2 other bump:2.66217 Ang Y20.CD1 and N40.CG other bump:1.70604 Ang Y20.CE1 and N40.CG other bump:2.6386 Ang Y20.OH and N40.CG other bump:3.03911 Ang Y20.CD1 and N40.CB other bump:2.28734 Ang Y20.CE1 and N40.CB other bump:2.93095 Ang Y20.CE2 and N40.CB other bump:2.21507 Ang Y20.CZ and N40.CB other bump:2.55247 Ang Y20.OH and N40.CB other bump:2.91574 Ang Y20.CZ and N40.CA other bump:2.51191 Ang Y20.OH and N40.CA other bump:2.70621 Ang Y20.CZ and N40.N other bump:1.65958 Ang Y20.OH and N40.N other bump:2.63681 Ang Y20.OH and I39.C other bump:2.6489 Ang K8.NZ and L27.CD2 other bump:2.87968 Ang K8.NZ and L27.CD1 other bump:2.30564 Ang K8.NZ and L27.CG other bump:2.76483 Ang K8.CE and L27.CB other bump:1.42576 Ang K8.NZ and L27.CB other bump:2.4554 Ang K8.NZ and L27.CA other bump:2.54715 Ang P22.O and V26.CG2 other bump:2.88229 Ang M16.CE and L18.CD1 other bump:2.76847 Ang E7.CG and V14.CG2 other bump:2.39354 Ang I3.O and E7.OE2 other bump:0.955899 Ang I3.O and E7.OE1 other bump:1.85571 Ang I3.C and E7.OE1 other bump:2.57732 Ang V4.CA and E7.OE1 other bump:1.86853 Ang I3.O and E7.CD other bump:2.75978 Ang I3.C and E7.CD Number of specific fragments= 5 total=695 Number of alignments=125 # Reading fragments from alignment file # T0191 read from T0191-1ff9A-local-adpstyle1.pw.a2m.gz # 1ff9A read from T0191-1ff9A-local-adpstyle1.pw.a2m.gz # found chain 1ff9A in template set T0191 24 :KNIVIYGAGGAARAVAFELAK 1ff9A 4 :KSVLMLGSGFVTRPTLDVLTD Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 23 residues other bump:2.47698 Ang I4.CD1 and L20.CD1 other bump:2.82716 Ang R14.CG and F18.CZ other bump:2.38157 Ang R14.NE and F18.CZ other bump:2.87952 Ang R14.CG and F18.CE2 other bump:2.99735 Ang R14.CD and F18.CE2 other bump:2.27429 Ang R14.NE and F18.CE2 other bump:3.12943 Ang R14.CZ and F18.CE2 other bump:2.44894 Ang V5.CG1 and Y7.OH other bump:2.57918 Ang V5.CG1 and Y7.CZ other bump:2.81169 Ang V5.CG1 and Y7.CE1 T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKK 1ff9A 26 :GIKVTVACRTLESAKKLSAGVQHSTPIS Fragment has 33 clashes (null) has 33 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 30 residues other bump:3.08149 Ang T11.C and K29.CD other bump:2.61092 Ang R10.O and K29.CD other bump:2.96438 Ang T11.CA and K29.CD other bump:2.72308 Ang V12.N and K29.CD other bump:2.85131 Ang V12.N and K29.CG other bump:2.1743 Ang V12.CG2 and K29.CG other bump:2.31532 Ang I7.CG1 and N27.OD1 other bump:2.59361 Ang I7.CD1 and N27.OD1 other bump:2.4925 Ang A19.CB and N27.OD1 other bump:2.5622 Ang A19.CB and N27.ND2 other bump:2.84903 Ang A19.CB and N27.CG other bump:2.50901 Ang A15.O and N27.CG other bump:2.93406 Ang A15.C and N27.CG other bump:2.70886 Ang I7.CB and K25.NZ other bump:1.44641 Ang I7.CG1 and K25.NZ other bump:1.84148 Ang I7.CD1 and K25.NZ other bump:2.44083 Ang A19.CB and K25.NZ other bump:2.59486 Ang I7.CG1 and K25.CE other bump:1.96902 Ang I7.CD1 and K25.CE other bump:2.3557 Ang A19.CA and K25.CE other bump:1.50683 Ang A19.CB and K25.CE other bump:2.579 Ang A19.CA and K25.CD other bump:1.92171 Ang A19.CB and K25.CD other bump:2.50739 Ang E16.O and K20.CG other bump:2.94247 Ang I7.CD1 and A19.CB other bump:2.39144 Ang N9.ND2 and K14.NZ other bump:2.20145 Ang N9.ND2 and K14.CE other bump:1.44098 Ang N9.ND2 and K14.CD other bump:2.27746 Ang N9.CG and K14.CD other bump:2.57192 Ang N9.OD1 and K14.CD other bump:2.17406 Ang N9.ND2 and K14.CG other bump:2.75282 Ang N9.CG and K14.CG other bump:2.80008 Ang N9.CG and K14.CB T0191 74 :GEEVKFSGLDVDLDGVDIIINAT 1ff9A 54 :LDVNDDAALDAEVAKHDLVISLI Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 25 residues other bump:2.58717 Ang V17.CG1 and I19.O neighbor-bump: 2.44145 Ang D18.O and I19.CG2 other bump:2.8004 Ang V17.CG1 and I19.N other bump:2.75038 Ang E4.OE1 and L10.CD1 T0191 101 :YP 1ff9A 81 :HA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues T0191 108 :PIVKAEKLREDMVVMDLIYNPLETVLLKEAKKVNAKTINGLGM 1ff9A 83 :TVIKSAIRQKKHVVTTSYVSPAMMELDQAAKDAGITVMNEIGL Fragment has 34 clashes (null) has 34 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 45 residues other bump:3.03577 Ang M16.SD and N40.OD1 other bump:0.90171 Ang Y20.CE1 and N40.ND2 other bump:3.1025 Ang Y20.CE2 and N40.ND2 other bump:1.83973 Ang Y20.CZ and N40.ND2 other bump:2.3193 Ang Y20.OH and N40.ND2 other bump:2.11026 Ang Y20.CD1 and N40.ND2 other bump:1.70604 Ang Y20.CE1 and N40.CG other bump:2.6386 Ang Y20.OH and N40.CG other bump:2.66217 Ang Y20.CD1 and N40.CG other bump:2.28734 Ang Y20.CE1 and N40.CB other bump:2.93095 Ang Y20.CE2 and N40.CB other bump:2.21507 Ang Y20.CZ and N40.CB other bump:2.55247 Ang Y20.OH and N40.CB other bump:3.03911 Ang Y20.CD1 and N40.CB other bump:2.91574 Ang Y20.CZ and N40.CA other bump:2.51191 Ang Y20.OH and N40.CA other bump:2.70621 Ang Y20.CZ and N40.N other bump:1.65958 Ang Y20.OH and N40.N other bump:2.63681 Ang Y20.OH and I39.C other bump:2.6489 Ang K8.NZ and L27.CD2 other bump:2.87968 Ang K8.NZ and L27.CD1 other bump:2.30564 Ang K8.NZ and L27.CG other bump:2.76483 Ang K8.CE and L27.CB other bump:1.42576 Ang K8.NZ and L27.CB other bump:2.4554 Ang K8.NZ and L27.CA other bump:2.54715 Ang P22.O and V26.CG2 other bump:2.88229 Ang M16.CE and L18.CD1 other bump:2.76847 Ang E7.CG and V14.CG2 other bump:2.39354 Ang I3.O and E7.OE2 other bump:0.955899 Ang I3.O and E7.OE1 other bump:1.85571 Ang I3.C and E7.OE1 other bump:2.57732 Ang V4.CA and E7.OE1 other bump:1.86853 Ang I3.O and E7.CD other bump:2.75978 Ang I3.C and E7.CD Number of specific fragments= 5 total=700 Number of alignments=126 # Reading fragments from alignment file # T0191 read from T0191-1ff9A-local-adpstyle5.pw.a2m.gz # 1ff9A read from T0191-1ff9A-local-adpstyle5.pw.a2m.gz # found chain 1ff9A in template set T0191 23 :DKNIVIYGAGGAARAVAFELAK 1ff9A 3 :TKSVLMLGSGFVTRPTLDVLTD Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 24 residues other bump:2.47698 Ang I5.CD1 and L21.CD1 other bump:2.82716 Ang R15.CG and F19.CZ other bump:2.38157 Ang R15.NE and F19.CZ other bump:2.87952 Ang R15.CG and F19.CE2 other bump:2.99735 Ang R15.CD and F19.CE2 other bump:2.27429 Ang R15.NE and F19.CE2 other bump:3.12943 Ang R15.CZ and F19.CE2 other bump:2.44894 Ang V6.CG1 and Y8.OH other bump:2.57918 Ang V6.CG1 and Y8.CZ other bump:2.81169 Ang V6.CG1 and Y8.CE1 T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKK 1ff9A 26 :GIKVTVACRTLESAKKLSAGVQHSTPIS Fragment has 33 clashes (null) has 33 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 30 residues other bump:3.08149 Ang T11.C and K29.CD other bump:2.61092 Ang R10.O and K29.CD other bump:2.96438 Ang T11.CA and K29.CD other bump:2.72308 Ang V12.N and K29.CD other bump:2.85131 Ang V12.N and K29.CG other bump:2.1743 Ang V12.CG2 and K29.CG other bump:2.31532 Ang I7.CG1 and N27.OD1 other bump:2.59361 Ang I7.CD1 and N27.OD1 other bump:2.4925 Ang A19.CB and N27.OD1 other bump:2.5622 Ang A19.CB and N27.ND2 other bump:2.84903 Ang A19.CB and N27.CG other bump:2.50901 Ang A15.O and N27.CG other bump:2.93406 Ang A15.C and N27.CG other bump:2.70886 Ang I7.CB and K25.NZ other bump:1.44641 Ang I7.CG1 and K25.NZ other bump:1.84148 Ang I7.CD1 and K25.NZ other bump:2.44083 Ang A19.CB and K25.NZ other bump:2.59486 Ang I7.CG1 and K25.CE other bump:1.96902 Ang I7.CD1 and K25.CE other bump:2.3557 Ang A19.CA and K25.CE other bump:1.50683 Ang A19.CB and K25.CE other bump:2.579 Ang A19.CA and K25.CD other bump:1.92171 Ang A19.CB and K25.CD other bump:2.50739 Ang E16.O and K20.CG other bump:2.94247 Ang I7.CD1 and A19.CB other bump:2.39144 Ang N9.ND2 and K14.NZ other bump:2.20145 Ang N9.ND2 and K14.CE other bump:1.44098 Ang N9.ND2 and K14.CD other bump:2.27746 Ang N9.CG and K14.CD other bump:2.57192 Ang N9.OD1 and K14.CD other bump:2.17406 Ang N9.ND2 and K14.CG other bump:2.75282 Ang N9.CG and K14.CG other bump:2.80008 Ang N9.CG and K14.CB T0191 74 :GEEVKFSGLDVDLDGVDIIINAT 1ff9A 54 :LDVNDDAALDAEVAKHDLVISLI Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 25 residues other bump:2.58717 Ang V17.CG1 and I19.O neighbor-bump: 2.44145 Ang D18.O and I19.CG2 other bump:2.8004 Ang V17.CG1 and I19.N other bump:2.75038 Ang E4.OE1 and L10.CD1 T0191 101 :YP 1ff9A 81 :HA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues T0191 108 :PIVKAEKLREDMVVMDLIYNPLETVLLKEAKKVNAKTINGLG 1ff9A 83 :TVIKSAIRQKKHVVTTSYVSPAMMELDQAAKDAGITVMNEIG Fragment has 34 clashes (null) has 34 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 44 residues other bump:3.03577 Ang M16.SD and N40.OD1 other bump:2.11026 Ang Y20.CD1 and N40.ND2 other bump:0.90171 Ang Y20.CE1 and N40.ND2 other bump:3.1025 Ang Y20.CE2 and N40.ND2 other bump:1.83973 Ang Y20.CZ and N40.ND2 other bump:2.3193 Ang Y20.OH and N40.ND2 other bump:2.66217 Ang Y20.CD1 and N40.CG other bump:1.70604 Ang Y20.CE1 and N40.CG other bump:2.6386 Ang Y20.OH and N40.CG other bump:3.03911 Ang Y20.CD1 and N40.CB other bump:2.28734 Ang Y20.CE1 and N40.CB other bump:2.93095 Ang Y20.CE2 and N40.CB other bump:2.21507 Ang Y20.CZ and N40.CB other bump:2.55247 Ang Y20.OH and N40.CB other bump:2.91574 Ang Y20.CZ and N40.CA other bump:2.51191 Ang Y20.OH and N40.CA other bump:2.70621 Ang Y20.CZ and N40.N other bump:1.65958 Ang Y20.OH and N40.N other bump:2.63681 Ang Y20.OH and I39.C other bump:2.6489 Ang K8.NZ and L27.CD2 other bump:2.87968 Ang K8.NZ and L27.CD1 other bump:2.30564 Ang K8.NZ and L27.CG other bump:2.76483 Ang K8.CE and L27.CB other bump:1.42576 Ang K8.NZ and L27.CB other bump:2.4554 Ang K8.NZ and L27.CA other bump:2.54715 Ang P22.O and V26.CG2 other bump:2.88229 Ang M16.CE and L18.CD1 other bump:2.76847 Ang E7.CG and V14.CG2 other bump:2.39354 Ang I3.O and E7.OE2 other bump:0.955899 Ang I3.O and E7.OE1 other bump:1.85571 Ang I3.C and E7.OE1 other bump:2.57732 Ang V4.CA and E7.OE1 other bump:1.86853 Ang I3.O and E7.CD other bump:2.75978 Ang I3.C and E7.CD Number of specific fragments= 5 total=705 Number of alignments=127 # Reading fragments from alignment file # T0191 read from T0191-1ff9A-simpleSW-adpstyle1.pw.a2m.gz # 1ff9A read from T0191-1ff9A-simpleSW-adpstyle1.pw.a2m.gz # found chain 1ff9A in template set T0191 33 :GAARAVAFELAKDNNIIIANRTVEKAEALAKEIAEKLNKKFGEEVK 1ff9A 400 :GVPCAVAVKFVLDGTISDRGVLAPMNSKINDPLMKELKEKYGIECK Fragment has 23 clashes (null) has 23 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 48 residues other bump:2.23302 Ang N39.ND2 and E45.OE2 other bump:2.63051 Ang N39.ND2 and E45.CD other bump:2.95172 Ang K37.CE and K41.CD other bump:2.44613 Ang K37.NZ and K41.CD other bump:2.73033 Ang N16.ND2 and E33.CB other bump:2.70894 Ang V24.CG1 and K26.NZ other bump:3.24043 Ang V24.CG1 and K26.CD other bump:2.35864 Ang V24.CG1 and K26.CG other bump:3.00432 Ang N21.CG and T23.CG2 other bump:2.27793 Ang N21.ND2 and T23.CG2 other bump:3.13932 Ang I19.CG1 and N21.OD1 neighbor-bump: 2.06932 Ang A20.O and N21.CG neighbor-bump: 2.74919 Ang A20.C and N21.CG neighbor-bump: 2.05281 Ang A20.O and N21.CB neighbor-bump: 2.56223 Ang A20.C and N21.CB other bump:2.06784 Ang N15.O and I18.CD1 other bump:2.58272 Ang N15.ND2 and I18.CD1 other bump:2.51592 Ang N15.CG and I18.CG1 other bump:1.98489 Ang N15.O and I18.CG1 other bump:2.93798 Ang N15.C and I18.CG1 other bump:2.19333 Ang N15.OD1 and I18.CG1 other bump:2.97669 Ang N15.ND2 and I18.CG1 other bump:2.90548 Ang R5.NH2 and F9.CE1 Number of specific fragments= 1 total=706 Number of alignments=128 # Reading fragments from alignment file # T0191 read from T0191-1ff9A-simpleSW-adpstyle5.pw.a2m.gz # 1ff9A read from T0191-1ff9A-simpleSW-adpstyle5.pw.a2m.gz # found chain 1ff9A in template set T0191 24 :KNIVIYGAGGAARAVA 1ff9A 4 :KSVLMLGSGFVTRPTL Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 18 residues other bump:2.44894 Ang V5.CG1 and Y7.OH other bump:2.57918 Ang V5.CG1 and Y7.CZ other bump:2.81169 Ang V5.CG1 and Y7.CE1 T0191 41 :ELAKDN 1ff9A 20 :DVLTDS Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 8 residues other bump:1.30469 Ang A4.O and N7.OD1 other bump:2.3891 Ang A4.C and N7.OD1 other bump:2.40134 Ang A4.O and N7.CG T0191 47 :NIIIANRTVEKAEALAKEIAEKLNKKFGE 1ff9A 28 :KVTVACRTLESAKKLSAGVQHSTPISLDV Fragment has 33 clashes (null) has 33 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 31 residues other bump:3.08149 Ang T9.C and K27.CD other bump:2.72309 Ang V10.N and K27.CD other bump:2.61091 Ang R8.O and K27.CD other bump:2.96438 Ang T9.CA and K27.CD other bump:2.85131 Ang V10.N and K27.CG other bump:2.17432 Ang V10.CG2 and K27.CG other bump:2.59361 Ang I5.CD1 and N25.OD1 other bump:2.31532 Ang I5.CG1 and N25.OD1 other bump:2.4925 Ang A17.CB and N25.OD1 other bump:2.5622 Ang A17.CB and N25.ND2 other bump:2.84903 Ang A17.CB and N25.CG other bump:2.50901 Ang A13.O and N25.CG other bump:2.93406 Ang A13.C and N25.CG other bump:1.84148 Ang I5.CD1 and K23.NZ other bump:2.70886 Ang I5.CB and K23.NZ other bump:1.4464 Ang I5.CG1 and K23.NZ other bump:2.44083 Ang A17.CB and K23.NZ other bump:1.96902 Ang I5.CD1 and K23.CE other bump:2.59486 Ang I5.CG1 and K23.CE other bump:2.3557 Ang A17.CA and K23.CE other bump:1.50683 Ang A17.CB and K23.CE other bump:2.579 Ang A17.CA and K23.CD other bump:1.92171 Ang A17.CB and K23.CD other bump:2.50739 Ang E14.O and K18.CG other bump:2.94247 Ang I5.CD1 and A17.CB other bump:2.39144 Ang N7.ND2 and K12.NZ other bump:2.20145 Ang N7.ND2 and K12.CE other bump:1.44098 Ang N7.ND2 and K12.CD other bump:2.27746 Ang N7.CG and K12.CD other bump:2.57192 Ang N7.OD1 and K12.CD other bump:2.17406 Ang N7.ND2 and K12.CG other bump:2.75282 Ang N7.CG and K12.CG other bump:2.80008 Ang N7.CG and K12.CB T0191 77 :VKFSGLDVDLDGVDIIINAT 1ff9A 57 :NDDAALDAEVAKHDLVISLI Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 22 residues other bump:2.58717 Ang V14.CG1 and I16.O neighbor-bump: 2.44145 Ang D15.O and I16.CG2 other bump:2.8004 Ang V14.CG1 and I16.N T0191 101 :YPN 1ff9A 81 :HAT Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 5 residues T0191 109 :IVKAEKLREDMVVMDLIYNPL 1ff9A 84 :VIKSAIRQKKHVVTTSYVSPA Fragment has 8 clashes (null) has 8 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 23 residues other bump:2.88229 Ang M15.CE and L17.CD1 other bump:2.76847 Ang E6.CG and V13.CG2 other bump:2.39354 Ang I2.O and E6.OE2 other bump:0.955899 Ang I2.O and E6.OE1 other bump:2.57732 Ang V3.CA and E6.OE1 other bump:1.85571 Ang I2.C and E6.OE1 other bump:1.86853 Ang I2.O and E6.CD other bump:2.75978 Ang I2.C and E6.CD Number of specific fragments= 6 total=712 Number of alignments=129 # Reading fragments from alignment file # T0191 read from T0191-1ff9A-vit-adpstyle1.pw.a2m.gz # 1ff9A read from T0191-1ff9A-vit-adpstyle1.pw.a2m.gz # found chain 1ff9A in template set T0191 24 :KNIVIYGAGGAARAVAFELAK 1ff9A 4 :KSVLMLGSGFVTRPTLDVLTD Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 23 residues other bump:2.47698 Ang I4.CD1 and L20.CD1 other bump:2.82716 Ang R14.CG and F18.CZ other bump:2.38157 Ang R14.NE and F18.CZ other bump:2.87952 Ang R14.CG and F18.CE2 other bump:2.99735 Ang R14.CD and F18.CE2 other bump:2.27429 Ang R14.NE and F18.CE2 other bump:3.12943 Ang R14.CZ and F18.CE2 other bump:2.44894 Ang V5.CG1 and Y7.OH other bump:2.57918 Ang V5.CG1 and Y7.CZ other bump:2.81169 Ang V5.CG1 and Y7.CE1 T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKK 1ff9A 26 :GIKVTVACRTLESAKKLSAGVQHSTPIS Fragment has 33 clashes (null) has 33 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 30 residues other bump:3.08149 Ang T11.C and K29.CD other bump:2.61092 Ang R10.O and K29.CD other bump:2.96438 Ang T11.CA and K29.CD other bump:2.72308 Ang V12.N and K29.CD other bump:2.85131 Ang V12.N and K29.CG other bump:2.1743 Ang V12.CG2 and K29.CG other bump:2.31532 Ang I7.CG1 and N27.OD1 other bump:2.59361 Ang I7.CD1 and N27.OD1 other bump:2.4925 Ang A19.CB and N27.OD1 other bump:2.5622 Ang A19.CB and N27.ND2 other bump:2.84903 Ang A19.CB and N27.CG other bump:2.50901 Ang A15.O and N27.CG other bump:2.93406 Ang A15.C and N27.CG other bump:2.70886 Ang I7.CB and K25.NZ other bump:1.44641 Ang I7.CG1 and K25.NZ other bump:1.84148 Ang I7.CD1 and K25.NZ other bump:2.44083 Ang A19.CB and K25.NZ other bump:2.59486 Ang I7.CG1 and K25.CE other bump:1.96902 Ang I7.CD1 and K25.CE other bump:2.3557 Ang A19.CA and K25.CE other bump:1.50683 Ang A19.CB and K25.CE other bump:2.579 Ang A19.CA and K25.CD other bump:1.92171 Ang A19.CB and K25.CD other bump:2.50739 Ang E16.O and K20.CG other bump:2.94247 Ang I7.CD1 and A19.CB other bump:2.39144 Ang N9.ND2 and K14.NZ other bump:2.20145 Ang N9.ND2 and K14.CE other bump:1.44098 Ang N9.ND2 and K14.CD other bump:2.27746 Ang N9.CG and K14.CD other bump:2.57192 Ang N9.OD1 and K14.CD other bump:2.17406 Ang N9.ND2 and K14.CG other bump:2.75282 Ang N9.CG and K14.CG other bump:2.80008 Ang N9.CG and K14.CB T0191 74 :GEEVKFSGLDVDLDGVDIIINAT 1ff9A 54 :LDVNDDAALDAEVAKHDLVISLI Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 25 residues other bump:2.58717 Ang V17.CG1 and I19.O neighbor-bump: 2.44145 Ang D18.O and I19.CG2 other bump:2.8004 Ang V17.CG1 and I19.N other bump:2.75038 Ang E4.OE1 and L10.CD1 T0191 101 :YP 1ff9A 81 :HA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues T0191 108 :PIVKAEKLREDMVVMDLIYNPLETVLLKEAKKVNAKTINGLGM 1ff9A 83 :TVIKSAIRQKKHVVTTSYVSPAMMELDQAAKDAGITVMNEIGL Fragment has 34 clashes (null) has 34 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 45 residues other bump:3.03577 Ang M16.SD and N40.OD1 other bump:0.90171 Ang Y20.CE1 and N40.ND2 other bump:3.1025 Ang Y20.CE2 and N40.ND2 other bump:1.83973 Ang Y20.CZ and N40.ND2 other bump:2.3193 Ang Y20.OH and N40.ND2 other bump:2.11026 Ang Y20.CD1 and N40.ND2 other bump:1.70604 Ang Y20.CE1 and N40.CG other bump:2.6386 Ang Y20.OH and N40.CG other bump:2.66217 Ang Y20.CD1 and N40.CG other bump:2.28734 Ang Y20.CE1 and N40.CB other bump:2.93095 Ang Y20.CE2 and N40.CB other bump:2.21507 Ang Y20.CZ and N40.CB other bump:2.55247 Ang Y20.OH and N40.CB other bump:3.03911 Ang Y20.CD1 and N40.CB other bump:2.91574 Ang Y20.CZ and N40.CA other bump:2.51191 Ang Y20.OH and N40.CA other bump:2.70621 Ang Y20.CZ and N40.N other bump:1.65958 Ang Y20.OH and N40.N other bump:2.63681 Ang Y20.OH and I39.C other bump:2.6489 Ang K8.NZ and L27.CD2 other bump:2.87968 Ang K8.NZ and L27.CD1 other bump:2.30564 Ang K8.NZ and L27.CG other bump:2.76483 Ang K8.CE and L27.CB other bump:1.42576 Ang K8.NZ and L27.CB other bump:2.4554 Ang K8.NZ and L27.CA other bump:2.54715 Ang P22.O and V26.CG2 other bump:2.88229 Ang M16.CE and L18.CD1 other bump:2.76847 Ang E7.CG and V14.CG2 other bump:2.39354 Ang I3.O and E7.OE2 other bump:0.955899 Ang I3.O and E7.OE1 other bump:1.85571 Ang I3.C and E7.OE1 other bump:2.57732 Ang V4.CA and E7.OE1 other bump:1.86853 Ang I3.O and E7.CD other bump:2.75978 Ang I3.C and E7.CD Number of specific fragments= 5 total=717 Number of alignments=130 # Reading fragments from alignment file # T0191 read from T0191-1ff9A-vit-adpstyle5.pw.a2m.gz # 1ff9A read from T0191-1ff9A-vit-adpstyle5.pw.a2m.gz # found chain 1ff9A in template set T0191 23 :DKNIVIYGAGGAARAVAFELAK 1ff9A 3 :TKSVLMLGSGFVTRPTLDVLTD Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 24 residues other bump:2.47698 Ang I5.CD1 and L21.CD1 other bump:2.82716 Ang R15.CG and F19.CZ other bump:2.38157 Ang R15.NE and F19.CZ other bump:2.87952 Ang R15.CG and F19.CE2 other bump:2.99735 Ang R15.CD and F19.CE2 other bump:2.27429 Ang R15.NE and F19.CE2 other bump:3.12943 Ang R15.CZ and F19.CE2 other bump:2.44894 Ang V6.CG1 and Y8.OH other bump:2.57918 Ang V6.CG1 and Y8.CZ other bump:2.81169 Ang V6.CG1 and Y8.CE1 T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKK 1ff9A 26 :GIKVTVACRTLESAKKLSAGVQHSTPIS Fragment has 33 clashes (null) has 33 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 30 residues other bump:3.08149 Ang T11.C and K29.CD other bump:2.61092 Ang R10.O and K29.CD other bump:2.96438 Ang T11.CA and K29.CD other bump:2.72308 Ang V12.N and K29.CD other bump:2.85131 Ang V12.N and K29.CG other bump:2.1743 Ang V12.CG2 and K29.CG other bump:2.31532 Ang I7.CG1 and N27.OD1 other bump:2.59361 Ang I7.CD1 and N27.OD1 other bump:2.4925 Ang A19.CB and N27.OD1 other bump:2.5622 Ang A19.CB and N27.ND2 other bump:2.84903 Ang A19.CB and N27.CG other bump:2.50901 Ang A15.O and N27.CG other bump:2.93406 Ang A15.C and N27.CG other bump:2.70886 Ang I7.CB and K25.NZ other bump:1.44641 Ang I7.CG1 and K25.NZ other bump:1.84148 Ang I7.CD1 and K25.NZ other bump:2.44083 Ang A19.CB and K25.NZ other bump:2.59486 Ang I7.CG1 and K25.CE other bump:1.96902 Ang I7.CD1 and K25.CE other bump:2.3557 Ang A19.CA and K25.CE other bump:1.50683 Ang A19.CB and K25.CE other bump:2.579 Ang A19.CA and K25.CD other bump:1.92171 Ang A19.CB and K25.CD other bump:2.50739 Ang E16.O and K20.CG other bump:2.94247 Ang I7.CD1 and A19.CB other bump:2.39144 Ang N9.ND2 and K14.NZ other bump:2.20145 Ang N9.ND2 and K14.CE other bump:1.44098 Ang N9.ND2 and K14.CD other bump:2.27746 Ang N9.CG and K14.CD other bump:2.57192 Ang N9.OD1 and K14.CD other bump:2.17406 Ang N9.ND2 and K14.CG other bump:2.75282 Ang N9.CG and K14.CG other bump:2.80008 Ang N9.CG and K14.CB T0191 74 :GEEVKFSGLDVDLDGVDIIINAT 1ff9A 54 :LDVNDDAALDAEVAKHDLVISLI Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 25 residues other bump:2.58717 Ang V17.CG1 and I19.O neighbor-bump: 2.44145 Ang D18.O and I19.CG2 other bump:2.8004 Ang V17.CG1 and I19.N other bump:2.75038 Ang E4.OE1 and L10.CD1 T0191 101 :YP 1ff9A 81 :HA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues T0191 108 :PIVKAEKLREDMVVMDLIYNPLETVLLKEAKKVNAKTINGLG 1ff9A 83 :TVIKSAIRQKKHVVTTSYVSPAMMELDQAAKDAGITVMNEIG Fragment has 34 clashes (null) has 34 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 44 residues other bump:3.03577 Ang M16.SD and N40.OD1 other bump:2.11026 Ang Y20.CD1 and N40.ND2 other bump:0.90171 Ang Y20.CE1 and N40.ND2 other bump:3.1025 Ang Y20.CE2 and N40.ND2 other bump:1.83973 Ang Y20.CZ and N40.ND2 other bump:2.3193 Ang Y20.OH and N40.ND2 other bump:2.66217 Ang Y20.CD1 and N40.CG other bump:1.70604 Ang Y20.CE1 and N40.CG other bump:2.6386 Ang Y20.OH and N40.CG other bump:3.03911 Ang Y20.CD1 and N40.CB other bump:2.28734 Ang Y20.CE1 and N40.CB other bump:2.93095 Ang Y20.CE2 and N40.CB other bump:2.21507 Ang Y20.CZ and N40.CB other bump:2.55247 Ang Y20.OH and N40.CB other bump:2.91574 Ang Y20.CZ and N40.CA other bump:2.51191 Ang Y20.OH and N40.CA other bump:2.70621 Ang Y20.CZ and N40.N other bump:1.65958 Ang Y20.OH and N40.N other bump:2.63681 Ang Y20.OH and I39.C other bump:2.6489 Ang K8.NZ and L27.CD2 other bump:2.87968 Ang K8.NZ and L27.CD1 other bump:2.30564 Ang K8.NZ and L27.CG other bump:2.76483 Ang K8.CE and L27.CB other bump:1.42576 Ang K8.NZ and L27.CB other bump:2.4554 Ang K8.NZ and L27.CA other bump:2.54715 Ang P22.O and V26.CG2 other bump:2.88229 Ang M16.CE and L18.CD1 other bump:2.76847 Ang E7.CG and V14.CG2 other bump:2.39354 Ang I3.O and E7.OE2 other bump:0.955899 Ang I3.O and E7.OE1 other bump:1.85571 Ang I3.C and E7.OE1 other bump:2.57732 Ang V4.CA and E7.OE1 other bump:1.86853 Ang I3.O and E7.CD other bump:2.75978 Ang I3.C and E7.CD Number of specific fragments= 5 total=722 Number of alignments=131 # command:# Prefix for input files set to 1jaxA/ # command:# reading script from file read-alignments.under # Reading fragments from alignment file # T0191 read from 1jaxA-T0191-local-adpstyle1.pw.a2m.gz # 1jaxA read from 1jaxA-T0191-local-adpstyle1.pw.a2m.gz # found chain 1jaxA in template set T0191 25 :NIVIY 1jaxA 2 :RVALL Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 7 residues other bump:2.68543 Ang V4.CG1 and Y6.CZ other bump:2.96811 Ang V4.CG1 and Y6.CE2 other bump:2.91432 Ang V4.CG1 and Y6.CE1 T0191 30 :GAGGAARAVAFELAKD 1jaxA 8 :GTGNLGKGLALRLATL Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 18 residues other bump:2.85917 Ang G2.C and A7.CB other bump:2.65143 Ang G2.O and A7.CB other bump:2.73101 Ang G2.CA and A7.CB T0191 46 :NNIIIANRTVEKAEALAKEIAEKLNKKFGEEV 1jaxA 25 :HEIVVGSRREEKAEAKAAEYRRIAGDASITGM Fragment has 50 clashes (null) has 50 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 34 residues other bump:2.87489 Ang I5.CG1 and V33.CG2 other bump:2.47604 Ang I5.CD1 and V33.CG2 other bump:2.8209 Ang I5.CD1 and V33.CG1 other bump:1.67864 Ang E15.N and E32.OE2 other bump:1.79763 Ang K13.C and E32.OE2 other bump:1.0317 Ang A14.N and E32.OE2 other bump:1.54786 Ang A14.CA and E32.OE2 other bump:2.51127 Ang A14.CB and E32.OE2 other bump:1.76559 Ang A14.C and E32.OE2 other bump:0.899862 Ang E15.N and E32.OE1 other bump:1.10488 Ang E15.CA and E32.OE1 other bump:2.24411 Ang E15.C and E32.OE1 other bump:1.61355 Ang E15.CB and E32.OE1 other bump:2.21594 Ang A14.C and E32.OE1 other bump:2.43633 Ang A14.O and E32.CD other bump:0.565897 Ang E15.N and E32.CD other bump:1.99209 Ang E15.CA and E32.CD other bump:3.01536 Ang E15.C and E32.CD other bump:2.81391 Ang E15.CB and E32.CD other bump:2.92884 Ang K13.C and E32.CD other bump:2.23224 Ang A14.N and E32.CD other bump:2.02599 Ang A14.CA and E32.CD other bump:2.66184 Ang A14.CB and E32.CD other bump:1.30434 Ang A14.C and E32.CD other bump:2.191 Ang A14.O and E32.CG other bump:1.70188 Ang E15.N and E32.CG other bump:2.63976 Ang E15.CA and E32.CG other bump:3.04308 Ang A14.N and E32.CG other bump:2.10154 Ang A14.CA and E32.CG other bump:2.0153 Ang A14.CB and E32.CG other bump:1.48782 Ang A14.C and E32.CG other bump:2.38329 Ang A14.O and E32.CB other bump:2.36679 Ang E15.N and E32.CB other bump:2.42495 Ang E15.CA and E32.CB other bump:2.36144 Ang A14.C and E32.CB other bump:2.8852 Ang F29.CD1 and E31.OE1 other bump:1.68779 Ang F29.CE1 and E31.OE1 other bump:2.16903 Ang F29.CZ and E31.OE1 other bump:2.81264 Ang F29.CZ and E31.CD other bump:2.93181 Ang N3.CB and F29.CE2 other bump:3.08236 Ang N3.CG and F29.CE2 other bump:2.76982 Ang N3.CA and F29.CD2 other bump:2.76488 Ang N3.CB and F29.CD2 other bump:2.82356 Ang N3.CG and F29.CD2 other bump:2.95391 Ang L25.CB and K28.CD other bump:2.89819 Ang I6.CD1 and A18.CA other bump:2.52503 Ang I6.CD1 and A18.N other bump:2.46765 Ang V11.CG1 and E15.OE2 other bump:2.85136 Ang N8.ND2 and K13.CE other bump:2.77127 Ang N8.ND2 and K13.CD T0191 81 :GLDVDLDGVDIIINATPI 1jaxA 57 :KNEDAAEACDIAVLTIPW Fragment has 8 clashes (null) has 8 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 20 residues other bump:2.14889 Ang L7.CD2 and I13.CD1 other bump:2.91433 Ang L7.CB and I13.CD1 other bump:2.26708 Ang L7.CD2 and I13.CG2 other bump:2.63206 Ang L7.CD2 and I13.CG1 other bump:2.81381 Ang V10.CG1 and I13.CG1 other bump:2.93808 Ang L7.CD2 and I13.CB other bump:2.70337 Ang V10.CG2 and I12.C other bump:1.98462 Ang V10.CG2 and I12.O T0191 103 :NIDVEPIVKAEKLREDMVVMDL 1jaxA 75 :EHAIDTARDLKNILREKIVVSP Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 24 residues other bump:1.5429 Ang I3.O and P7.CD other bump:2.65015 Ang I3.C and P7.CD other bump:2.96338 Ang D4.C and P7.CD other bump:1.85393 Ang I3.O and P7.CG other bump:3.01831 Ang I3.C and P7.CG Number of specific fragments= 5 total=727 Number of alignments=132 # Reading fragments from alignment file # T0191 read from 1jaxA-T0191-local-adpstyle5.pw.a2m.gz # 1jaxA read from 1jaxA-T0191-local-adpstyle5.pw.a2m.gz # found chain 1jaxA in template set T0191 25 :NIVIY 1jaxA 2 :RVALL Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 7 residues other bump:2.68543 Ang V4.CG1 and Y6.CZ other bump:2.96811 Ang V4.CG1 and Y6.CE2 other bump:2.91432 Ang V4.CG1 and Y6.CE1 T0191 30 :GAGGAARAVAFELAKD 1jaxA 8 :GTGNLGKGLALRLATL Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 18 residues other bump:2.85917 Ang G2.C and A7.CB other bump:2.65143 Ang G2.O and A7.CB other bump:2.73101 Ang G2.CA and A7.CB T0191 46 :NNIIIANRTVEKAEALAKEIAEKLNKKFGEEV 1jaxA 25 :HEIVVGSRREEKAEAKAAEYRRIAGDASITGM Fragment has 50 clashes (null) has 50 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 34 residues other bump:2.87489 Ang I5.CG1 and V33.CG2 other bump:2.47604 Ang I5.CD1 and V33.CG2 other bump:2.8209 Ang I5.CD1 and V33.CG1 other bump:1.67864 Ang E15.N and E32.OE2 other bump:1.79763 Ang K13.C and E32.OE2 other bump:1.0317 Ang A14.N and E32.OE2 other bump:1.54786 Ang A14.CA and E32.OE2 other bump:2.51127 Ang A14.CB and E32.OE2 other bump:1.76559 Ang A14.C and E32.OE2 other bump:0.899862 Ang E15.N and E32.OE1 other bump:1.10488 Ang E15.CA and E32.OE1 other bump:2.24411 Ang E15.C and E32.OE1 other bump:1.61355 Ang E15.CB and E32.OE1 other bump:2.21594 Ang A14.C and E32.OE1 other bump:2.43633 Ang A14.O and E32.CD other bump:0.565897 Ang E15.N and E32.CD other bump:1.99209 Ang E15.CA and E32.CD other bump:3.01536 Ang E15.C and E32.CD other bump:2.81391 Ang E15.CB and E32.CD other bump:2.92884 Ang K13.C and E32.CD other bump:2.23224 Ang A14.N and E32.CD other bump:2.02599 Ang A14.CA and E32.CD other bump:2.66184 Ang A14.CB and E32.CD other bump:1.30434 Ang A14.C and E32.CD other bump:2.191 Ang A14.O and E32.CG other bump:1.70188 Ang E15.N and E32.CG other bump:2.63976 Ang E15.CA and E32.CG other bump:3.04308 Ang A14.N and E32.CG other bump:2.10154 Ang A14.CA and E32.CG other bump:2.0153 Ang A14.CB and E32.CG other bump:1.48782 Ang A14.C and E32.CG other bump:2.38329 Ang A14.O and E32.CB other bump:2.36679 Ang E15.N and E32.CB other bump:2.42495 Ang E15.CA and E32.CB other bump:2.36144 Ang A14.C and E32.CB other bump:2.8852 Ang F29.CD1 and E31.OE1 other bump:1.68779 Ang F29.CE1 and E31.OE1 other bump:2.16903 Ang F29.CZ and E31.OE1 other bump:2.81264 Ang F29.CZ and E31.CD other bump:2.93181 Ang N3.CB and F29.CE2 other bump:3.08236 Ang N3.CG and F29.CE2 other bump:2.76982 Ang N3.CA and F29.CD2 other bump:2.76488 Ang N3.CB and F29.CD2 other bump:2.82356 Ang N3.CG and F29.CD2 other bump:2.95391 Ang L25.CB and K28.CD other bump:2.89819 Ang I6.CD1 and A18.CA other bump:2.52503 Ang I6.CD1 and A18.N other bump:2.46765 Ang V11.CG1 and E15.OE2 other bump:2.85136 Ang N8.ND2 and K13.CE other bump:2.77127 Ang N8.ND2 and K13.CD T0191 81 :GLDV 1jaxA 57 :KNED Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 6 residues T0191 86 :LDGVDIIINATPIGMYPNIDVE 1jaxA 62 :AEACDIAVLTIPWEHAIDTARD Fragment has 8 clashes (null) has 8 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 24 residues neighbor-bump: 2.74793 Ang Y17.CD2 and P18.CD other bump:3.02336 Ang L2.CB and I8.CD1 other bump:2.09297 Ang L2.CG and I8.CD1 other bump:0.9829 Ang L2.CD2 and I8.CD1 other bump:2.81381 Ang V5.CG1 and I8.CG1 other bump:2.5019 Ang L2.CD2 and I8.CG1 other bump:2.70337 Ang V5.CG2 and I7.C other bump:1.98462 Ang V5.CG2 and I7.O T0191 111 :KAEKLREDMVVMDLIYNPLE 1jaxA 84 :LKNILREKIVVSPLVPVSRG Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 22 residues other bump:2.69097 Ang I16.CG1 and N18.ND2 Number of specific fragments= 6 total=733 Number of alignments=133 # Reading fragments from alignment file # T0191 read from 1jaxA-T0191-vit-adpstyle1.pw.a2m.gz # 1jaxA read from 1jaxA-T0191-vit-adpstyle1.pw.a2m.gz # found chain 1jaxA in template set T0191 25 :NIVIY 1jaxA 2 :RVALL Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 7 residues other bump:2.68543 Ang V4.CG1 and Y6.CZ other bump:2.96811 Ang V4.CG1 and Y6.CE2 other bump:2.91432 Ang V4.CG1 and Y6.CE1 T0191 30 :GAGGAARAVAFELAKD 1jaxA 8 :GTGNLGKGLALRLATL Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 18 residues other bump:2.85917 Ang G2.C and A7.CB other bump:2.65143 Ang G2.O and A7.CB other bump:2.73101 Ang G2.CA and A7.CB T0191 46 :NNIIIANRTVEKAEALAKEIAEKLNKKFGEEV 1jaxA 25 :HEIVVGSRREEKAEAKAAEYRRIAGDASITGM Fragment has 50 clashes (null) has 50 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 34 residues other bump:2.87489 Ang I5.CG1 and V33.CG2 other bump:2.47604 Ang I5.CD1 and V33.CG2 other bump:2.8209 Ang I5.CD1 and V33.CG1 other bump:1.67864 Ang E15.N and E32.OE2 other bump:1.79763 Ang K13.C and E32.OE2 other bump:1.0317 Ang A14.N and E32.OE2 other bump:1.54786 Ang A14.CA and E32.OE2 other bump:2.51127 Ang A14.CB and E32.OE2 other bump:1.76559 Ang A14.C and E32.OE2 other bump:0.899862 Ang E15.N and E32.OE1 other bump:1.10488 Ang E15.CA and E32.OE1 other bump:2.24411 Ang E15.C and E32.OE1 other bump:1.61355 Ang E15.CB and E32.OE1 other bump:2.21594 Ang A14.C and E32.OE1 other bump:2.43633 Ang A14.O and E32.CD other bump:0.565897 Ang E15.N and E32.CD other bump:1.99209 Ang E15.CA and E32.CD other bump:3.01536 Ang E15.C and E32.CD other bump:2.81391 Ang E15.CB and E32.CD other bump:2.92884 Ang K13.C and E32.CD other bump:2.23224 Ang A14.N and E32.CD other bump:2.02599 Ang A14.CA and E32.CD other bump:2.66184 Ang A14.CB and E32.CD other bump:1.30434 Ang A14.C and E32.CD other bump:2.191 Ang A14.O and E32.CG other bump:1.70188 Ang E15.N and E32.CG other bump:2.63976 Ang E15.CA and E32.CG other bump:3.04308 Ang A14.N and E32.CG other bump:2.10154 Ang A14.CA and E32.CG other bump:2.0153 Ang A14.CB and E32.CG other bump:1.48782 Ang A14.C and E32.CG other bump:2.38329 Ang A14.O and E32.CB other bump:2.36679 Ang E15.N and E32.CB other bump:2.42495 Ang E15.CA and E32.CB other bump:2.36144 Ang A14.C and E32.CB other bump:2.8852 Ang F29.CD1 and E31.OE1 other bump:1.68779 Ang F29.CE1 and E31.OE1 other bump:2.16903 Ang F29.CZ and E31.OE1 other bump:2.81264 Ang F29.CZ and E31.CD other bump:2.93181 Ang N3.CB and F29.CE2 other bump:3.08236 Ang N3.CG and F29.CE2 other bump:2.76982 Ang N3.CA and F29.CD2 other bump:2.76488 Ang N3.CB and F29.CD2 other bump:2.82356 Ang N3.CG and F29.CD2 other bump:2.95391 Ang L25.CB and K28.CD other bump:2.89819 Ang I6.CD1 and A18.CA other bump:2.52503 Ang I6.CD1 and A18.N other bump:2.46765 Ang V11.CG1 and E15.OE2 other bump:2.85136 Ang N8.ND2 and K13.CE other bump:2.77127 Ang N8.ND2 and K13.CD T0191 81 :GLDVDLDGVDIIINATPI 1jaxA 57 :KNEDAAEACDIAVLTIPW Fragment has 8 clashes (null) has 8 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 20 residues other bump:2.14889 Ang L7.CD2 and I13.CD1 other bump:2.91433 Ang L7.CB and I13.CD1 other bump:2.26708 Ang L7.CD2 and I13.CG2 other bump:2.63206 Ang L7.CD2 and I13.CG1 other bump:2.81381 Ang V10.CG1 and I13.CG1 other bump:2.93808 Ang L7.CD2 and I13.CB other bump:2.70337 Ang V10.CG2 and I12.C other bump:1.98462 Ang V10.CG2 and I12.O T0191 103 :NIDVEPIVKAEKLREDMVVMDL 1jaxA 75 :EHAIDTARDLKNILREKIVVSP Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 24 residues other bump:1.5429 Ang I3.O and P7.CD other bump:2.65015 Ang I3.C and P7.CD other bump:2.96338 Ang D4.C and P7.CD other bump:1.85393 Ang I3.O and P7.CG other bump:3.01831 Ang I3.C and P7.CG Number of specific fragments= 5 total=738 Number of alignments=134 # Reading fragments from alignment file # T0191 read from 1jaxA-T0191-vit-adpstyle5.pw.a2m.gz # 1jaxA read from 1jaxA-T0191-vit-adpstyle5.pw.a2m.gz # found chain 1jaxA in template set T0191 25 :NIVIY 1jaxA 2 :RVALL Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 7 residues other bump:2.68543 Ang V4.CG1 and Y6.CZ other bump:2.96811 Ang V4.CG1 and Y6.CE2 other bump:2.91432 Ang V4.CG1 and Y6.CE1 T0191 30 :GAGGAARAVAFELAKD 1jaxA 8 :GTGNLGKGLALRLATL Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 18 residues other bump:2.85917 Ang G2.C and A7.CB other bump:2.65143 Ang G2.O and A7.CB other bump:2.73101 Ang G2.CA and A7.CB T0191 46 :NNIIIANRTVEKAEALAKEIAEKLNKKFGEEV 1jaxA 25 :HEIVVGSRREEKAEAKAAEYRRIAGDASITGM Fragment has 50 clashes (null) has 50 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 34 residues other bump:2.87489 Ang I5.CG1 and V33.CG2 other bump:2.47604 Ang I5.CD1 and V33.CG2 other bump:2.8209 Ang I5.CD1 and V33.CG1 other bump:1.67864 Ang E15.N and E32.OE2 other bump:1.79763 Ang K13.C and E32.OE2 other bump:1.0317 Ang A14.N and E32.OE2 other bump:1.54786 Ang A14.CA and E32.OE2 other bump:2.51127 Ang A14.CB and E32.OE2 other bump:1.76559 Ang A14.C and E32.OE2 other bump:0.899862 Ang E15.N and E32.OE1 other bump:1.10488 Ang E15.CA and E32.OE1 other bump:2.24411 Ang E15.C and E32.OE1 other bump:1.61355 Ang E15.CB and E32.OE1 other bump:2.21594 Ang A14.C and E32.OE1 other bump:2.43633 Ang A14.O and E32.CD other bump:0.565897 Ang E15.N and E32.CD other bump:1.99209 Ang E15.CA and E32.CD other bump:3.01536 Ang E15.C and E32.CD other bump:2.81391 Ang E15.CB and E32.CD other bump:2.92884 Ang K13.C and E32.CD other bump:2.23224 Ang A14.N and E32.CD other bump:2.02599 Ang A14.CA and E32.CD other bump:2.66184 Ang A14.CB and E32.CD other bump:1.30434 Ang A14.C and E32.CD other bump:2.191 Ang A14.O and E32.CG other bump:1.70188 Ang E15.N and E32.CG other bump:2.63976 Ang E15.CA and E32.CG other bump:3.04308 Ang A14.N and E32.CG other bump:2.10154 Ang A14.CA and E32.CG other bump:2.0153 Ang A14.CB and E32.CG other bump:1.48782 Ang A14.C and E32.CG other bump:2.38329 Ang A14.O and E32.CB other bump:2.36679 Ang E15.N and E32.CB other bump:2.42495 Ang E15.CA and E32.CB other bump:2.36144 Ang A14.C and E32.CB other bump:2.8852 Ang F29.CD1 and E31.OE1 other bump:1.68779 Ang F29.CE1 and E31.OE1 other bump:2.16903 Ang F29.CZ and E31.OE1 other bump:2.81264 Ang F29.CZ and E31.CD other bump:2.93181 Ang N3.CB and F29.CE2 other bump:3.08236 Ang N3.CG and F29.CE2 other bump:2.76982 Ang N3.CA and F29.CD2 other bump:2.76488 Ang N3.CB and F29.CD2 other bump:2.82356 Ang N3.CG and F29.CD2 other bump:2.95391 Ang L25.CB and K28.CD other bump:2.89819 Ang I6.CD1 and A18.CA other bump:2.52503 Ang I6.CD1 and A18.N other bump:2.46765 Ang V11.CG1 and E15.OE2 other bump:2.85136 Ang N8.ND2 and K13.CE other bump:2.77127 Ang N8.ND2 and K13.CD T0191 81 :GLDV 1jaxA 57 :KNED Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 6 residues T0191 86 :LDGVDIIINATPIGMYPNIDVE 1jaxA 62 :AEACDIAVLTIPWEHAIDTARD Fragment has 8 clashes (null) has 8 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 24 residues neighbor-bump: 2.74793 Ang Y17.CD2 and P18.CD other bump:3.02336 Ang L2.CB and I8.CD1 other bump:2.09297 Ang L2.CG and I8.CD1 other bump:0.9829 Ang L2.CD2 and I8.CD1 other bump:2.81381 Ang V5.CG1 and I8.CG1 other bump:2.5019 Ang L2.CD2 and I8.CG1 other bump:2.70337 Ang V5.CG2 and I7.C other bump:1.98462 Ang V5.CG2 and I7.O T0191 111 :KAEKLREDMVVMDLIYNPLE 1jaxA 84 :LKNILREKIVVSPLVPVSRG Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 22 residues other bump:2.69097 Ang I16.CG1 and N18.ND2 Number of specific fragments= 6 total=744 Number of alignments=135 # Reading fragments from alignment file # T0191 read from T0191-1jaxA-2track-protein-EBGHSTL-global-adpstyle1.pw.a2m.gz # 1jaxA read from T0191-1jaxA-2track-protein-EBGHSTL-global-adpstyle1.pw.a2m.gz # found chain 1jaxA in template set T0191 25 :NIVIYGA 1jaxA 2 :RVALLGG Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 9 residues other bump:2.60548 Ang I5.CB and A8.CB other bump:2.48976 Ang I5.CG2 and A8.CB other bump:2.24555 Ang I5.O and A8.CB other bump:2.91754 Ang I5.C and A8.CB other bump:3.14389 Ang I5.CG2 and A8.CA T0191 32 :GGAARAVAFELAK 1jaxA 10 :GNLGKGLALRLAT Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGLD 1jaxA 24 :GHEIVVGSRREEKAEAKAAEYRRIAGDASITGMKNEDAA Fragment has 81 clashes (null) has 81 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 41 residues other bump:2.93864 Ang V34.CB and L39.CD2 other bump:1.70767 Ang V34.CG2 and L39.CD2 other bump:2.60435 Ang I6.CB and L39.CD2 other bump:1.33969 Ang I6.CG1 and L39.CD2 other bump:1.68413 Ang I6.CD1 and L39.CD2 other bump:2.29645 Ang I7.O and L39.CD1 other bump:2.41783 Ang I7.C and L39.CD1 other bump:2.33376 Ang A8.N and L39.CD1 other bump:2.82692 Ang V34.CG2 and L39.CD1 other bump:2.11126 Ang A8.CA and L39.CD1 other bump:2.55666 Ang A8.CB and L39.CD1 other bump:3.08697 Ang V34.CB and L39.CG other bump:1.60756 Ang V34.CG2 and L39.CG other bump:2.81748 Ang I6.CG1 and L39.CG other bump:2.6943 Ang V34.CG2 and L39.CB other bump:2.91117 Ang V34.CG2 and L39.CA other bump:3.07176 Ang N9.CA and F36.CZ other bump:2.55044 Ang A8.O and F36.CZ other bump:2.99252 Ang A8.C and F36.CZ other bump:2.57132 Ang N9.CA and F36.CE2 other bump:2.78413 Ang N9.C and F36.CE2 other bump:3.14449 Ang R10.N and F36.CE2 other bump:3.06525 Ang N9.N and F36.CE2 other bump:2.92316 Ang A8.CB and F36.CE1 other bump:2.93525 Ang A8.C and F36.CE1 other bump:3.07999 Ang N9.CA and F36.CD2 other bump:2.76539 Ang N9.C and F36.CD2 other bump:2.50446 Ang A8.CB and F36.CD1 other bump:2.61283 Ang V12.CG2 and K35.CE other bump:2.87829 Ang V12.CG2 and K35.CD other bump:2.1409 Ang V12.CG2 and K35.CG other bump:2.87488 Ang I6.CG1 and V34.CG2 other bump:2.47604 Ang I6.CD1 and V34.CG2 other bump:2.8209 Ang I6.CD1 and V34.CG1 other bump:1.76559 Ang A15.C and E33.OE2 other bump:1.67864 Ang E16.N and E33.OE2 other bump:1.79763 Ang K14.C and E33.OE2 other bump:1.0317 Ang A15.N and E33.OE2 other bump:1.54786 Ang A15.CA and E33.OE2 other bump:2.51127 Ang A15.CB and E33.OE2 other bump:2.21594 Ang A15.C and E33.OE1 other bump:0.899862 Ang E16.N and E33.OE1 other bump:1.10488 Ang E16.CA and E33.OE1 other bump:1.61355 Ang E16.CB and E33.OE1 other bump:2.24411 Ang E16.C and E33.OE1 other bump:2.43633 Ang A15.O and E33.CD other bump:1.30434 Ang A15.C and E33.CD other bump:0.565897 Ang E16.N and E33.CD other bump:1.99209 Ang E16.CA and E33.CD other bump:2.81391 Ang E16.CB and E33.CD other bump:3.01536 Ang E16.C and E33.CD other bump:2.92884 Ang K14.C and E33.CD other bump:2.23224 Ang A15.N and E33.CD other bump:2.02599 Ang A15.CA and E33.CD other bump:2.66184 Ang A15.CB and E33.CD other bump:2.191 Ang A15.O and E33.CG other bump:1.48782 Ang A15.C and E33.CG other bump:1.70188 Ang E16.N and E33.CG other bump:2.63976 Ang E16.CA and E33.CG other bump:3.04308 Ang A15.N and E33.CG other bump:2.10154 Ang A15.CA and E33.CG other bump:2.0153 Ang A15.CB and E33.CG other bump:2.38329 Ang A15.O and E33.CB other bump:2.36144 Ang A15.C and E33.CB other bump:2.36679 Ang E16.N and E33.CB other bump:2.42495 Ang E16.CA and E33.CB other bump:2.8852 Ang F30.CD1 and E32.OE1 other bump:1.68779 Ang F30.CE1 and E32.OE1 other bump:2.16903 Ang F30.CZ and E32.OE1 other bump:2.81264 Ang F30.CZ and E32.CD other bump:2.93181 Ang N4.CB and F30.CE2 other bump:3.08236 Ang N4.CG and F30.CE2 other bump:2.76982 Ang N4.CA and F30.CD2 other bump:2.76488 Ang N4.CB and F30.CD2 other bump:2.82356 Ang N4.CG and F30.CD2 other bump:2.95391 Ang L26.CB and K29.CD other bump:2.89819 Ang I7.CD1 and A19.CA other bump:2.52503 Ang I7.CD1 and A19.N other bump:2.46765 Ang V12.CG1 and E16.OE2 other bump:2.85136 Ang N9.ND2 and K14.CE other bump:2.77127 Ang N9.ND2 and K14.CD T0191 87 :DGVDIIINATPIGMYPNIDVE 1jaxA 63 :EACDIAVLTIPWEHAIDTARD Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 23 residues neighbor-bump: 2.74793 Ang Y16.CD2 and P17.CD other bump:2.81381 Ang V4.CG1 and I7.CG1 other bump:2.70337 Ang V4.CG2 and I6.C other bump:1.98462 Ang V4.CG2 and I6.O T0191 108 :PIVKAEKLREDMVVMDLIYNPLETVLLKEAKKVNAK 1jaxA 93 :VVSPLVPVSRGAKGFTYSSERSAAEIVAEVLESEKV Fragment has 70 clashes (null) has 70 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 38 residues other bump:2.25588 Ang V4.CB and K37.NZ other bump:3.11521 Ang V4.CG1 and K37.NZ other bump:2.1992 Ang V4.CG2 and K37.NZ other bump:2.50892 Ang T25.CG2 and K37.NZ other bump:2.28032 Ang T25.CA and K37.CE other bump:2.31396 Ang T25.O and K37.CE other bump:2.60867 Ang T25.C and K37.CE other bump:2.71643 Ang T25.CB and K37.CE other bump:2.37218 Ang T25.CG2 and K37.CE other bump:2.40162 Ang T25.O and K37.CD other bump:3.11636 Ang T25.C and K37.CD other bump:2.5294 Ang T25.CG2 and K37.CD other bump:2.8416 Ang K29.CG and K37.CB other bump:2.77552 Ang P2.CD and A36.O other bump:2.8108 Ang K32.CB and V34.CG2 other bump:2.9644 Ang K8.NZ and L27.CD1 other bump:2.36057 Ang Y20.CE2 and E24.OE2 other bump:2.47883 Ang K8.CB and E24.OE2 other bump:2.20898 Ang Y20.CD2 and E24.OE2 other bump:1.36864 Ang K8.CG and E24.OE2 other bump:1.42014 Ang K8.CD and E24.OE2 other bump:2.07043 Ang K8.CE and E24.OE2 other bump:1.9922 Ang K8.CE and E24.OE1 other bump:2.06577 Ang K8.CG and E24.CD other bump:2.39489 Ang K8.CD and E24.CD other bump:2.30491 Ang K8.CE and E24.CD other bump:2.95175 Ang K8.CG and E24.CG neighbor-bump: 2.5168 Ang N21.OD1 and P22.CG neighbor-bump: 2.17837 Ang N21.OD1 and P22.N self-bump: 1.38544 Ang N21.CA and N21.CB other bump:2.83159 Ang K8.CD and Y20.OH other bump:2.74135 Ang K8.CG and Y20.CZ other bump:1.87032 Ang K8.CD and Y20.CZ other bump:2.59599 Ang K8.CE and Y20.CZ other bump:2.96074 Ang K8.NZ and Y20.CZ other bump:3.12213 Ang K8.CA and Y20.CE2 other bump:1.78549 Ang K8.CB and Y20.CE2 other bump:1.6099 Ang K8.CG and Y20.CE2 other bump:1.34659 Ang K8.CD and Y20.CE2 other bump:2.50181 Ang K8.CD and Y20.CE1 other bump:3.03738 Ang K8.CE and Y20.CE1 other bump:2.73101 Ang K8.NZ and Y20.CE1 other bump:3.22111 Ang K8.CA and Y20.CD2 other bump:1.83838 Ang K8.CB and Y20.CD2 other bump:2.0788 Ang K8.CG and Y20.CD2 other bump:1.68521 Ang K8.CD and Y20.CD2 other bump:2.69649 Ang K8.CD and Y20.CD1 other bump:2.37564 Ang K8.CD and Y20.CG other bump:2.96917 Ang L9.N and I19.CD1 other bump:2.92077 Ang R10.CA and I19.CG2 other bump:2.38392 Ang R10.CB and I19.CG2 other bump:3.10706 Ang L9.C and I19.CG2 other bump:2.56337 Ang R10.N and I19.CG2 other bump:2.96166 Ang L9.N and I19.CG1 other bump:2.72269 Ang K8.C and I19.CG1 neighbor-bump: 3.22045 Ang V15.CG1 and M16.C neighbor-bump: 2.63517 Ang V15.CG1 and M16.O neighbor-bump: 3.22623 Ang V15.CG1 and M16.CA neighbor-bump: 2.2333 Ang V15.CG1 and M16.N other bump:2.81802 Ang D12.OD1 and V15.C other bump:1.91182 Ang D12.OD1 and V15.O neighbor-bump: 2.25192 Ang V14.C and V15.CG2 neighbor-bump: 1.18133 Ang V14.O and V15.CG2 neighbor-bump: 2.47367 Ang V14.C and V15.CB neighbor-bump: 2.0924 Ang V14.O and V15.CB other bump:2.28047 Ang E7.OE1 and L9.CD2 other bump:3.03134 Ang E7.CD and L9.CD1 other bump:2.47947 Ang E7.OE1 and L9.CD1 other bump:2.57183 Ang E7.OE1 and L9.CG other bump:2.86811 Ang I3.CD1 and K5.NZ T0191 144 :TINGLGMLIYQGAVAF 1jaxA 131 :ALHTIPAARFANLDEK Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 18 residues neighbor-bump: 2.95627 Ang T2.OG1 and I3.CD1 neighbor-bump: 3.07725 Ang T2.C and I3.CG1 neighbor-bump: 2.54064 Ang T2.C and I3.CB Number of specific fragments= 6 total=750 Number of alignments=136 # Reading fragments from alignment file # T0191 read from T0191-1jaxA-2track-protein-EBGHSTL-global-adpstyle5.pw.a2m.gz # 1jaxA read from T0191-1jaxA-2track-protein-EBGHSTL-global-adpstyle5.pw.a2m.gz # found chain 1jaxA in template set T0191 25 :NIVIYGA 1jaxA 2 :RVALLGG Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 9 residues other bump:2.60548 Ang I5.CB and A8.CB other bump:2.48976 Ang I5.CG2 and A8.CB other bump:2.24555 Ang I5.O and A8.CB other bump:2.91754 Ang I5.C and A8.CB other bump:3.14389 Ang I5.CG2 and A8.CA T0191 32 :GGAARAVAFELAK 1jaxA 10 :GNLGKGLALRLAT Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGLD 1jaxA 24 :GHEIVVGSRREEKAEAKAAEYRRIAGDASITGMKNEDAA Fragment has 81 clashes (null) has 81 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 41 residues other bump:2.93864 Ang V34.CB and L39.CD2 other bump:1.70767 Ang V34.CG2 and L39.CD2 other bump:2.60435 Ang I6.CB and L39.CD2 other bump:1.33969 Ang I6.CG1 and L39.CD2 other bump:1.68413 Ang I6.CD1 and L39.CD2 other bump:2.29645 Ang I7.O and L39.CD1 other bump:2.41783 Ang I7.C and L39.CD1 other bump:2.33376 Ang A8.N and L39.CD1 other bump:2.82692 Ang V34.CG2 and L39.CD1 other bump:2.11126 Ang A8.CA and L39.CD1 other bump:2.55666 Ang A8.CB and L39.CD1 other bump:3.08697 Ang V34.CB and L39.CG other bump:1.60756 Ang V34.CG2 and L39.CG other bump:2.81748 Ang I6.CG1 and L39.CG other bump:2.6943 Ang V34.CG2 and L39.CB other bump:2.91117 Ang V34.CG2 and L39.CA other bump:3.07176 Ang N9.CA and F36.CZ other bump:2.55044 Ang A8.O and F36.CZ other bump:2.99252 Ang A8.C and F36.CZ other bump:2.57132 Ang N9.CA and F36.CE2 other bump:2.78413 Ang N9.C and F36.CE2 other bump:3.14449 Ang R10.N and F36.CE2 other bump:3.06525 Ang N9.N and F36.CE2 other bump:2.92316 Ang A8.CB and F36.CE1 other bump:2.93525 Ang A8.C and F36.CE1 other bump:3.07999 Ang N9.CA and F36.CD2 other bump:2.76539 Ang N9.C and F36.CD2 other bump:2.50446 Ang A8.CB and F36.CD1 other bump:2.61283 Ang V12.CG2 and K35.CE other bump:2.87829 Ang V12.CG2 and K35.CD other bump:2.1409 Ang V12.CG2 and K35.CG other bump:2.87488 Ang I6.CG1 and V34.CG2 other bump:2.47604 Ang I6.CD1 and V34.CG2 other bump:2.8209 Ang I6.CD1 and V34.CG1 other bump:1.76559 Ang A15.C and E33.OE2 other bump:1.67864 Ang E16.N and E33.OE2 other bump:1.79763 Ang K14.C and E33.OE2 other bump:1.0317 Ang A15.N and E33.OE2 other bump:1.54786 Ang A15.CA and E33.OE2 other bump:2.51127 Ang A15.CB and E33.OE2 other bump:2.21594 Ang A15.C and E33.OE1 other bump:0.899862 Ang E16.N and E33.OE1 other bump:1.10488 Ang E16.CA and E33.OE1 other bump:1.61355 Ang E16.CB and E33.OE1 other bump:2.24411 Ang E16.C and E33.OE1 other bump:2.43633 Ang A15.O and E33.CD other bump:1.30434 Ang A15.C and E33.CD other bump:0.565897 Ang E16.N and E33.CD other bump:1.99209 Ang E16.CA and E33.CD other bump:2.81391 Ang E16.CB and E33.CD other bump:3.01536 Ang E16.C and E33.CD other bump:2.92884 Ang K14.C and E33.CD other bump:2.23224 Ang A15.N and E33.CD other bump:2.02599 Ang A15.CA and E33.CD other bump:2.66184 Ang A15.CB and E33.CD other bump:2.191 Ang A15.O and E33.CG other bump:1.48782 Ang A15.C and E33.CG other bump:1.70188 Ang E16.N and E33.CG other bump:2.63976 Ang E16.CA and E33.CG other bump:3.04308 Ang A15.N and E33.CG other bump:2.10154 Ang A15.CA and E33.CG other bump:2.0153 Ang A15.CB and E33.CG other bump:2.38329 Ang A15.O and E33.CB other bump:2.36144 Ang A15.C and E33.CB other bump:2.36679 Ang E16.N and E33.CB other bump:2.42495 Ang E16.CA and E33.CB other bump:2.8852 Ang F30.CD1 and E32.OE1 other bump:1.68779 Ang F30.CE1 and E32.OE1 other bump:2.16903 Ang F30.CZ and E32.OE1 other bump:2.81264 Ang F30.CZ and E32.CD other bump:2.93181 Ang N4.CB and F30.CE2 other bump:3.08236 Ang N4.CG and F30.CE2 other bump:2.76982 Ang N4.CA and F30.CD2 other bump:2.76488 Ang N4.CB and F30.CD2 other bump:2.82356 Ang N4.CG and F30.CD2 other bump:2.95391 Ang L26.CB and K29.CD other bump:2.89819 Ang I7.CD1 and A19.CA other bump:2.52503 Ang I7.CD1 and A19.N other bump:2.46765 Ang V12.CG1 and E16.OE2 other bump:2.85136 Ang N9.ND2 and K14.CE other bump:2.77127 Ang N9.ND2 and K14.CD T0191 87 :DGVDIIINATPIGMYPNI 1jaxA 63 :EACDIAVLTIPWEHAIDT Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 20 residues neighbor-bump: 2.74793 Ang Y16.CD2 and P17.CD other bump:2.81381 Ang V4.CG1 and I7.CG1 other bump:2.70337 Ang V4.CG2 and I6.C other bump:1.98462 Ang V4.CG2 and I6.O T0191 109 :IVKAEKLREDMVVMDLIYN 1jaxA 81 :ARDLKNILREKIVVSPLVP Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 21 residues other bump:2.47542 Ang D16.OD2 and I18.CB other bump:2.95588 Ang M15.CE and L17.CD1 T0191 144 :TINGLGMLIYQGAVAFK 1jaxA 111 :SERSAAEIVAEVLESEK Fragment has 9 clashes (null) has 9 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 18 residues other bump:3.13807 Ang Y11.OH and F17.CZ other bump:2.16323 Ang Y11.OH and F17.CE1 other bump:2.25085 Ang Y11.OH and F17.CD1 other bump:2.95386 Ang Y11.CE1 and F17.CA other bump:2.8765 Ang Y11.CD1 and A16.C other bump:2.65922 Ang Y11.CE1 and A16.C other bump:1.66922 Ang Y11.CD1 and A16.O other bump:1.73521 Ang Y11.CE1 and A16.O other bump:2.12185 Ang T2.OG1 and N4.O Number of specific fragments= 6 total=756 Number of alignments=137 # Reading fragments from alignment file # T0191 read from T0191-1jaxA-2track-protein-EBGHSTL-local-adpstyle1.pw.a2m.gz # 1jaxA read from T0191-1jaxA-2track-protein-EBGHSTL-local-adpstyle1.pw.a2m.gz # found chain 1jaxA in template set T0191 25 :NIVIYGA 1jaxA 2 :RVALLGG Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 9 residues other bump:2.60548 Ang I5.CB and A8.CB other bump:2.48976 Ang I5.CG2 and A8.CB other bump:2.24555 Ang I5.O and A8.CB other bump:2.91754 Ang I5.C and A8.CB other bump:3.14389 Ang I5.CG2 and A8.CA T0191 32 :GGAARAVAFELAK 1jaxA 10 :GNLGKGLALRLAT Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGLD 1jaxA 24 :GHEIVVGSRREEKAEAKAAEYRRIAGDASITGMKNEDAA Fragment has 81 clashes (null) has 81 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 41 residues other bump:2.93864 Ang V34.CB and L39.CD2 other bump:1.70767 Ang V34.CG2 and L39.CD2 other bump:2.60435 Ang I6.CB and L39.CD2 other bump:1.33969 Ang I6.CG1 and L39.CD2 other bump:1.68413 Ang I6.CD1 and L39.CD2 other bump:2.29645 Ang I7.O and L39.CD1 other bump:2.41783 Ang I7.C and L39.CD1 other bump:2.33376 Ang A8.N and L39.CD1 other bump:2.82692 Ang V34.CG2 and L39.CD1 other bump:2.11126 Ang A8.CA and L39.CD1 other bump:2.55666 Ang A8.CB and L39.CD1 other bump:3.08697 Ang V34.CB and L39.CG other bump:1.60756 Ang V34.CG2 and L39.CG other bump:2.81748 Ang I6.CG1 and L39.CG other bump:2.6943 Ang V34.CG2 and L39.CB other bump:2.91117 Ang V34.CG2 and L39.CA other bump:3.07176 Ang N9.CA and F36.CZ other bump:2.55044 Ang A8.O and F36.CZ other bump:2.99252 Ang A8.C and F36.CZ other bump:2.57132 Ang N9.CA and F36.CE2 other bump:2.78413 Ang N9.C and F36.CE2 other bump:3.14449 Ang R10.N and F36.CE2 other bump:3.06525 Ang N9.N and F36.CE2 other bump:2.92316 Ang A8.CB and F36.CE1 other bump:2.93525 Ang A8.C and F36.CE1 other bump:3.07999 Ang N9.CA and F36.CD2 other bump:2.76539 Ang N9.C and F36.CD2 other bump:2.50446 Ang A8.CB and F36.CD1 other bump:2.61283 Ang V12.CG2 and K35.CE other bump:2.87829 Ang V12.CG2 and K35.CD other bump:2.1409 Ang V12.CG2 and K35.CG other bump:2.87488 Ang I6.CG1 and V34.CG2 other bump:2.47604 Ang I6.CD1 and V34.CG2 other bump:2.8209 Ang I6.CD1 and V34.CG1 other bump:1.76559 Ang A15.C and E33.OE2 other bump:1.67864 Ang E16.N and E33.OE2 other bump:1.79763 Ang K14.C and E33.OE2 other bump:1.0317 Ang A15.N and E33.OE2 other bump:1.54786 Ang A15.CA and E33.OE2 other bump:2.51127 Ang A15.CB and E33.OE2 other bump:2.21594 Ang A15.C and E33.OE1 other bump:0.899862 Ang E16.N and E33.OE1 other bump:1.10488 Ang E16.CA and E33.OE1 other bump:1.61355 Ang E16.CB and E33.OE1 other bump:2.24411 Ang E16.C and E33.OE1 other bump:2.43633 Ang A15.O and E33.CD other bump:1.30434 Ang A15.C and E33.CD other bump:0.565897 Ang E16.N and E33.CD other bump:1.99209 Ang E16.CA and E33.CD other bump:2.81391 Ang E16.CB and E33.CD other bump:3.01536 Ang E16.C and E33.CD other bump:2.92884 Ang K14.C and E33.CD other bump:2.23224 Ang A15.N and E33.CD other bump:2.02599 Ang A15.CA and E33.CD other bump:2.66184 Ang A15.CB and E33.CD other bump:2.191 Ang A15.O and E33.CG other bump:1.48782 Ang A15.C and E33.CG other bump:1.70188 Ang E16.N and E33.CG other bump:2.63976 Ang E16.CA and E33.CG other bump:3.04308 Ang A15.N and E33.CG other bump:2.10154 Ang A15.CA and E33.CG other bump:2.0153 Ang A15.CB and E33.CG other bump:2.38329 Ang A15.O and E33.CB other bump:2.36144 Ang A15.C and E33.CB other bump:2.36679 Ang E16.N and E33.CB other bump:2.42495 Ang E16.CA and E33.CB other bump:2.8852 Ang F30.CD1 and E32.OE1 other bump:1.68779 Ang F30.CE1 and E32.OE1 other bump:2.16903 Ang F30.CZ and E32.OE1 other bump:2.81264 Ang F30.CZ and E32.CD other bump:2.93181 Ang N4.CB and F30.CE2 other bump:3.08236 Ang N4.CG and F30.CE2 other bump:2.76982 Ang N4.CA and F30.CD2 other bump:2.76488 Ang N4.CB and F30.CD2 other bump:2.82356 Ang N4.CG and F30.CD2 other bump:2.95391 Ang L26.CB and K29.CD other bump:2.89819 Ang I7.CD1 and A19.CA other bump:2.52503 Ang I7.CD1 and A19.N other bump:2.46765 Ang V12.CG1 and E16.OE2 other bump:2.85136 Ang N9.ND2 and K14.CE other bump:2.77127 Ang N9.ND2 and K14.CD T0191 87 :DGVDIIINATPIGM 1jaxA 63 :EACDIAVLTIPWEH Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 16 residues other bump:2.81381 Ang V4.CG1 and I7.CG1 other bump:2.70337 Ang V4.CG2 and I6.C other bump:1.98462 Ang V4.CG2 and I6.O Number of specific fragments= 4 total=760 Number of alignments=138 # Reading fragments from alignment file # T0191 read from T0191-1jaxA-2track-protein-EBGHSTL-local-adpstyle5.pw.a2m.gz # 1jaxA read from T0191-1jaxA-2track-protein-EBGHSTL-local-adpstyle5.pw.a2m.gz # found chain 1jaxA in template set T0191 25 :NIVIYGA 1jaxA 2 :RVALLGG Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 9 residues other bump:2.60548 Ang I5.CB and A8.CB other bump:2.48976 Ang I5.CG2 and A8.CB other bump:2.24555 Ang I5.O and A8.CB other bump:2.91754 Ang I5.C and A8.CB other bump:3.14389 Ang I5.CG2 and A8.CA T0191 32 :GGAARAVAFELAK 1jaxA 10 :GNLGKGLALRLAT Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGLD 1jaxA 24 :GHEIVVGSRREEKAEAKAAEYRRIAGDASITGMKNEDAA Fragment has 81 clashes (null) has 81 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 41 residues other bump:2.93864 Ang V34.CB and L39.CD2 other bump:1.70767 Ang V34.CG2 and L39.CD2 other bump:2.60435 Ang I6.CB and L39.CD2 other bump:1.33969 Ang I6.CG1 and L39.CD2 other bump:1.68413 Ang I6.CD1 and L39.CD2 other bump:2.29645 Ang I7.O and L39.CD1 other bump:2.41783 Ang I7.C and L39.CD1 other bump:2.33376 Ang A8.N and L39.CD1 other bump:2.82692 Ang V34.CG2 and L39.CD1 other bump:2.11126 Ang A8.CA and L39.CD1 other bump:2.55666 Ang A8.CB and L39.CD1 other bump:3.08697 Ang V34.CB and L39.CG other bump:1.60756 Ang V34.CG2 and L39.CG other bump:2.81748 Ang I6.CG1 and L39.CG other bump:2.6943 Ang V34.CG2 and L39.CB other bump:2.91117 Ang V34.CG2 and L39.CA other bump:3.07176 Ang N9.CA and F36.CZ other bump:2.55044 Ang A8.O and F36.CZ other bump:2.99252 Ang A8.C and F36.CZ other bump:2.57132 Ang N9.CA and F36.CE2 other bump:2.78413 Ang N9.C and F36.CE2 other bump:3.14449 Ang R10.N and F36.CE2 other bump:3.06525 Ang N9.N and F36.CE2 other bump:2.92316 Ang A8.CB and F36.CE1 other bump:2.93525 Ang A8.C and F36.CE1 other bump:3.07999 Ang N9.CA and F36.CD2 other bump:2.76539 Ang N9.C and F36.CD2 other bump:2.50446 Ang A8.CB and F36.CD1 other bump:2.61283 Ang V12.CG2 and K35.CE other bump:2.87829 Ang V12.CG2 and K35.CD other bump:2.1409 Ang V12.CG2 and K35.CG other bump:2.87488 Ang I6.CG1 and V34.CG2 other bump:2.47604 Ang I6.CD1 and V34.CG2 other bump:2.8209 Ang I6.CD1 and V34.CG1 other bump:1.76559 Ang A15.C and E33.OE2 other bump:1.67864 Ang E16.N and E33.OE2 other bump:1.79763 Ang K14.C and E33.OE2 other bump:1.0317 Ang A15.N and E33.OE2 other bump:1.54786 Ang A15.CA and E33.OE2 other bump:2.51127 Ang A15.CB and E33.OE2 other bump:2.21594 Ang A15.C and E33.OE1 other bump:0.899862 Ang E16.N and E33.OE1 other bump:1.10488 Ang E16.CA and E33.OE1 other bump:1.61355 Ang E16.CB and E33.OE1 other bump:2.24411 Ang E16.C and E33.OE1 other bump:2.43633 Ang A15.O and E33.CD other bump:1.30434 Ang A15.C and E33.CD other bump:0.565897 Ang E16.N and E33.CD other bump:1.99209 Ang E16.CA and E33.CD other bump:2.81391 Ang E16.CB and E33.CD other bump:3.01536 Ang E16.C and E33.CD other bump:2.92884 Ang K14.C and E33.CD other bump:2.23224 Ang A15.N and E33.CD other bump:2.02599 Ang A15.CA and E33.CD other bump:2.66184 Ang A15.CB and E33.CD other bump:2.191 Ang A15.O and E33.CG other bump:1.48782 Ang A15.C and E33.CG other bump:1.70188 Ang E16.N and E33.CG other bump:2.63976 Ang E16.CA and E33.CG other bump:3.04308 Ang A15.N and E33.CG other bump:2.10154 Ang A15.CA and E33.CG other bump:2.0153 Ang A15.CB and E33.CG other bump:2.38329 Ang A15.O and E33.CB other bump:2.36144 Ang A15.C and E33.CB other bump:2.36679 Ang E16.N and E33.CB other bump:2.42495 Ang E16.CA and E33.CB other bump:2.8852 Ang F30.CD1 and E32.OE1 other bump:1.68779 Ang F30.CE1 and E32.OE1 other bump:2.16903 Ang F30.CZ and E32.OE1 other bump:2.81264 Ang F30.CZ and E32.CD other bump:2.93181 Ang N4.CB and F30.CE2 other bump:3.08236 Ang N4.CG and F30.CE2 other bump:2.76982 Ang N4.CA and F30.CD2 other bump:2.76488 Ang N4.CB and F30.CD2 other bump:2.82356 Ang N4.CG and F30.CD2 other bump:2.95391 Ang L26.CB and K29.CD other bump:2.89819 Ang I7.CD1 and A19.CA other bump:2.52503 Ang I7.CD1 and A19.N other bump:2.46765 Ang V12.CG1 and E16.OE2 other bump:2.85136 Ang N9.ND2 and K14.CE other bump:2.77127 Ang N9.ND2 and K14.CD T0191 87 :DGVDIIINATPIGMYPN 1jaxA 63 :EACDIAVLTIPWEHAID Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 19 residues neighbor-bump: 2.74793 Ang Y16.CD2 and P17.CD other bump:2.81381 Ang V4.CG1 and I7.CG1 other bump:2.70337 Ang V4.CG2 and I6.C other bump:1.98462 Ang V4.CG2 and I6.O T0191 108 :PIVKAEKLREDMVVMD 1jaxA 80 :TARDLKNILREKIVVS Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 18 residues Number of specific fragments= 5 total=765 Number of alignments=139 # Reading fragments from alignment file # T0191 read from T0191-1jaxA-2track-protein-EBGHTL-global-adpstyle1.pw.a2m.gz # 1jaxA read from T0191-1jaxA-2track-protein-EBGHTL-global-adpstyle1.pw.a2m.gz # found chain 1jaxA in template set T0191 25 :NIVIYGA 1jaxA 2 :RVALLGG Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 9 residues other bump:2.60548 Ang I5.CB and A8.CB other bump:2.48976 Ang I5.CG2 and A8.CB other bump:2.24555 Ang I5.O and A8.CB other bump:2.91754 Ang I5.C and A8.CB other bump:3.14389 Ang I5.CG2 and A8.CA T0191 32 :GGAARAVAFELAK 1jaxA 10 :GNLGKGLALRLAT Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGLDVD 1jaxA 24 :GHEIVVGSRREEKAEAKAAEYRRIAGDASITGMKNEDAAEA Fragment has 81 clashes (null) has 81 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 43 residues other bump:2.93864 Ang V34.CB and L39.CD2 other bump:1.70767 Ang V34.CG2 and L39.CD2 other bump:2.60435 Ang I6.CB and L39.CD2 other bump:1.33969 Ang I6.CG1 and L39.CD2 other bump:1.68413 Ang I6.CD1 and L39.CD2 other bump:2.29645 Ang I7.O and L39.CD1 other bump:2.41783 Ang I7.C and L39.CD1 other bump:2.33376 Ang A8.N and L39.CD1 other bump:2.82692 Ang V34.CG2 and L39.CD1 other bump:2.11126 Ang A8.CA and L39.CD1 other bump:2.55666 Ang A8.CB and L39.CD1 other bump:3.08697 Ang V34.CB and L39.CG other bump:1.60756 Ang V34.CG2 and L39.CG other bump:2.81748 Ang I6.CG1 and L39.CG other bump:2.6943 Ang V34.CG2 and L39.CB other bump:2.91117 Ang V34.CG2 and L39.CA other bump:3.07176 Ang N9.CA and F36.CZ other bump:2.55044 Ang A8.O and F36.CZ other bump:2.99252 Ang A8.C and F36.CZ other bump:2.57132 Ang N9.CA and F36.CE2 other bump:2.78413 Ang N9.C and F36.CE2 other bump:3.14449 Ang R10.N and F36.CE2 other bump:3.06525 Ang N9.N and F36.CE2 other bump:2.92316 Ang A8.CB and F36.CE1 other bump:2.93525 Ang A8.C and F36.CE1 other bump:3.07999 Ang N9.CA and F36.CD2 other bump:2.76539 Ang N9.C and F36.CD2 other bump:2.50446 Ang A8.CB and F36.CD1 other bump:2.61283 Ang V12.CG2 and K35.CE other bump:2.87829 Ang V12.CG2 and K35.CD other bump:2.1409 Ang V12.CG2 and K35.CG other bump:2.87488 Ang I6.CG1 and V34.CG2 other bump:2.47604 Ang I6.CD1 and V34.CG2 other bump:2.8209 Ang I6.CD1 and V34.CG1 other bump:1.76559 Ang A15.C and E33.OE2 other bump:1.67864 Ang E16.N and E33.OE2 other bump:1.79763 Ang K14.C and E33.OE2 other bump:1.0317 Ang A15.N and E33.OE2 other bump:1.54786 Ang A15.CA and E33.OE2 other bump:2.51127 Ang A15.CB and E33.OE2 other bump:2.21594 Ang A15.C and E33.OE1 other bump:0.899862 Ang E16.N and E33.OE1 other bump:1.10488 Ang E16.CA and E33.OE1 other bump:1.61355 Ang E16.CB and E33.OE1 other bump:2.24411 Ang E16.C and E33.OE1 other bump:2.43633 Ang A15.O and E33.CD other bump:1.30434 Ang A15.C and E33.CD other bump:0.565897 Ang E16.N and E33.CD other bump:1.99209 Ang E16.CA and E33.CD other bump:2.81391 Ang E16.CB and E33.CD other bump:3.01536 Ang E16.C and E33.CD other bump:2.92884 Ang K14.C and E33.CD other bump:2.23224 Ang A15.N and E33.CD other bump:2.02599 Ang A15.CA and E33.CD other bump:2.66184 Ang A15.CB and E33.CD other bump:2.191 Ang A15.O and E33.CG other bump:1.48782 Ang A15.C and E33.CG other bump:1.70188 Ang E16.N and E33.CG other bump:2.63976 Ang E16.CA and E33.CG other bump:3.04308 Ang A15.N and E33.CG other bump:2.10154 Ang A15.CA and E33.CG other bump:2.0153 Ang A15.CB and E33.CG other bump:2.38329 Ang A15.O and E33.CB other bump:2.36144 Ang A15.C and E33.CB other bump:2.36679 Ang E16.N and E33.CB other bump:2.42495 Ang E16.CA and E33.CB other bump:2.8852 Ang F30.CD1 and E32.OE1 other bump:1.68779 Ang F30.CE1 and E32.OE1 other bump:2.16903 Ang F30.CZ and E32.OE1 other bump:2.81264 Ang F30.CZ and E32.CD other bump:2.93181 Ang N4.CB and F30.CE2 other bump:3.08236 Ang N4.CG and F30.CE2 other bump:2.76982 Ang N4.CA and F30.CD2 other bump:2.76488 Ang N4.CB and F30.CD2 other bump:2.82356 Ang N4.CG and F30.CD2 other bump:2.95391 Ang L26.CB and K29.CD other bump:2.89819 Ang I7.CD1 and A19.CA other bump:2.52503 Ang I7.CD1 and A19.N other bump:2.46765 Ang V12.CG1 and E16.OE2 other bump:2.85136 Ang N9.ND2 and K14.CE other bump:2.77127 Ang N9.ND2 and K14.CD T0191 86 :LDGVDIIINATPIG 1jaxA 144 :DEKFDWDVPVCGDD Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 16 residues neighbor-bump: 2.13116 Ang T12.CA and P13.CD neighbor-bump: 2.08048 Ang T12.O and P13.CD neighbor-bump: 1.36377 Ang T12.C and P13.CD neighbor-bump: 2.6059 Ang T12.C and P13.CG other bump:2.6724 Ang V5.CG1 and I7.CG1 T0191 105 :DVEPIVKAEKLR 1jaxA 158 :DESKKVVMSLIS Fragment has 9 clashes (null) has 9 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:2.35232 Ang I6.O and E10.OE2 other bump:2.05718 Ang I6.CG2 and E10.OE2 other bump:0.832866 Ang I6.O and E10.OE1 other bump:1.82127 Ang I6.C and E10.OE1 other bump:2.73839 Ang V7.CA and E10.OE1 other bump:1.75281 Ang I6.O and E10.CD other bump:2.69944 Ang I6.C and E10.CD other bump:2.95342 Ang I6.CG2 and E10.CD other bump:2.76675 Ang D2.OD2 and I6.CD1 T0191 117 :EDMVVMDLI 1jaxA 172 :DGLRPLDAG Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 3.07791 Ang I10.CG2 and G11.CA neighbor-bump: 1.9422 Ang I10.CG2 and G11.N self-bump: 2.38061 Ang I10.CG2 and I10.C self-bump: 1.36301 Ang I10.CA and I10.CB T0191 127 :NPLETVLLKEAK 1jaxA 181 :PLSNSRLVESLT Fragment has 20 clashes (null) has 20 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:2.59737 Ang L8.CA and E11.OE2 other bump:2.72808 Ang L8.C and E11.OE2 other bump:0.443124 Ang V7.O and E11.OE2 other bump:1.15893 Ang V7.C and E11.OE2 other bump:2.07969 Ang L8.N and E11.OE2 other bump:2.39861 Ang V7.CA and E11.OE2 other bump:2.38229 Ang V7.CG1 and E11.OE1 other bump:1.91706 Ang V7.O and E11.OE1 other bump:2.44523 Ang V7.C and E11.OE1 other bump:2.45411 Ang V7.CA and E11.OE1 other bump:2.8782 Ang V7.CG1 and E11.CD other bump:0.890903 Ang V7.O and E11.CD other bump:1.92832 Ang V7.C and E11.CD other bump:2.72132 Ang V7.CA and E11.CD other bump:2.13752 Ang V7.O and E11.CG other bump:3.21973 Ang V7.C and E11.CG other bump:2.01256 Ang N2.O and E5.OE1 other bump:2.61575 Ang N2.C and E5.OE1 other bump:2.66668 Ang N2.OD1 and E5.CD self-bump: 1.38962 Ang P3.N and P3.CD T0191 139 :KVNAKT 1jaxA 206 :ELGIKF Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 8 residues Number of specific fragments= 8 total=773 Number of alignments=140 # Reading fragments from alignment file # T0191 read from T0191-1jaxA-2track-protein-EBGHTL-global-adpstyle5.pw.a2m.gz # 1jaxA read from T0191-1jaxA-2track-protein-EBGHTL-global-adpstyle5.pw.a2m.gz # found chain 1jaxA in template set T0191 25 :NIVIYGA 1jaxA 2 :RVALLGG Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 9 residues other bump:2.60548 Ang I5.CB and A8.CB other bump:2.48976 Ang I5.CG2 and A8.CB other bump:2.24555 Ang I5.O and A8.CB other bump:2.91754 Ang I5.C and A8.CB other bump:3.14389 Ang I5.CG2 and A8.CA T0191 32 :GGAARAVAFELAK 1jaxA 10 :GNLGKGLALRLAT Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKKFGEEVK 1jaxA 24 :GHEIVVGSRREEKAEAKAAEYRRIAGDASITGMK Fragment has 53 clashes (null) has 53 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 36 residues other bump:2.61283 Ang V12.CG2 and K35.CE other bump:2.87829 Ang V12.CG2 and K35.CD other bump:2.1409 Ang V12.CG2 and K35.CG other bump:2.87488 Ang I6.CG1 and V34.CG2 other bump:2.47604 Ang I6.CD1 and V34.CG2 other bump:2.8209 Ang I6.CD1 and V34.CG1 other bump:1.67864 Ang E16.N and E33.OE2 other bump:1.79763 Ang K14.C and E33.OE2 other bump:1.0317 Ang A15.N and E33.OE2 other bump:1.54786 Ang A15.CA and E33.OE2 other bump:2.51127 Ang A15.CB and E33.OE2 other bump:1.76559 Ang A15.C and E33.OE2 other bump:0.899862 Ang E16.N and E33.OE1 other bump:1.10488 Ang E16.CA and E33.OE1 other bump:1.61355 Ang E16.CB and E33.OE1 other bump:2.24411 Ang E16.C and E33.OE1 other bump:2.21594 Ang A15.C and E33.OE1 other bump:2.43633 Ang A15.O and E33.CD other bump:0.565897 Ang E16.N and E33.CD other bump:1.99209 Ang E16.CA and E33.CD other bump:2.81391 Ang E16.CB and E33.CD other bump:3.01536 Ang E16.C and E33.CD other bump:2.92884 Ang K14.C and E33.CD other bump:2.23224 Ang A15.N and E33.CD other bump:2.02599 Ang A15.CA and E33.CD other bump:2.66184 Ang A15.CB and E33.CD other bump:1.30434 Ang A15.C and E33.CD other bump:2.191 Ang A15.O and E33.CG other bump:1.70188 Ang E16.N and E33.CG other bump:2.63976 Ang E16.CA and E33.CG other bump:3.04308 Ang A15.N and E33.CG other bump:2.10154 Ang A15.CA and E33.CG other bump:2.0153 Ang A15.CB and E33.CG other bump:1.48782 Ang A15.C and E33.CG other bump:2.38329 Ang A15.O and E33.CB other bump:2.36679 Ang E16.N and E33.CB other bump:2.42495 Ang E16.CA and E33.CB other bump:2.36144 Ang A15.C and E33.CB other bump:2.8852 Ang F30.CD1 and E32.OE1 other bump:1.68779 Ang F30.CE1 and E32.OE1 other bump:2.16903 Ang F30.CZ and E32.OE1 other bump:2.81264 Ang F30.CZ and E32.CD other bump:2.93181 Ang N4.CB and F30.CE2 other bump:3.08236 Ang N4.CG and F30.CE2 other bump:2.76982 Ang N4.CA and F30.CD2 other bump:2.76488 Ang N4.CB and F30.CD2 other bump:2.82356 Ang N4.CG and F30.CD2 other bump:2.95391 Ang L26.CB and K29.CD other bump:2.89819 Ang I7.CD1 and A19.CA other bump:2.52503 Ang I7.CD1 and A19.N other bump:2.46765 Ang V12.CG1 and E16.OE2 other bump:2.85136 Ang N9.ND2 and K14.CE other bump:2.77127 Ang N9.ND2 and K14.CD T0191 86 :LDGVDIIINATPIGM 1jaxA 144 :DEKFDWDVPVCGDDD Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 17 residues neighbor-bump: 2.13116 Ang T12.CA and P13.CD neighbor-bump: 2.08048 Ang T12.O and P13.CD neighbor-bump: 1.36377 Ang T12.C and P13.CD neighbor-bump: 2.6059 Ang T12.C and P13.CG other bump:2.6724 Ang V5.CG1 and I7.CG1 T0191 106 :VEPIVKAEKLR 1jaxA 159 :ESKKVVMSLIS Fragment has 8 clashes (null) has 8 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 13 residues other bump:2.35232 Ang I5.O and E9.OE2 other bump:2.05718 Ang I5.CG2 and E9.OE2 other bump:0.832866 Ang I5.O and E9.OE1 other bump:1.82127 Ang I5.C and E9.OE1 other bump:2.73839 Ang V6.CA and E9.OE1 other bump:1.75281 Ang I5.O and E9.CD other bump:2.69944 Ang I5.C and E9.CD other bump:2.95342 Ang I5.CG2 and E9.CD T0191 117 :EDMVVMDLI 1jaxA 172 :DGLRPLDAG Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 3.07791 Ang I10.CG2 and G11.CA neighbor-bump: 1.9422 Ang I10.CG2 and G11.N self-bump: 2.38061 Ang I10.CG2 and I10.C self-bump: 1.36301 Ang I10.CA and I10.CB T0191 127 :NPLETVLLKEAK 1jaxA 181 :PLSNSRLVESLT Fragment has 20 clashes (null) has 20 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:2.59737 Ang L8.CA and E11.OE2 other bump:2.72808 Ang L8.C and E11.OE2 other bump:0.443124 Ang V7.O and E11.OE2 other bump:1.15893 Ang V7.C and E11.OE2 other bump:2.07969 Ang L8.N and E11.OE2 other bump:2.39861 Ang V7.CA and E11.OE2 other bump:2.38229 Ang V7.CG1 and E11.OE1 other bump:1.91706 Ang V7.O and E11.OE1 other bump:2.44523 Ang V7.C and E11.OE1 other bump:2.45411 Ang V7.CA and E11.OE1 other bump:2.8782 Ang V7.CG1 and E11.CD other bump:0.890903 Ang V7.O and E11.CD other bump:1.92832 Ang V7.C and E11.CD other bump:2.72132 Ang V7.CA and E11.CD other bump:2.13752 Ang V7.O and E11.CG other bump:3.21973 Ang V7.C and E11.CG other bump:2.01256 Ang N2.O and E5.OE1 other bump:2.61575 Ang N2.C and E5.OE1 other bump:2.66668 Ang N2.OD1 and E5.CD self-bump: 1.38962 Ang P3.N and P3.CD Number of specific fragments= 7 total=780 Number of alignments=141 # Reading fragments from alignment file # T0191 read from T0191-1jaxA-2track-protein-EBGHTL-local-adpstyle1.pw.a2m.gz # 1jaxA read from T0191-1jaxA-2track-protein-EBGHTL-local-adpstyle1.pw.a2m.gz # found chain 1jaxA in template set T0191 25 :NIVIYGA 1jaxA 2 :RVALLGG Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 9 residues other bump:2.60548 Ang I5.CB and A8.CB other bump:2.48976 Ang I5.CG2 and A8.CB other bump:2.24555 Ang I5.O and A8.CB other bump:2.91754 Ang I5.C and A8.CB other bump:3.14389 Ang I5.CG2 and A8.CA T0191 32 :GGAARAVAFELAK 1jaxA 10 :GNLGKGLALRLAT Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGLD 1jaxA 24 :GHEIVVGSRREEKAEAKAAEYRRIAGDASITGMKNEDAA Fragment has 81 clashes (null) has 81 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 41 residues other bump:2.93864 Ang V34.CB and L39.CD2 other bump:1.70767 Ang V34.CG2 and L39.CD2 other bump:2.60435 Ang I6.CB and L39.CD2 other bump:1.33969 Ang I6.CG1 and L39.CD2 other bump:1.68413 Ang I6.CD1 and L39.CD2 other bump:2.29645 Ang I7.O and L39.CD1 other bump:2.41783 Ang I7.C and L39.CD1 other bump:2.33376 Ang A8.N and L39.CD1 other bump:2.82692 Ang V34.CG2 and L39.CD1 other bump:2.11126 Ang A8.CA and L39.CD1 other bump:2.55666 Ang A8.CB and L39.CD1 other bump:3.08697 Ang V34.CB and L39.CG other bump:1.60756 Ang V34.CG2 and L39.CG other bump:2.81748 Ang I6.CG1 and L39.CG other bump:2.6943 Ang V34.CG2 and L39.CB other bump:2.91117 Ang V34.CG2 and L39.CA other bump:3.07176 Ang N9.CA and F36.CZ other bump:2.55044 Ang A8.O and F36.CZ other bump:2.99252 Ang A8.C and F36.CZ other bump:2.57132 Ang N9.CA and F36.CE2 other bump:2.78413 Ang N9.C and F36.CE2 other bump:3.14449 Ang R10.N and F36.CE2 other bump:3.06525 Ang N9.N and F36.CE2 other bump:2.92316 Ang A8.CB and F36.CE1 other bump:2.93525 Ang A8.C and F36.CE1 other bump:3.07999 Ang N9.CA and F36.CD2 other bump:2.76539 Ang N9.C and F36.CD2 other bump:2.50446 Ang A8.CB and F36.CD1 other bump:2.61283 Ang V12.CG2 and K35.CE other bump:2.87829 Ang V12.CG2 and K35.CD other bump:2.1409 Ang V12.CG2 and K35.CG other bump:2.87488 Ang I6.CG1 and V34.CG2 other bump:2.47604 Ang I6.CD1 and V34.CG2 other bump:2.8209 Ang I6.CD1 and V34.CG1 other bump:1.76559 Ang A15.C and E33.OE2 other bump:1.67864 Ang E16.N and E33.OE2 other bump:1.79763 Ang K14.C and E33.OE2 other bump:1.0317 Ang A15.N and E33.OE2 other bump:1.54786 Ang A15.CA and E33.OE2 other bump:2.51127 Ang A15.CB and E33.OE2 other bump:2.21594 Ang A15.C and E33.OE1 other bump:0.899862 Ang E16.N and E33.OE1 other bump:1.10488 Ang E16.CA and E33.OE1 other bump:1.61355 Ang E16.CB and E33.OE1 other bump:2.24411 Ang E16.C and E33.OE1 other bump:2.43633 Ang A15.O and E33.CD other bump:1.30434 Ang A15.C and E33.CD other bump:0.565897 Ang E16.N and E33.CD other bump:1.99209 Ang E16.CA and E33.CD other bump:2.81391 Ang E16.CB and E33.CD other bump:3.01536 Ang E16.C and E33.CD other bump:2.92884 Ang K14.C and E33.CD other bump:2.23224 Ang A15.N and E33.CD other bump:2.02599 Ang A15.CA and E33.CD other bump:2.66184 Ang A15.CB and E33.CD other bump:2.191 Ang A15.O and E33.CG other bump:1.48782 Ang A15.C and E33.CG other bump:1.70188 Ang E16.N and E33.CG other bump:2.63976 Ang E16.CA and E33.CG other bump:3.04308 Ang A15.N and E33.CG other bump:2.10154 Ang A15.CA and E33.CG other bump:2.0153 Ang A15.CB and E33.CG other bump:2.38329 Ang A15.O and E33.CB other bump:2.36144 Ang A15.C and E33.CB other bump:2.36679 Ang E16.N and E33.CB other bump:2.42495 Ang E16.CA and E33.CB other bump:2.8852 Ang F30.CD1 and E32.OE1 other bump:1.68779 Ang F30.CE1 and E32.OE1 other bump:2.16903 Ang F30.CZ and E32.OE1 other bump:2.81264 Ang F30.CZ and E32.CD other bump:2.93181 Ang N4.CB and F30.CE2 other bump:3.08236 Ang N4.CG and F30.CE2 other bump:2.76982 Ang N4.CA and F30.CD2 other bump:2.76488 Ang N4.CB and F30.CD2 other bump:2.82356 Ang N4.CG and F30.CD2 other bump:2.95391 Ang L26.CB and K29.CD other bump:2.89819 Ang I7.CD1 and A19.CA other bump:2.52503 Ang I7.CD1 and A19.N other bump:2.46765 Ang V12.CG1 and E16.OE2 other bump:2.85136 Ang N9.ND2 and K14.CE other bump:2.77127 Ang N9.ND2 and K14.CD T0191 87 :DGVDIIINATPIGM 1jaxA 63 :EACDIAVLTIPWEH Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 16 residues other bump:2.81381 Ang V4.CG1 and I7.CG1 other bump:2.70337 Ang V4.CG2 and I6.C other bump:1.98462 Ang V4.CG2 and I6.O Number of specific fragments= 4 total=784 Number of alignments=142 # Reading fragments from alignment file # T0191 read from T0191-1jaxA-2track-protein-EBGHTL-local-adpstyle5.pw.a2m.gz # 1jaxA read from T0191-1jaxA-2track-protein-EBGHTL-local-adpstyle5.pw.a2m.gz # found chain 1jaxA in template set T0191 25 :NIVIYGA 1jaxA 2 :RVALLGG Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 9 residues other bump:2.60548 Ang I5.CB and A8.CB other bump:2.48976 Ang I5.CG2 and A8.CB other bump:2.24555 Ang I5.O and A8.CB other bump:2.91754 Ang I5.C and A8.CB other bump:3.14389 Ang I5.CG2 and A8.CA T0191 32 :GGAARAVAFELAK 1jaxA 10 :GNLGKGLALRLAT Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGLD 1jaxA 24 :GHEIVVGSRREEKAEAKAAEYRRIAGDASITGMKNEDAA Fragment has 81 clashes (null) has 81 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 41 residues other bump:2.93864 Ang V34.CB and L39.CD2 other bump:1.70767 Ang V34.CG2 and L39.CD2 other bump:2.60435 Ang I6.CB and L39.CD2 other bump:1.33969 Ang I6.CG1 and L39.CD2 other bump:1.68413 Ang I6.CD1 and L39.CD2 other bump:2.29645 Ang I7.O and L39.CD1 other bump:2.41783 Ang I7.C and L39.CD1 other bump:2.33376 Ang A8.N and L39.CD1 other bump:2.82692 Ang V34.CG2 and L39.CD1 other bump:2.11126 Ang A8.CA and L39.CD1 other bump:2.55666 Ang A8.CB and L39.CD1 other bump:3.08697 Ang V34.CB and L39.CG other bump:1.60756 Ang V34.CG2 and L39.CG other bump:2.81748 Ang I6.CG1 and L39.CG other bump:2.6943 Ang V34.CG2 and L39.CB other bump:2.91117 Ang V34.CG2 and L39.CA other bump:3.07176 Ang N9.CA and F36.CZ other bump:2.55044 Ang A8.O and F36.CZ other bump:2.99252 Ang A8.C and F36.CZ other bump:2.57132 Ang N9.CA and F36.CE2 other bump:2.78413 Ang N9.C and F36.CE2 other bump:3.14449 Ang R10.N and F36.CE2 other bump:3.06525 Ang N9.N and F36.CE2 other bump:2.92316 Ang A8.CB and F36.CE1 other bump:2.93525 Ang A8.C and F36.CE1 other bump:3.07999 Ang N9.CA and F36.CD2 other bump:2.76539 Ang N9.C and F36.CD2 other bump:2.50446 Ang A8.CB and F36.CD1 other bump:2.61283 Ang V12.CG2 and K35.CE other bump:2.87829 Ang V12.CG2 and K35.CD other bump:2.1409 Ang V12.CG2 and K35.CG other bump:2.87488 Ang I6.CG1 and V34.CG2 other bump:2.47604 Ang I6.CD1 and V34.CG2 other bump:2.8209 Ang I6.CD1 and V34.CG1 other bump:1.76559 Ang A15.C and E33.OE2 other bump:1.67864 Ang E16.N and E33.OE2 other bump:1.79763 Ang K14.C and E33.OE2 other bump:1.0317 Ang A15.N and E33.OE2 other bump:1.54786 Ang A15.CA and E33.OE2 other bump:2.51127 Ang A15.CB and E33.OE2 other bump:2.21594 Ang A15.C and E33.OE1 other bump:0.899862 Ang E16.N and E33.OE1 other bump:1.10488 Ang E16.CA and E33.OE1 other bump:1.61355 Ang E16.CB and E33.OE1 other bump:2.24411 Ang E16.C and E33.OE1 other bump:2.43633 Ang A15.O and E33.CD other bump:1.30434 Ang A15.C and E33.CD other bump:0.565897 Ang E16.N and E33.CD other bump:1.99209 Ang E16.CA and E33.CD other bump:2.81391 Ang E16.CB and E33.CD other bump:3.01536 Ang E16.C and E33.CD other bump:2.92884 Ang K14.C and E33.CD other bump:2.23224 Ang A15.N and E33.CD other bump:2.02599 Ang A15.CA and E33.CD other bump:2.66184 Ang A15.CB and E33.CD other bump:2.191 Ang A15.O and E33.CG other bump:1.48782 Ang A15.C and E33.CG other bump:1.70188 Ang E16.N and E33.CG other bump:2.63976 Ang E16.CA and E33.CG other bump:3.04308 Ang A15.N and E33.CG other bump:2.10154 Ang A15.CA and E33.CG other bump:2.0153 Ang A15.CB and E33.CG other bump:2.38329 Ang A15.O and E33.CB other bump:2.36144 Ang A15.C and E33.CB other bump:2.36679 Ang E16.N and E33.CB other bump:2.42495 Ang E16.CA and E33.CB other bump:2.8852 Ang F30.CD1 and E32.OE1 other bump:1.68779 Ang F30.CE1 and E32.OE1 other bump:2.16903 Ang F30.CZ and E32.OE1 other bump:2.81264 Ang F30.CZ and E32.CD other bump:2.93181 Ang N4.CB and F30.CE2 other bump:3.08236 Ang N4.CG and F30.CE2 other bump:2.76982 Ang N4.CA and F30.CD2 other bump:2.76488 Ang N4.CB and F30.CD2 other bump:2.82356 Ang N4.CG and F30.CD2 other bump:2.95391 Ang L26.CB and K29.CD other bump:2.89819 Ang I7.CD1 and A19.CA other bump:2.52503 Ang I7.CD1 and A19.N other bump:2.46765 Ang V12.CG1 and E16.OE2 other bump:2.85136 Ang N9.ND2 and K14.CE other bump:2.77127 Ang N9.ND2 and K14.CD T0191 87 :DGVDIIINATPIGMYPN 1jaxA 63 :EACDIAVLTIPWEHAID Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 19 residues neighbor-bump: 2.74793 Ang Y16.CD2 and P17.CD other bump:2.81381 Ang V4.CG1 and I7.CG1 other bump:2.70337 Ang V4.CG2 and I6.C other bump:1.98462 Ang V4.CG2 and I6.O T0191 108 :PIVKAE 1jaxA 80 :TARDLK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 8 residues T0191 114 :KLREDMVVM 1jaxA 87 :ILREKIVVS Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 6 total=790 Number of alignments=143 # Reading fragments from alignment file # T0191 read from T0191-1jaxA-2track-protein-STR-global-adpstyle1.pw.a2m.gz # 1jaxA read from T0191-1jaxA-2track-protein-STR-global-adpstyle1.pw.a2m.gz # found chain 1jaxA in template set T0191 25 :NIVIYGA 1jaxA 2 :RVALLGG Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 9 residues other bump:2.60548 Ang I5.CB and A8.CB other bump:2.48976 Ang I5.CG2 and A8.CB other bump:2.24555 Ang I5.O and A8.CB other bump:2.91754 Ang I5.C and A8.CB other bump:3.14389 Ang I5.CG2 and A8.CA T0191 32 :GGAARAVAFELAK 1jaxA 10 :GNLGKGLALRLAT Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGLD 1jaxA 24 :GHEIVVGSRREEKAEAKAAEYRRIAGDASITGMKNEDAA Fragment has 81 clashes (null) has 81 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 41 residues other bump:2.93864 Ang V34.CB and L39.CD2 other bump:1.70767 Ang V34.CG2 and L39.CD2 other bump:2.60435 Ang I6.CB and L39.CD2 other bump:1.33969 Ang I6.CG1 and L39.CD2 other bump:1.68413 Ang I6.CD1 and L39.CD2 other bump:2.29645 Ang I7.O and L39.CD1 other bump:2.41783 Ang I7.C and L39.CD1 other bump:2.33376 Ang A8.N and L39.CD1 other bump:2.82692 Ang V34.CG2 and L39.CD1 other bump:2.11126 Ang A8.CA and L39.CD1 other bump:2.55666 Ang A8.CB and L39.CD1 other bump:3.08697 Ang V34.CB and L39.CG other bump:1.60756 Ang V34.CG2 and L39.CG other bump:2.81748 Ang I6.CG1 and L39.CG other bump:2.6943 Ang V34.CG2 and L39.CB other bump:2.91117 Ang V34.CG2 and L39.CA other bump:3.07176 Ang N9.CA and F36.CZ other bump:2.55044 Ang A8.O and F36.CZ other bump:2.99252 Ang A8.C and F36.CZ other bump:2.57132 Ang N9.CA and F36.CE2 other bump:2.78413 Ang N9.C and F36.CE2 other bump:3.14449 Ang R10.N and F36.CE2 other bump:3.06525 Ang N9.N and F36.CE2 other bump:2.92316 Ang A8.CB and F36.CE1 other bump:2.93525 Ang A8.C and F36.CE1 other bump:3.07999 Ang N9.CA and F36.CD2 other bump:2.76539 Ang N9.C and F36.CD2 other bump:2.50446 Ang A8.CB and F36.CD1 other bump:2.61283 Ang V12.CG2 and K35.CE other bump:2.87829 Ang V12.CG2 and K35.CD other bump:2.1409 Ang V12.CG2 and K35.CG other bump:2.87488 Ang I6.CG1 and V34.CG2 other bump:2.47604 Ang I6.CD1 and V34.CG2 other bump:2.8209 Ang I6.CD1 and V34.CG1 other bump:1.76559 Ang A15.C and E33.OE2 other bump:1.67864 Ang E16.N and E33.OE2 other bump:1.79763 Ang K14.C and E33.OE2 other bump:1.0317 Ang A15.N and E33.OE2 other bump:1.54786 Ang A15.CA and E33.OE2 other bump:2.51127 Ang A15.CB and E33.OE2 other bump:2.21594 Ang A15.C and E33.OE1 other bump:0.899862 Ang E16.N and E33.OE1 other bump:1.10488 Ang E16.CA and E33.OE1 other bump:1.61355 Ang E16.CB and E33.OE1 other bump:2.24411 Ang E16.C and E33.OE1 other bump:2.43633 Ang A15.O and E33.CD other bump:1.30434 Ang A15.C and E33.CD other bump:0.565897 Ang E16.N and E33.CD other bump:1.99209 Ang E16.CA and E33.CD other bump:2.81391 Ang E16.CB and E33.CD other bump:3.01536 Ang E16.C and E33.CD other bump:2.92884 Ang K14.C and E33.CD other bump:2.23224 Ang A15.N and E33.CD other bump:2.02599 Ang A15.CA and E33.CD other bump:2.66184 Ang A15.CB and E33.CD other bump:2.191 Ang A15.O and E33.CG other bump:1.48782 Ang A15.C and E33.CG other bump:1.70188 Ang E16.N and E33.CG other bump:2.63976 Ang E16.CA and E33.CG other bump:3.04308 Ang A15.N and E33.CG other bump:2.10154 Ang A15.CA and E33.CG other bump:2.0153 Ang A15.CB and E33.CG other bump:2.38329 Ang A15.O and E33.CB other bump:2.36144 Ang A15.C and E33.CB other bump:2.36679 Ang E16.N and E33.CB other bump:2.42495 Ang E16.CA and E33.CB other bump:2.8852 Ang F30.CD1 and E32.OE1 other bump:1.68779 Ang F30.CE1 and E32.OE1 other bump:2.16903 Ang F30.CZ and E32.OE1 other bump:2.81264 Ang F30.CZ and E32.CD other bump:2.93181 Ang N4.CB and F30.CE2 other bump:3.08236 Ang N4.CG and F30.CE2 other bump:2.76982 Ang N4.CA and F30.CD2 other bump:2.76488 Ang N4.CB and F30.CD2 other bump:2.82356 Ang N4.CG and F30.CD2 other bump:2.95391 Ang L26.CB and K29.CD other bump:2.89819 Ang I7.CD1 and A19.CA other bump:2.52503 Ang I7.CD1 and A19.N other bump:2.46765 Ang V12.CG1 and E16.OE2 other bump:2.85136 Ang N9.ND2 and K14.CE other bump:2.77127 Ang N9.ND2 and K14.CD T0191 87 :DGVDIIINATPIGMYP 1jaxA 63 :EACDIAVLTIPWEHAI Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 18 residues neighbor-bump: 2.74792 Ang Y16.CD2 and P17.CD other bump:2.81381 Ang V4.CG1 and I7.CG1 other bump:2.70337 Ang V4.CG2 and I6.C other bump:1.98462 Ang V4.CG2 and I6.O T0191 106 :VEPIVKAEKLREDMVVMDLI 1jaxA 79 :DTARDLKNILREKIVVSPLV Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 22 residues other bump:3.07213 Ang G1.C and P4.CD T0191 126 :YNPLETVLLKEAKKVNAK 1jaxA 109 :YSSERSAAEIVAEVLESE Fragment has 11 clashes (null) has 11 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 20 residues other bump:2.95556 Ang V16.CG1 and A18.CB other bump:2.27092 Ang V8.CG1 and E12.OE2 other bump:1.09645 Ang V8.O and E12.OE1 other bump:1.97665 Ang V8.C and E12.OE1 other bump:2.59762 Ang L9.CA and E12.OE1 other bump:3.15187 Ang V8.CG1 and E12.CD other bump:1.9506 Ang V8.O and E12.CD other bump:2.82767 Ang V8.C and E12.CD neighbor-bump: 2.53522 Ang N3.N and P4.CD neighbor-bump: 2.13017 Ang N3.C and P4.CD neighbor-bump: 2.61461 Ang N3.ND2 and P4.CD T0191 144 :TINGLGMLIYQGAVAFK 1jaxA 128 :VVSALHTIPAARFANLD Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 18 residues Number of specific fragments= 7 total=797 Number of alignments=144 # Reading fragments from alignment file # T0191 read from T0191-1jaxA-2track-protein-STR-global-adpstyle5.pw.a2m.gz # 1jaxA read from T0191-1jaxA-2track-protein-STR-global-adpstyle5.pw.a2m.gz # found chain 1jaxA in template set T0191 25 :NIVIYGA 1jaxA 2 :RVALLGG Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 9 residues other bump:2.60548 Ang I5.CB and A8.CB other bump:2.48976 Ang I5.CG2 and A8.CB other bump:2.24555 Ang I5.O and A8.CB other bump:2.91754 Ang I5.C and A8.CB other bump:3.14389 Ang I5.CG2 and A8.CA T0191 32 :GGAARAVAFELAK 1jaxA 10 :GNLGKGLALRLAT Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGLD 1jaxA 24 :GHEIVVGSRREEKAEAKAAEYRRIAGDASITGMKNEDAA Fragment has 81 clashes (null) has 81 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 41 residues other bump:2.93864 Ang V34.CB and L39.CD2 other bump:1.70767 Ang V34.CG2 and L39.CD2 other bump:2.60435 Ang I6.CB and L39.CD2 other bump:1.33969 Ang I6.CG1 and L39.CD2 other bump:1.68413 Ang I6.CD1 and L39.CD2 other bump:2.29645 Ang I7.O and L39.CD1 other bump:2.41783 Ang I7.C and L39.CD1 other bump:2.33376 Ang A8.N and L39.CD1 other bump:2.82692 Ang V34.CG2 and L39.CD1 other bump:2.11126 Ang A8.CA and L39.CD1 other bump:2.55666 Ang A8.CB and L39.CD1 other bump:3.08697 Ang V34.CB and L39.CG other bump:1.60756 Ang V34.CG2 and L39.CG other bump:2.81748 Ang I6.CG1 and L39.CG other bump:2.6943 Ang V34.CG2 and L39.CB other bump:2.91117 Ang V34.CG2 and L39.CA other bump:3.07176 Ang N9.CA and F36.CZ other bump:2.55044 Ang A8.O and F36.CZ other bump:2.99252 Ang A8.C and F36.CZ other bump:2.57132 Ang N9.CA and F36.CE2 other bump:2.78413 Ang N9.C and F36.CE2 other bump:3.14449 Ang R10.N and F36.CE2 other bump:3.06525 Ang N9.N and F36.CE2 other bump:2.92316 Ang A8.CB and F36.CE1 other bump:2.93525 Ang A8.C and F36.CE1 other bump:3.07999 Ang N9.CA and F36.CD2 other bump:2.76539 Ang N9.C and F36.CD2 other bump:2.50446 Ang A8.CB and F36.CD1 other bump:2.61283 Ang V12.CG2 and K35.CE other bump:2.87829 Ang V12.CG2 and K35.CD other bump:2.1409 Ang V12.CG2 and K35.CG other bump:2.87488 Ang I6.CG1 and V34.CG2 other bump:2.47604 Ang I6.CD1 and V34.CG2 other bump:2.8209 Ang I6.CD1 and V34.CG1 other bump:1.76559 Ang A15.C and E33.OE2 other bump:1.67864 Ang E16.N and E33.OE2 other bump:1.79763 Ang K14.C and E33.OE2 other bump:1.0317 Ang A15.N and E33.OE2 other bump:1.54786 Ang A15.CA and E33.OE2 other bump:2.51127 Ang A15.CB and E33.OE2 other bump:2.21594 Ang A15.C and E33.OE1 other bump:0.899862 Ang E16.N and E33.OE1 other bump:1.10488 Ang E16.CA and E33.OE1 other bump:1.61355 Ang E16.CB and E33.OE1 other bump:2.24411 Ang E16.C and E33.OE1 other bump:2.43633 Ang A15.O and E33.CD other bump:1.30434 Ang A15.C and E33.CD other bump:0.565897 Ang E16.N and E33.CD other bump:1.99209 Ang E16.CA and E33.CD other bump:2.81391 Ang E16.CB and E33.CD other bump:3.01536 Ang E16.C and E33.CD other bump:2.92884 Ang K14.C and E33.CD other bump:2.23224 Ang A15.N and E33.CD other bump:2.02599 Ang A15.CA and E33.CD other bump:2.66184 Ang A15.CB and E33.CD other bump:2.191 Ang A15.O and E33.CG other bump:1.48782 Ang A15.C and E33.CG other bump:1.70188 Ang E16.N and E33.CG other bump:2.63976 Ang E16.CA and E33.CG other bump:3.04308 Ang A15.N and E33.CG other bump:2.10154 Ang A15.CA and E33.CG other bump:2.0153 Ang A15.CB and E33.CG other bump:2.38329 Ang A15.O and E33.CB other bump:2.36144 Ang A15.C and E33.CB other bump:2.36679 Ang E16.N and E33.CB other bump:2.42495 Ang E16.CA and E33.CB other bump:2.8852 Ang F30.CD1 and E32.OE1 other bump:1.68779 Ang F30.CE1 and E32.OE1 other bump:2.16903 Ang F30.CZ and E32.OE1 other bump:2.81264 Ang F30.CZ and E32.CD other bump:2.93181 Ang N4.CB and F30.CE2 other bump:3.08236 Ang N4.CG and F30.CE2 other bump:2.76982 Ang N4.CA and F30.CD2 other bump:2.76488 Ang N4.CB and F30.CD2 other bump:2.82356 Ang N4.CG and F30.CD2 other bump:2.95391 Ang L26.CB and K29.CD other bump:2.89819 Ang I7.CD1 and A19.CA other bump:2.52503 Ang I7.CD1 and A19.N other bump:2.46765 Ang V12.CG1 and E16.OE2 other bump:2.85136 Ang N9.ND2 and K14.CE other bump:2.77127 Ang N9.ND2 and K14.CD T0191 87 :DGVDIIINATPIGMYPNIDVE 1jaxA 63 :EACDIAVLTIPWEHAIDTARD Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 23 residues neighbor-bump: 2.74793 Ang Y16.CD2 and P17.CD other bump:2.81381 Ang V4.CG1 and I7.CG1 other bump:2.70337 Ang V4.CG2 and I6.C other bump:1.98462 Ang V4.CG2 and I6.O T0191 149 :GMLIYQGA 1jaxA 133 :HTIPAARF Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 10 residues Number of specific fragments= 5 total=802 Number of alignments=145 # Reading fragments from alignment file # T0191 read from T0191-1jaxA-2track-protein-STR-local-adpstyle1.pw.a2m.gz # 1jaxA read from T0191-1jaxA-2track-protein-STR-local-adpstyle1.pw.a2m.gz # found chain 1jaxA in template set T0191 25 :NIVIYGA 1jaxA 2 :RVALLGG Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 9 residues other bump:2.60548 Ang I5.CB and A8.CB other bump:2.48976 Ang I5.CG2 and A8.CB other bump:2.24555 Ang I5.O and A8.CB other bump:2.91754 Ang I5.C and A8.CB other bump:3.14389 Ang I5.CG2 and A8.CA T0191 32 :GGAARAVAFELAK 1jaxA 10 :GNLGKGLALRLAT Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGLD 1jaxA 24 :GHEIVVGSRREEKAEAKAAEYRRIAGDASITGMKNEDAA Fragment has 81 clashes (null) has 81 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 41 residues other bump:2.93864 Ang V34.CB and L39.CD2 other bump:1.70767 Ang V34.CG2 and L39.CD2 other bump:2.60435 Ang I6.CB and L39.CD2 other bump:1.33969 Ang I6.CG1 and L39.CD2 other bump:1.68413 Ang I6.CD1 and L39.CD2 other bump:2.29645 Ang I7.O and L39.CD1 other bump:2.41783 Ang I7.C and L39.CD1 other bump:2.33376 Ang A8.N and L39.CD1 other bump:2.82692 Ang V34.CG2 and L39.CD1 other bump:2.11126 Ang A8.CA and L39.CD1 other bump:2.55666 Ang A8.CB and L39.CD1 other bump:3.08697 Ang V34.CB and L39.CG other bump:1.60756 Ang V34.CG2 and L39.CG other bump:2.81748 Ang I6.CG1 and L39.CG other bump:2.6943 Ang V34.CG2 and L39.CB other bump:2.91117 Ang V34.CG2 and L39.CA other bump:3.07176 Ang N9.CA and F36.CZ other bump:2.55044 Ang A8.O and F36.CZ other bump:2.99252 Ang A8.C and F36.CZ other bump:2.57132 Ang N9.CA and F36.CE2 other bump:2.78413 Ang N9.C and F36.CE2 other bump:3.14449 Ang R10.N and F36.CE2 other bump:3.06525 Ang N9.N and F36.CE2 other bump:2.92316 Ang A8.CB and F36.CE1 other bump:2.93525 Ang A8.C and F36.CE1 other bump:3.07999 Ang N9.CA and F36.CD2 other bump:2.76539 Ang N9.C and F36.CD2 other bump:2.50446 Ang A8.CB and F36.CD1 other bump:2.61283 Ang V12.CG2 and K35.CE other bump:2.87829 Ang V12.CG2 and K35.CD other bump:2.1409 Ang V12.CG2 and K35.CG other bump:2.87488 Ang I6.CG1 and V34.CG2 other bump:2.47604 Ang I6.CD1 and V34.CG2 other bump:2.8209 Ang I6.CD1 and V34.CG1 other bump:1.76559 Ang A15.C and E33.OE2 other bump:1.67864 Ang E16.N and E33.OE2 other bump:1.79763 Ang K14.C and E33.OE2 other bump:1.0317 Ang A15.N and E33.OE2 other bump:1.54786 Ang A15.CA and E33.OE2 other bump:2.51127 Ang A15.CB and E33.OE2 other bump:2.21594 Ang A15.C and E33.OE1 other bump:0.899862 Ang E16.N and E33.OE1 other bump:1.10488 Ang E16.CA and E33.OE1 other bump:1.61355 Ang E16.CB and E33.OE1 other bump:2.24411 Ang E16.C and E33.OE1 other bump:2.43633 Ang A15.O and E33.CD other bump:1.30434 Ang A15.C and E33.CD other bump:0.565897 Ang E16.N and E33.CD other bump:1.99209 Ang E16.CA and E33.CD other bump:2.81391 Ang E16.CB and E33.CD other bump:3.01536 Ang E16.C and E33.CD other bump:2.92884 Ang K14.C and E33.CD other bump:2.23224 Ang A15.N and E33.CD other bump:2.02599 Ang A15.CA and E33.CD other bump:2.66184 Ang A15.CB and E33.CD other bump:2.191 Ang A15.O and E33.CG other bump:1.48782 Ang A15.C and E33.CG other bump:1.70188 Ang E16.N and E33.CG other bump:2.63976 Ang E16.CA and E33.CG other bump:3.04308 Ang A15.N and E33.CG other bump:2.10154 Ang A15.CA and E33.CG other bump:2.0153 Ang A15.CB and E33.CG other bump:2.38329 Ang A15.O and E33.CB other bump:2.36144 Ang A15.C and E33.CB other bump:2.36679 Ang E16.N and E33.CB other bump:2.42495 Ang E16.CA and E33.CB other bump:2.8852 Ang F30.CD1 and E32.OE1 other bump:1.68779 Ang F30.CE1 and E32.OE1 other bump:2.16903 Ang F30.CZ and E32.OE1 other bump:2.81264 Ang F30.CZ and E32.CD other bump:2.93181 Ang N4.CB and F30.CE2 other bump:3.08236 Ang N4.CG and F30.CE2 other bump:2.76982 Ang N4.CA and F30.CD2 other bump:2.76488 Ang N4.CB and F30.CD2 other bump:2.82356 Ang N4.CG and F30.CD2 other bump:2.95391 Ang L26.CB and K29.CD other bump:2.89819 Ang I7.CD1 and A19.CA other bump:2.52503 Ang I7.CD1 and A19.N other bump:2.46765 Ang V12.CG1 and E16.OE2 other bump:2.85136 Ang N9.ND2 and K14.CE other bump:2.77127 Ang N9.ND2 and K14.CD T0191 87 :DGVDIIINATPIGMYP 1jaxA 63 :EACDIAVLTIPWEHAI Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 18 residues neighbor-bump: 2.74792 Ang Y16.CD2 and P17.CD other bump:2.81381 Ang V4.CG1 and I7.CG1 other bump:2.70337 Ang V4.CG2 and I6.C other bump:1.98462 Ang V4.CG2 and I6.O T0191 107 :EPIVKAEKLREDMVVMDLIYN 1jaxA 79 :DTARDLKNILREKIVVSPLVP Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 23 residues other bump:2.47542 Ang D18.OD2 and I20.CB other bump:2.95588 Ang M17.CE and L19.CD1 Number of specific fragments= 5 total=807 Number of alignments=146 # Reading fragments from alignment file # T0191 read from T0191-1jaxA-2track-protein-STR-local-adpstyle5.pw.a2m.gz # 1jaxA read from T0191-1jaxA-2track-protein-STR-local-adpstyle5.pw.a2m.gz # found chain 1jaxA in template set T0191 25 :NIVIYGA 1jaxA 2 :RVALLGG Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 9 residues other bump:2.60548 Ang I5.CB and A8.CB other bump:2.48976 Ang I5.CG2 and A8.CB other bump:2.24555 Ang I5.O and A8.CB other bump:2.91754 Ang I5.C and A8.CB other bump:3.14389 Ang I5.CG2 and A8.CA T0191 32 :GGAARAVAFELAK 1jaxA 10 :GNLGKGLALRLAT Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGLD 1jaxA 24 :GHEIVVGSRREEKAEAKAAEYRRIAGDASITGMKNEDAA Fragment has 81 clashes (null) has 81 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 41 residues other bump:2.93864 Ang V34.CB and L39.CD2 other bump:1.70767 Ang V34.CG2 and L39.CD2 other bump:2.60435 Ang I6.CB and L39.CD2 other bump:1.33969 Ang I6.CG1 and L39.CD2 other bump:1.68413 Ang I6.CD1 and L39.CD2 other bump:2.29645 Ang I7.O and L39.CD1 other bump:2.41783 Ang I7.C and L39.CD1 other bump:2.33376 Ang A8.N and L39.CD1 other bump:2.82692 Ang V34.CG2 and L39.CD1 other bump:2.11126 Ang A8.CA and L39.CD1 other bump:2.55666 Ang A8.CB and L39.CD1 other bump:3.08697 Ang V34.CB and L39.CG other bump:1.60756 Ang V34.CG2 and L39.CG other bump:2.81748 Ang I6.CG1 and L39.CG other bump:2.6943 Ang V34.CG2 and L39.CB other bump:2.91117 Ang V34.CG2 and L39.CA other bump:3.07176 Ang N9.CA and F36.CZ other bump:2.55044 Ang A8.O and F36.CZ other bump:2.99252 Ang A8.C and F36.CZ other bump:2.57132 Ang N9.CA and F36.CE2 other bump:2.78413 Ang N9.C and F36.CE2 other bump:3.14449 Ang R10.N and F36.CE2 other bump:3.06525 Ang N9.N and F36.CE2 other bump:2.92316 Ang A8.CB and F36.CE1 other bump:2.93525 Ang A8.C and F36.CE1 other bump:3.07999 Ang N9.CA and F36.CD2 other bump:2.76539 Ang N9.C and F36.CD2 other bump:2.50446 Ang A8.CB and F36.CD1 other bump:2.61283 Ang V12.CG2 and K35.CE other bump:2.87829 Ang V12.CG2 and K35.CD other bump:2.1409 Ang V12.CG2 and K35.CG other bump:2.87488 Ang I6.CG1 and V34.CG2 other bump:2.47604 Ang I6.CD1 and V34.CG2 other bump:2.8209 Ang I6.CD1 and V34.CG1 other bump:1.76559 Ang A15.C and E33.OE2 other bump:1.67864 Ang E16.N and E33.OE2 other bump:1.79763 Ang K14.C and E33.OE2 other bump:1.0317 Ang A15.N and E33.OE2 other bump:1.54786 Ang A15.CA and E33.OE2 other bump:2.51127 Ang A15.CB and E33.OE2 other bump:2.21594 Ang A15.C and E33.OE1 other bump:0.899862 Ang E16.N and E33.OE1 other bump:1.10488 Ang E16.CA and E33.OE1 other bump:1.61355 Ang E16.CB and E33.OE1 other bump:2.24411 Ang E16.C and E33.OE1 other bump:2.43633 Ang A15.O and E33.CD other bump:1.30434 Ang A15.C and E33.CD other bump:0.565897 Ang E16.N and E33.CD other bump:1.99209 Ang E16.CA and E33.CD other bump:2.81391 Ang E16.CB and E33.CD other bump:3.01536 Ang E16.C and E33.CD other bump:2.92884 Ang K14.C and E33.CD other bump:2.23224 Ang A15.N and E33.CD other bump:2.02599 Ang A15.CA and E33.CD other bump:2.66184 Ang A15.CB and E33.CD other bump:2.191 Ang A15.O and E33.CG other bump:1.48782 Ang A15.C and E33.CG other bump:1.70188 Ang E16.N and E33.CG other bump:2.63976 Ang E16.CA and E33.CG other bump:3.04308 Ang A15.N and E33.CG other bump:2.10154 Ang A15.CA and E33.CG other bump:2.0153 Ang A15.CB and E33.CG other bump:2.38329 Ang A15.O and E33.CB other bump:2.36144 Ang A15.C and E33.CB other bump:2.36679 Ang E16.N and E33.CB other bump:2.42495 Ang E16.CA and E33.CB other bump:2.8852 Ang F30.CD1 and E32.OE1 other bump:1.68779 Ang F30.CE1 and E32.OE1 other bump:2.16903 Ang F30.CZ and E32.OE1 other bump:2.81264 Ang F30.CZ and E32.CD other bump:2.93181 Ang N4.CB and F30.CE2 other bump:3.08236 Ang N4.CG and F30.CE2 other bump:2.76982 Ang N4.CA and F30.CD2 other bump:2.76488 Ang N4.CB and F30.CD2 other bump:2.82356 Ang N4.CG and F30.CD2 other bump:2.95391 Ang L26.CB and K29.CD other bump:2.89819 Ang I7.CD1 and A19.CA other bump:2.52503 Ang I7.CD1 and A19.N other bump:2.46765 Ang V12.CG1 and E16.OE2 other bump:2.85136 Ang N9.ND2 and K14.CE other bump:2.77127 Ang N9.ND2 and K14.CD T0191 87 :DGVDIIINATPIGMYPN 1jaxA 63 :EACDIAVLTIPWEHAID Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 19 residues neighbor-bump: 2.74793 Ang Y16.CD2 and P17.CD other bump:2.81381 Ang V4.CG1 and I7.CG1 other bump:2.70337 Ang V4.CG2 and I6.C other bump:1.98462 Ang V4.CG2 and I6.O T0191 108 :PIVKAEKLREDMVVMDLIY 1jaxA 80 :TARDLKNILREKIVVSPLV Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 21 residues other bump:2.47542 Ang D17.OD2 and I19.CB other bump:2.95588 Ang M16.CE and L18.CD1 Number of specific fragments= 5 total=812 Number of alignments=147 # Reading fragments from alignment file # T0191 read from T0191-1jaxA-local-adpstyle1.pw.a2m.gz # 1jaxA read from T0191-1jaxA-local-adpstyle1.pw.a2m.gz # found chain 1jaxA in template set T0191 24 :KNIVIYGAGGAARAVAFELAK 1jaxA 2 :RVALLGGTGNLGKGLALRLAT Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 23 residues other bump:2.65143 Ang G8.O and A13.CB other bump:2.85917 Ang G8.C and A13.CB other bump:2.73101 Ang G8.CA and A13.CB other bump:3.14259 Ang V5.CG1 and G8.CA neighbor-bump: 2.08682 Ang I6.CG2 and Y7.N self-bump: 2.41239 Ang I6.CG2 and I6.C self-bump: 1.33758 Ang I6.CA and I6.CB T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLN 1jaxA 24 :GHEIVVGSRREEKAEAKAAEYRRIAG Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:2.89819 Ang I7.CD1 and A19.CA other bump:2.52503 Ang I7.CD1 and A19.N other bump:2.46765 Ang V12.CG1 and E16.OE2 other bump:2.85136 Ang N9.ND2 and K14.CE other bump:2.77127 Ang N9.ND2 and K14.CD T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYPNI 1jaxA 50 :DASITGMKNEDAAEACDIAVLTIPWEHAIDT Fragment has 11 clashes (null) has 11 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 33 residues neighbor-bump: 2.74793 Ang Y29.CD2 and P30.CD other bump:2.14889 Ang L14.CD2 and I20.CD1 other bump:2.91433 Ang L14.CB and I20.CD1 other bump:2.26708 Ang L14.CD2 and I20.CG2 other bump:2.63206 Ang L14.CD2 and I20.CG1 other bump:2.81381 Ang V17.CG1 and I20.CG1 other bump:2.93808 Ang L14.CD2 and I20.CB other bump:2.70337 Ang V17.CG2 and I19.C other bump:1.98462 Ang V17.CG2 and I19.O other bump:2.23815 Ang S8.CB and D13.OD1 other bump:2.65512 Ang S8.OG and V12.CG1 Number of specific fragments= 3 total=815 Number of alignments=148 # Reading fragments from alignment file # T0191 read from T0191-1jaxA-local-adpstyle5.pw.a2m.gz # 1jaxA read from T0191-1jaxA-local-adpstyle5.pw.a2m.gz # found chain 1jaxA in template set T0191 24 :KNIVIYGAGGAARAVAFELAK 1jaxA 2 :RVALLGGTGNLGKGLALRLAT Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 23 residues other bump:2.65143 Ang G8.O and A13.CB other bump:2.85917 Ang G8.C and A13.CB other bump:2.73101 Ang G8.CA and A13.CB other bump:3.14259 Ang V5.CG1 and G8.CA neighbor-bump: 2.08682 Ang I6.CG2 and Y7.N self-bump: 2.41239 Ang I6.CG2 and I6.C self-bump: 1.33758 Ang I6.CA and I6.CB T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKKFGEEVKF 1jaxA 24 :GHEIVVGSRREEKAEAKAAEYRRIAGDASITGMKN Fragment has 65 clashes (null) has 65 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 37 residues other bump:3.07177 Ang N9.CA and F36.CZ other bump:2.55044 Ang A8.O and F36.CZ other bump:2.99252 Ang A8.C and F36.CZ other bump:2.57133 Ang N9.CA and F36.CE2 other bump:2.78413 Ang N9.C and F36.CE2 other bump:3.14449 Ang R10.N and F36.CE2 other bump:3.06526 Ang N9.N and F36.CE2 other bump:2.92316 Ang A8.CB and F36.CE1 other bump:2.93526 Ang A8.C and F36.CE1 other bump:3.07999 Ang N9.CA and F36.CD2 other bump:2.7654 Ang N9.C and F36.CD2 other bump:2.50447 Ang A8.CB and F36.CD1 other bump:2.61283 Ang V12.CG2 and K35.CE other bump:2.87829 Ang V12.CG2 and K35.CD other bump:2.1409 Ang V12.CG2 and K35.CG other bump:2.87488 Ang I6.CG1 and V34.CG2 other bump:2.47604 Ang I6.CD1 and V34.CG2 other bump:2.8209 Ang I6.CD1 and V34.CG1 other bump:1.67864 Ang E16.N and E33.OE2 other bump:1.79763 Ang K14.C and E33.OE2 other bump:1.0317 Ang A15.N and E33.OE2 other bump:1.54786 Ang A15.CA and E33.OE2 other bump:2.51127 Ang A15.CB and E33.OE2 other bump:1.76559 Ang A15.C and E33.OE2 other bump:0.899862 Ang E16.N and E33.OE1 other bump:1.10488 Ang E16.CA and E33.OE1 other bump:1.61355 Ang E16.CB and E33.OE1 other bump:2.24411 Ang E16.C and E33.OE1 other bump:2.21594 Ang A15.C and E33.OE1 other bump:2.43633 Ang A15.O and E33.CD other bump:0.565897 Ang E16.N and E33.CD other bump:1.99209 Ang E16.CA and E33.CD other bump:2.81391 Ang E16.CB and E33.CD other bump:3.01536 Ang E16.C and E33.CD other bump:2.92884 Ang K14.C and E33.CD other bump:2.23224 Ang A15.N and E33.CD other bump:2.02599 Ang A15.CA and E33.CD other bump:2.66184 Ang A15.CB and E33.CD other bump:1.30434 Ang A15.C and E33.CD other bump:2.191 Ang A15.O and E33.CG other bump:1.70188 Ang E16.N and E33.CG other bump:2.63976 Ang E16.CA and E33.CG other bump:3.04308 Ang A15.N and E33.CG other bump:2.10154 Ang A15.CA and E33.CG other bump:2.0153 Ang A15.CB and E33.CG other bump:1.48782 Ang A15.C and E33.CG other bump:2.38329 Ang A15.O and E33.CB other bump:2.36679 Ang E16.N and E33.CB other bump:2.42495 Ang E16.CA and E33.CB other bump:2.36144 Ang A15.C and E33.CB other bump:2.8852 Ang F30.CD1 and E32.OE1 other bump:1.68779 Ang F30.CE1 and E32.OE1 other bump:2.16903 Ang F30.CZ and E32.OE1 other bump:2.81264 Ang F30.CZ and E32.CD other bump:2.93181 Ang N4.CB and F30.CE2 other bump:3.08236 Ang N4.CG and F30.CE2 other bump:2.76982 Ang N4.CA and F30.CD2 other bump:2.76488 Ang N4.CB and F30.CD2 other bump:2.82356 Ang N4.CG and F30.CD2 other bump:2.95391 Ang L26.CB and K29.CD other bump:2.89819 Ang I7.CD1 and A19.CA other bump:2.52503 Ang I7.CD1 and A19.N other bump:2.46765 Ang V12.CG1 and E16.OE2 other bump:2.85136 Ang N9.ND2 and K14.CE other bump:2.77127 Ang N9.ND2 and K14.CD T0191 83 :DVDLDGVDIIINATPIGMYPNIDVEPIV 1jaxA 59 :EDAAEACDIAVLTIPWEHAIDTARDLKN Fragment has 27 clashes (null) has 27 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 30 residues other bump:2.87806 Ang V25.CA and I28.CD1 other bump:2.96827 Ang V25.CA and I28.CG1 other bump:2.07058 Ang I23.O and P27.CD neighbor-bump: 2.44877 Ang E26.CB and P27.CD neighbor-bump: 1.83775 Ang E26.C and P27.CD neighbor-bump: 2.40239 Ang E26.N and P27.CD neighbor-bump: 2.18821 Ang E26.CA and P27.CD self-bump: 1.28356 Ang P27.N and P27.CD other bump:2.18343 Ang I23.O and P27.CG self-bump: 2.14571 Ang P27.N and P27.CG other bump:2.11738 Ang N22.O and E26.OE2 other bump:2.70449 Ang N22.C and E26.OE2 other bump:0.857121 Ang N22.O and E26.OE1 other bump:1.80866 Ang N22.C and E26.OE1 other bump:2.48897 Ang I23.CA and E26.OE1 other bump:2.78225 Ang I23.C and E26.OE1 other bump:1.61404 Ang N22.O and E26.CD other bump:2.57231 Ang N22.C and E26.CD neighbor-bump: 2.74793 Ang Y20.CD2 and P21.CD other bump:2.14889 Ang L5.CD2 and I11.CD1 other bump:2.91433 Ang L5.CB and I11.CD1 other bump:2.26708 Ang L5.CD2 and I11.CG2 other bump:2.63206 Ang L5.CD2 and I11.CG1 other bump:2.81381 Ang V8.CG1 and I11.CG1 other bump:2.93808 Ang L5.CD2 and I11.CB other bump:2.70337 Ang V8.CG2 and I10.C other bump:1.98462 Ang V8.CG2 and I10.O T0191 114 :KLRED 1jaxA 87 :ILREK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 7 residues Number of specific fragments= 4 total=819 Number of alignments=149 # Reading fragments from alignment file # T0191 read from T0191-1jaxA-simpleSW-adpstyle1.pw.a2m.gz # 1jaxA read from T0191-1jaxA-simpleSW-adpstyle1.pw.a2m.gz # found chain 1jaxA in template set T0191 27 :VIYGAGGAARAVAFELAK 1jaxA 5 :LLGGTGNLGKGLALRLAT Fragment has 8 clashes (null) has 8 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 20 residues other bump:2.65143 Ang G5.O and A10.CB other bump:2.85917 Ang G5.C and A10.CB other bump:3.03215 Ang V2.CG1 and A10.CB other bump:2.73101 Ang G5.CA and A10.CB other bump:3.08684 Ang V2.CG1 and G5.CA neighbor-bump: 2.08682 Ang I3.CG2 and Y4.N self-bump: 2.4124 Ang I3.CG2 and I3.C self-bump: 1.33758 Ang I3.CA and I3.CB T0191 45 :DNNIIIANRTVEKAEALAKE 1jaxA 24 :GHEIVVGSRREEKAEAKAAE Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 22 residues other bump:2.89819 Ang I7.CD1 and A19.CA other bump:2.52503 Ang I7.CD1 and A19.N other bump:2.46765 Ang V12.CG1 and E16.OE2 other bump:2.85136 Ang N9.ND2 and K14.CE other bump:2.77127 Ang N9.ND2 and K14.CD Number of specific fragments= 2 total=821 Number of alignments=150 # Reading fragments from alignment file # T0191 read from T0191-1jaxA-simpleSW-adpstyle5.pw.a2m.gz # 1jaxA read from T0191-1jaxA-simpleSW-adpstyle5.pw.a2m.gz # found chain 1jaxA in template set T0191 27 :VIYGAGGAARAVAFELAK 1jaxA 5 :LLGGTGNLGKGLALRLAT Fragment has 8 clashes (null) has 8 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 20 residues other bump:2.65143 Ang G5.O and A10.CB other bump:2.85917 Ang G5.C and A10.CB other bump:3.03215 Ang V2.CG1 and A10.CB other bump:2.73101 Ang G5.CA and A10.CB other bump:3.08684 Ang V2.CG1 and G5.CA neighbor-bump: 2.08682 Ang I3.CG2 and Y4.N self-bump: 2.4124 Ang I3.CG2 and I3.C self-bump: 1.33758 Ang I3.CA and I3.CB T0191 45 :DNNIIIANRTVEKAEALAKEIA 1jaxA 24 :GHEIVVGSRREEKAEAKAAEYR Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 24 residues other bump:2.89819 Ang I7.CD1 and A19.CA other bump:2.52503 Ang I7.CD1 and A19.N other bump:2.46765 Ang V12.CG1 and E16.OE2 other bump:2.85136 Ang N9.ND2 and K14.CE other bump:2.77127 Ang N9.ND2 and K14.CD Number of specific fragments= 2 total=823 Number of alignments=151 # Reading fragments from alignment file # T0191 read from T0191-1jaxA-vit-adpstyle1.pw.a2m.gz # 1jaxA read from T0191-1jaxA-vit-adpstyle1.pw.a2m.gz # found chain 1jaxA in template set T0191 24 :KNIVIYGAGGAARAVAFELAK 1jaxA 2 :RVALLGGTGNLGKGLALRLAT Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 23 residues other bump:2.65143 Ang G8.O and A13.CB other bump:2.85917 Ang G8.C and A13.CB other bump:2.73101 Ang G8.CA and A13.CB other bump:3.14259 Ang V5.CG1 and G8.CA neighbor-bump: 2.08682 Ang I6.CG2 and Y7.N self-bump: 2.41239 Ang I6.CG2 and I6.C self-bump: 1.33758 Ang I6.CA and I6.CB T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLN 1jaxA 24 :GHEIVVGSRREEKAEAKAAEYRRIAG Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:2.89819 Ang I7.CD1 and A19.CA other bump:2.52503 Ang I7.CD1 and A19.N other bump:2.46765 Ang V12.CG1 and E16.OE2 other bump:2.85136 Ang N9.ND2 and K14.CE other bump:2.77127 Ang N9.ND2 and K14.CD T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYPNI 1jaxA 50 :DASITGMKNEDAAEACDIAVLTIPWEHAIDT Fragment has 11 clashes (null) has 11 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 33 residues neighbor-bump: 2.74793 Ang Y29.CD2 and P30.CD other bump:2.14889 Ang L14.CD2 and I20.CD1 other bump:2.91433 Ang L14.CB and I20.CD1 other bump:2.26708 Ang L14.CD2 and I20.CG2 other bump:2.63206 Ang L14.CD2 and I20.CG1 other bump:2.81381 Ang V17.CG1 and I20.CG1 other bump:2.93808 Ang L14.CD2 and I20.CB other bump:2.70337 Ang V17.CG2 and I19.C other bump:1.98462 Ang V17.CG2 and I19.O other bump:2.23815 Ang S8.CB and D13.OD1 other bump:2.65512 Ang S8.OG and V12.CG1 Number of specific fragments= 3 total=826 Number of alignments=152 # Reading fragments from alignment file # T0191 read from T0191-1jaxA-vit-adpstyle5.pw.a2m.gz # 1jaxA read from T0191-1jaxA-vit-adpstyle5.pw.a2m.gz # found chain 1jaxA in template set T0191 24 :KNIVIYGAGGAARAVAFELAK 1jaxA 2 :RVALLGGTGNLGKGLALRLAT Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 23 residues other bump:2.65143 Ang G8.O and A13.CB other bump:2.85917 Ang G8.C and A13.CB other bump:2.73101 Ang G8.CA and A13.CB other bump:3.14259 Ang V5.CG1 and G8.CA neighbor-bump: 2.08682 Ang I6.CG2 and Y7.N self-bump: 2.41239 Ang I6.CG2 and I6.C self-bump: 1.33758 Ang I6.CA and I6.CB T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKKFGEEVKF 1jaxA 24 :GHEIVVGSRREEKAEAKAAEYRRIAGDASITGMKN Fragment has 65 clashes (null) has 65 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 37 residues other bump:3.07177 Ang N9.CA and F36.CZ other bump:2.55044 Ang A8.O and F36.CZ other bump:2.99252 Ang A8.C and F36.CZ other bump:2.57133 Ang N9.CA and F36.CE2 other bump:2.78413 Ang N9.C and F36.CE2 other bump:3.14449 Ang R10.N and F36.CE2 other bump:3.06526 Ang N9.N and F36.CE2 other bump:2.92316 Ang A8.CB and F36.CE1 other bump:2.93526 Ang A8.C and F36.CE1 other bump:3.07999 Ang N9.CA and F36.CD2 other bump:2.7654 Ang N9.C and F36.CD2 other bump:2.50447 Ang A8.CB and F36.CD1 other bump:2.61283 Ang V12.CG2 and K35.CE other bump:2.87829 Ang V12.CG2 and K35.CD other bump:2.1409 Ang V12.CG2 and K35.CG other bump:2.87488 Ang I6.CG1 and V34.CG2 other bump:2.47604 Ang I6.CD1 and V34.CG2 other bump:2.8209 Ang I6.CD1 and V34.CG1 other bump:1.67864 Ang E16.N and E33.OE2 other bump:1.79763 Ang K14.C and E33.OE2 other bump:1.0317 Ang A15.N and E33.OE2 other bump:1.54786 Ang A15.CA and E33.OE2 other bump:2.51127 Ang A15.CB and E33.OE2 other bump:1.76559 Ang A15.C and E33.OE2 other bump:0.899862 Ang E16.N and E33.OE1 other bump:1.10488 Ang E16.CA and E33.OE1 other bump:1.61355 Ang E16.CB and E33.OE1 other bump:2.24411 Ang E16.C and E33.OE1 other bump:2.21594 Ang A15.C and E33.OE1 other bump:2.43633 Ang A15.O and E33.CD other bump:0.565897 Ang E16.N and E33.CD other bump:1.99209 Ang E16.CA and E33.CD other bump:2.81391 Ang E16.CB and E33.CD other bump:3.01536 Ang E16.C and E33.CD other bump:2.92884 Ang K14.C and E33.CD other bump:2.23224 Ang A15.N and E33.CD other bump:2.02599 Ang A15.CA and E33.CD other bump:2.66184 Ang A15.CB and E33.CD other bump:1.30434 Ang A15.C and E33.CD other bump:2.191 Ang A15.O and E33.CG other bump:1.70188 Ang E16.N and E33.CG other bump:2.63976 Ang E16.CA and E33.CG other bump:3.04308 Ang A15.N and E33.CG other bump:2.10154 Ang A15.CA and E33.CG other bump:2.0153 Ang A15.CB and E33.CG other bump:1.48782 Ang A15.C and E33.CG other bump:2.38329 Ang A15.O and E33.CB other bump:2.36679 Ang E16.N and E33.CB other bump:2.42495 Ang E16.CA and E33.CB other bump:2.36144 Ang A15.C and E33.CB other bump:2.8852 Ang F30.CD1 and E32.OE1 other bump:1.68779 Ang F30.CE1 and E32.OE1 other bump:2.16903 Ang F30.CZ and E32.OE1 other bump:2.81264 Ang F30.CZ and E32.CD other bump:2.93181 Ang N4.CB and F30.CE2 other bump:3.08236 Ang N4.CG and F30.CE2 other bump:2.76982 Ang N4.CA and F30.CD2 other bump:2.76488 Ang N4.CB and F30.CD2 other bump:2.82356 Ang N4.CG and F30.CD2 other bump:2.95391 Ang L26.CB and K29.CD other bump:2.89819 Ang I7.CD1 and A19.CA other bump:2.52503 Ang I7.CD1 and A19.N other bump:2.46765 Ang V12.CG1 and E16.OE2 other bump:2.85136 Ang N9.ND2 and K14.CE other bump:2.77127 Ang N9.ND2 and K14.CD T0191 83 :DVDLDGVDIIINATPIGMYPNIDVEPIV 1jaxA 59 :EDAAEACDIAVLTIPWEHAIDTARDLKN Fragment has 27 clashes (null) has 27 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 30 residues other bump:2.87806 Ang V25.CA and I28.CD1 other bump:2.96827 Ang V25.CA and I28.CG1 other bump:2.07058 Ang I23.O and P27.CD neighbor-bump: 2.44877 Ang E26.CB and P27.CD neighbor-bump: 1.83775 Ang E26.C and P27.CD neighbor-bump: 2.40239 Ang E26.N and P27.CD neighbor-bump: 2.18821 Ang E26.CA and P27.CD self-bump: 1.28356 Ang P27.N and P27.CD other bump:2.18343 Ang I23.O and P27.CG self-bump: 2.14571 Ang P27.N and P27.CG other bump:2.11738 Ang N22.O and E26.OE2 other bump:2.70449 Ang N22.C and E26.OE2 other bump:0.857121 Ang N22.O and E26.OE1 other bump:1.80866 Ang N22.C and E26.OE1 other bump:2.48897 Ang I23.CA and E26.OE1 other bump:2.78225 Ang I23.C and E26.OE1 other bump:1.61404 Ang N22.O and E26.CD other bump:2.57231 Ang N22.C and E26.CD neighbor-bump: 2.74793 Ang Y20.CD2 and P21.CD other bump:2.14889 Ang L5.CD2 and I11.CD1 other bump:2.91433 Ang L5.CB and I11.CD1 other bump:2.26708 Ang L5.CD2 and I11.CG2 other bump:2.63206 Ang L5.CD2 and I11.CG1 other bump:2.81381 Ang V8.CG1 and I11.CG1 other bump:2.93808 Ang L5.CD2 and I11.CB other bump:2.70337 Ang V8.CG2 and I10.C other bump:1.98462 Ang V8.CG2 and I10.O T0191 114 :KLRED 1jaxA 87 :ILREK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 7 residues Number of specific fragments= 4 total=830 Number of alignments=153 # command:# Prefix for input files set to 1sayA/ # command:# reading script from file read-alignments.under # Reading fragments from alignment file # T0191 read from 1sayA-T0191-fssp-global-adpstyle1.pw.a2m.gz # 1sayA read from 1sayA-T0191-fssp-global-adpstyle1.pw.a2m.gz # found chain 1sayA in template set T0191 1 :IGYNTDGIGARMALEEE 1sayA 129 :LTPMSIIAGRLSVQFGA Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 18 residues other bump:2.22167 Ang A13.O and E17.OE2 other bump:2.74643 Ang A13.C and E17.OE2 other bump:2.59487 Ang L14.CA and E17.OE1 other bump:0.920759 Ang A13.O and E17.OE1 other bump:1.83897 Ang A13.C and E17.OE1 other bump:1.68071 Ang A13.O and E17.CD other bump:2.60835 Ang A13.C and E17.CD T0191 18 :IGRVK 1sayA 156 :GVLLG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 7 residues T0191 23 :DKNIVIYGAGGAARAVAFELAK 1sayA 167 :PGKVVILGGGVVGTEAAKMAVG Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 24 residues other bump:2.56061 Ang I5.CD1 and L21.CD2 other bump:2.48157 Ang I5.CG1 and L21.CD1 other bump:1.10128 Ang I5.CD1 and L21.CD1 other bump:1.86376 Ang I5.CD1 and L21.CG other bump:2.28339 Ang I5.CD1 and L21.CB other bump:2.91693 Ang G9.C and A14.CB other bump:1.86192 Ang G9.O and A14.CB T0191 45 :DNNIIIANRTVEKAEALAKEI 1sayA 190 :GAQVQIFDINVERLSYLETLF Fragment has 11 clashes (null) has 11 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 23 residues other bump:1.70685 Ang V12.CG1 and E16.OE2 other bump:1.12933 Ang V12.O and E16.OE1 other bump:1.88395 Ang V12.C and E16.OE1 other bump:2.3869 Ang E13.CA and E16.OE1 other bump:1.91758 Ang V12.O and E16.CD other bump:2.73332 Ang V12.C and E16.CD other bump:2.75496 Ang V12.CG1 and E16.CD other bump:2.45045 Ang N9.CG and T11.OG1 other bump:1.45654 Ang N9.OD1 and T11.OG1 other bump:2.92142 Ang N3.CG and I5.CG2 other bump:1.96143 Ang N3.ND2 and I5.CG2 T0191 66 :AEKLNKK 1sayA 214 :VELLYSN Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 9 residues T0191 75 :EEVKFSGL 1sayA 221 :SAEIETAV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 10 residues T0191 87 :DGVDIIINATPIGMYPNIDV 1sayA 229 :AEADLLIGAVLVPGRRAPIL Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 22 residues self-bump: 1.34485 Ang M15.CA and M15.CB other bump:2.81175 Ang A10.C and P12.CD other bump:2.83688 Ang V4.CG1 and I6.C other bump:2.60825 Ang V4.CG1 and I6.O T0191 109 :IVK 1sayA 249 :VPA Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 5 residues neighbor-bump: 2.53445 Ang G1.O and I2.CG2 neighbor-bump: 2.86556 Ang G1.C and I2.CG2 T0191 112 :AEKLREDMVVMDLI 1sayA 254 :VEQMRTGSVIVDVA Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 16 residues other bump:3.02398 Ang D13.CG and I15.CG1 other bump:2.43822 Ang D13.OD1 and I15.CG1 other bump:2.47352 Ang L5.CD2 and M9.CE other bump:2.86871 Ang L5.CG and M9.SD other bump:2.95067 Ang L5.CD1 and M9.SD other bump:2.20917 Ang L5.CD2 and M9.SD T0191 126 :YNPLETVLLKE 1sayA 269 :DQGGCVETLHP Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 13 residues other bump:2.40564 Ang Y2.CA and E12.OE2 other bump:2.57826 Ang L5.CD1 and L10.CD2 other bump:2.78236 Ang L5.CD1 and L10.CB neighbor-bump: 2.42326 Ang N3.CB and P4.CD neighbor-bump: 0.548208 Ang N3.C and P4.CD neighbor-bump: 2.01934 Ang N3.CA and P4.CD neighbor-bump: 0.798606 Ang N3.O and P4.CD neighbor-bump: 2.03007 Ang N3.C and P4.CG neighbor-bump: 1.44751 Ang N3.O and P4.CG self-bump: 2.05685 Ang N3.CB and N3.C T0191 137 :AKKVNAKTING 1sayA 286 :TYEVFGVVHYG Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 13 residues other bump:2.75123 Ang A2.CA and I10.O neighbor-bump: 2.2941 Ang N6.O and A7.CB neighbor-bump: 2.54008 Ang N6.C and A7.CB T0191 148 :LGMLIYQGAVAFK 1sayA 298 :PNMPGAVPWTATQ Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues Number of specific fragments= 12 total=842 Number of alignments=154 # Reading fragments from alignment file # T0191 read from 1sayA-T0191-fssp-global-adpstyle5.pw.a2m.gz # 1sayA read from 1sayA-T0191-fssp-global-adpstyle5.pw.a2m.gz # found chain 1sayA in template set T0191 6 :DGIGARM 1sayA 39 :AGIGAGF Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 9 residues T0191 14 :LEEE 1sayA 144 :GARF Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 6 residues T0191 18 :IGRVK 1sayA 156 :GVLLG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 7 residues T0191 23 :DKNIVIYGAGGAARAVAFELAK 1sayA 167 :PGKVVILGGGVVGTEAAKMAVG Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 24 residues other bump:2.56061 Ang I5.CD1 and L21.CD2 other bump:2.48157 Ang I5.CG1 and L21.CD1 other bump:1.10128 Ang I5.CD1 and L21.CD1 other bump:1.86376 Ang I5.CD1 and L21.CG other bump:2.28339 Ang I5.CD1 and L21.CB other bump:2.91693 Ang G9.C and A14.CB other bump:1.86192 Ang G9.O and A14.CB T0191 45 :DNNIIIANRTVEKAEALAKEI 1sayA 190 :GAQVQIFDINVERLSYLETLF Fragment has 11 clashes (null) has 11 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 23 residues other bump:1.70685 Ang V12.CG1 and E16.OE2 other bump:1.12933 Ang V12.O and E16.OE1 other bump:1.88395 Ang V12.C and E16.OE1 other bump:2.3869 Ang E13.CA and E16.OE1 other bump:1.91758 Ang V12.O and E16.CD other bump:2.73332 Ang V12.C and E16.CD other bump:2.75496 Ang V12.CG1 and E16.CD other bump:2.45045 Ang N9.CG and T11.OG1 other bump:1.45654 Ang N9.OD1 and T11.OG1 other bump:2.92142 Ang N3.CG and I5.CG2 other bump:1.96143 Ang N3.ND2 and I5.CG2 T0191 66 :AEKLNKK 1sayA 214 :VELLYSN Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 9 residues T0191 75 :EEVKFS 1sayA 221 :SAEIET Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 8 residues T0191 87 :DGVDIIINATPIGMYPNID 1sayA 229 :AEADLLIGAVLVPGRRAPI Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 21 residues self-bump: 1.34485 Ang M15.CA and M15.CB other bump:2.81175 Ang A10.C and P12.CD other bump:2.83688 Ang V4.CG1 and I6.C other bump:2.60825 Ang V4.CG1 and I6.O T0191 108 :PIVK 1sayA 248 :LVPA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 6 residues T0191 112 :AEKLREDMVVMDLIYNP 1sayA 254 :VEQMRTGSVIVDVAVDQ Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 19 residues other bump:2.47352 Ang L5.CD2 and M9.CE other bump:2.86871 Ang L5.CG and M9.SD other bump:2.95067 Ang L5.CD1 and M9.SD other bump:2.20917 Ang L5.CD2 and M9.SD T0191 129 :LETVLLK 1sayA 272 :GCVETLH Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 9 residues other bump:2.73523 Ang L2.CD1 and L7.CD2 other bump:2.42904 Ang L2.CD1 and L7.CB T0191 136 :EAK 1sayA 288 :EVF Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 5 residues T0191 139 :KVNAKTINGLGMLI 1sayA 293 :VHYGVPNMPGAVPW Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 16 residues Number of specific fragments= 13 total=855 Number of alignments=155 # Reading fragments from alignment file # T0191 read from 1sayA-T0191-local-adpstyle1.pw.a2m.gz # 1sayA read from 1sayA-T0191-local-adpstyle1.pw.a2m.gz # found chain 1sayA in template set T0191 21 :VKDKNIVIYGAGGAAR 1sayA 165 :VKPGKVVILGGGVVGT Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 18 residues other bump:1.86192 Ang G11.O and A16.CB other bump:2.91693 Ang G11.C and A16.CB T0191 37 :AVAFELAKDNNIIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGLDVD 1sayA 182 :AAKMAVGLGAQVQIFDINVERLSYLETLFGSRVELLYSNSAEIETAVAE Fragment has 50 clashes (null) has 50 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 51 residues other bump:2.82127 Ang I14.CG1 and L47.CD2 other bump:2.10222 Ang I14.CD1 and L47.CD2 other bump:2.78249 Ang I14.CG1 and L47.CD1 other bump:1.62563 Ang I14.CD1 and L47.CD1 other bump:2.21343 Ang I14.CD1 and L47.CG other bump:2.4229 Ang G39.CA and F44.CZ other bump:2.58849 Ang G39.C and F44.CZ other bump:2.91171 Ang E40.N and F44.CZ other bump:2.60714 Ang G39.CA and F44.CE2 other bump:2.23498 Ang F38.CE2 and E40.OE2 other bump:3.12938 Ang F38.CE2 and E40.CD other bump:2.43637 Ang A27.N and K36.NZ other bump:2.79441 Ang L26.CA and K36.NZ other bump:2.3426 Ang L26.CB and K36.NZ other bump:2.68965 Ang L26.C and K36.NZ other bump:1.95789 Ang A23.O and K36.NZ other bump:2.79736 Ang L26.CB and K36.CE other bump:2.38585 Ang A23.O and K36.CE other bump:3.00484 Ang A23.C and K36.CE other bump:2.98708 Ang I30.CD1 and L34.CD2 other bump:2.54972 Ang I13.CD1 and L34.CD2 other bump:2.12102 Ang V3.CG1 and L34.CD2 other bump:2.46588 Ang I13.CG1 and L34.CD1 other bump:2.38607 Ang I13.CD1 and L34.CD1 other bump:2.47498 Ang I13.CG1 and L34.CG other bump:2.24959 Ang I13.CD1 and L34.CG other bump:2.39851 Ang L7.CD1 and K33.CE self-bump: 2.21791 Ang A31.CB and A31.C self-bump: 1.22414 Ang A31.CA and A31.CB other bump:1.70685 Ang V20.CG1 and E24.OE2 other bump:1.12933 Ang V20.O and E24.OE1 other bump:1.88395 Ang V20.C and E24.OE1 other bump:2.3869 Ang E21.CA and E24.OE1 other bump:2.75496 Ang V20.CG1 and E24.CD other bump:1.91758 Ang V20.O and E24.CD other bump:2.73332 Ang V20.C and E24.CD other bump:2.45045 Ang N17.CG and T19.OG1 other bump:1.45654 Ang N17.OD1 and T19.OG1 other bump:2.76041 Ang V3.CG2 and I15.CD1 other bump:2.96813 Ang V3.CG2 and I15.CG1 other bump:2.76621 Ang V3.CG1 and I13.CD1 other bump:2.92142 Ang N11.CG and I13.CG2 other bump:1.96143 Ang N11.ND2 and I13.CG2 other bump:1.27919 Ang E6.O and N11.OD1 other bump:1.93533 Ang E6.C and N11.OD1 other bump:2.69323 Ang E6.CA and N11.OD1 other bump:2.62783 Ang E6.CB and N11.ND2 other bump:2.50704 Ang E6.O and N11.CG other bump:2.99507 Ang E6.C and N11.CG other bump:3.09673 Ang E6.CB and N11.CG T0191 89 :VDIIINATPIGMYPNIDVEPIVKAEKLREDMVVMDL 1sayA 231 :ADLLIGAVLVPGRRAPILVPASLVEQMRTGSVIVDV Fragment has 23 clashes (null) has 23 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 38 residues other bump:2.76659 Ang N7.CB and D36.OD2 other bump:2.23101 Ang N7.CG and D36.OD2 other bump:1.36216 Ang N7.OD1 and D36.OD2 other bump:2.65553 Ang N7.CB and D36.OD1 other bump:2.42288 Ang N7.CG and D36.OD1 other bump:2.46217 Ang N7.CB and D36.CG other bump:2.39239 Ang N7.CG and D36.CG other bump:2.11572 Ang N7.OD1 and D36.CG other bump:3.07608 Ang N7.CB and D36.CB other bump:3.25209 Ang N7.CB and D36.CA other bump:2.70117 Ang I5.CG2 and V34.CG1 other bump:2.47352 Ang L28.CD2 and M32.CE other bump:2.86871 Ang L28.CG and M32.SD other bump:2.20917 Ang L28.CD2 and M32.SD other bump:2.95067 Ang L28.CD1 and M32.SD other bump:2.27098 Ang E20.CD and K24.NZ other bump:1.37195 Ang E20.OE2 and K24.NZ other bump:2.62443 Ang D18.OD1 and E20.C other bump:3.00272 Ang I5.CD1 and E20.OE2 self-bump: 1.34485 Ang M13.CA and M13.CB other bump:2.81175 Ang A8.C and P10.CD other bump:2.83688 Ang V2.CG1 and I4.C other bump:2.60825 Ang V2.CG1 and I4.O Number of specific fragments= 3 total=858 Number of alignments=156 # Reading fragments from alignment file # T0191 read from 1sayA-T0191-local-adpstyle5.pw.a2m.gz # 1sayA read from 1sayA-T0191-local-adpstyle5.pw.a2m.gz # found chain 1sayA in template set T0191 11 :RMALEEEIGRVKDKNIVIYGAGGAARAVA 1sayA 155 :RGVLLGGVPGVKPGKVVILGGGVVGTEAA Fragment has 36 clashes (null) has 36 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 31 residues other bump:1.86192 Ang G21.O and A26.CB other bump:2.91693 Ang G21.C and A26.CB other bump:2.36668 Ang E6.CD and K15.NZ other bump:1.70675 Ang E6.CG and K15.NZ other bump:2.6459 Ang E6.CG and K15.CE other bump:3.28898 Ang L5.C and K15.CG other bump:2.99765 Ang E6.N and K15.CG other bump:2.46514 Ang E6.CA and K15.CG other bump:3.03107 Ang E6.CA and K15.CB other bump:3.23339 Ang E8.CG and D14.C other bump:2.35617 Ang E8.OE1 and D14.OD2 other bump:1.89922 Ang E7.O and D14.OD1 other bump:2.65946 Ang E7.C and D14.OD1 other bump:2.10901 Ang E8.OE2 and D14.OD1 other bump:1.98112 Ang E8.CB and D14.OD1 other bump:1.82342 Ang E8.CG and D14.OD1 other bump:1.73063 Ang E8.CD and D14.OD1 other bump:1.74892 Ang E8.OE1 and D14.CG other bump:2.34411 Ang E8.OE2 and D14.CG other bump:3.09435 Ang E8.CB and D14.CG other bump:2.37494 Ang E8.CG and D14.CG other bump:1.70371 Ang E8.CD and D14.CG other bump:1.47636 Ang E8.OE1 and D14.CB other bump:2.456 Ang E8.CG and D14.CB other bump:2.10831 Ang E8.CD and D14.CB other bump:1.96371 Ang E8.OE1 and D14.CA other bump:3.21873 Ang E8.CB and D14.CA other bump:1.74937 Ang E8.CG and D14.CA other bump:2.13597 Ang E8.CD and D14.CA other bump:1.7689 Ang E8.OE1 and D14.N other bump:2.01333 Ang E8.CG and D14.N other bump:1.83427 Ang E8.CD and D14.N other bump:2.56301 Ang E8.CG and K13.C other bump:2.81307 Ang E8.CD and K13.C neighbor-bump: 2.11263 Ang E7.O and E8.CB neighbor-bump: 2.52822 Ang E7.C and E8.CB T0191 40 :FELAKDNNIIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGLDVD 1sayA 185 :MAVGLGAQVQIFDINVERLSYLETLFGSRVELLYSNSAEIETAVAE Fragment has 46 clashes (null) has 46 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 48 residues other bump:2.82127 Ang I11.CG1 and L44.CD2 other bump:2.10222 Ang I11.CD1 and L44.CD2 other bump:2.78249 Ang I11.CG1 and L44.CD1 other bump:1.62563 Ang I11.CD1 and L44.CD1 other bump:2.21343 Ang I11.CD1 and L44.CG other bump:2.4229 Ang G36.CA and F41.CZ other bump:2.58849 Ang G36.C and F41.CZ other bump:2.91171 Ang E37.N and F41.CZ other bump:2.60714 Ang G36.CA and F41.CE2 other bump:2.23498 Ang F35.CE2 and E37.OE2 other bump:3.12938 Ang F35.CE2 and E37.CD other bump:2.43637 Ang A24.N and K33.NZ other bump:2.79441 Ang L23.CA and K33.NZ other bump:2.3426 Ang L23.CB and K33.NZ other bump:2.68965 Ang L23.C and K33.NZ other bump:1.95789 Ang A20.O and K33.NZ other bump:2.79736 Ang L23.CB and K33.CE other bump:2.38585 Ang A20.O and K33.CE other bump:3.00484 Ang A20.C and K33.CE other bump:2.98708 Ang I27.CD1 and L31.CD2 other bump:2.54972 Ang I10.CD1 and L31.CD2 other bump:2.46588 Ang I10.CG1 and L31.CD1 other bump:2.38607 Ang I10.CD1 and L31.CD1 other bump:2.47498 Ang I10.CG1 and L31.CG other bump:2.24959 Ang I10.CD1 and L31.CG other bump:2.39851 Ang L4.CD1 and K30.CE self-bump: 2.21791 Ang A28.CB and A28.C self-bump: 1.22414 Ang A28.CA and A28.CB other bump:1.70685 Ang V17.CG1 and E21.OE2 other bump:1.12933 Ang V17.O and E21.OE1 other bump:1.88395 Ang V17.C and E21.OE1 other bump:2.3869 Ang E18.CA and E21.OE1 other bump:2.75496 Ang V17.CG1 and E21.CD other bump:1.91758 Ang V17.O and E21.CD other bump:2.73332 Ang V17.C and E21.CD other bump:2.45045 Ang N14.CG and T16.OG1 other bump:1.45654 Ang N14.OD1 and T16.OG1 other bump:2.92142 Ang N8.CG and I10.CG2 other bump:1.96143 Ang N8.ND2 and I10.CG2 other bump:1.27919 Ang E3.O and N8.OD1 other bump:1.93533 Ang E3.C and N8.OD1 other bump:2.69323 Ang E3.CA and N8.OD1 other bump:2.62783 Ang E3.CB and N8.ND2 other bump:2.50704 Ang E3.O and N8.CG other bump:2.99507 Ang E3.C and N8.CG other bump:3.09673 Ang E3.CB and N8.CG T0191 89 :VDIIINATPIGMYPNIDVEPIVKAEKLREDMVVMDL 1sayA 231 :ADLLIGAVLVPGRRAPILVPASLVEQMRTGSVIVDV Fragment has 23 clashes (null) has 23 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 38 residues other bump:2.76659 Ang N7.CB and D36.OD2 other bump:2.23101 Ang N7.CG and D36.OD2 other bump:1.36216 Ang N7.OD1 and D36.OD2 other bump:2.65553 Ang N7.CB and D36.OD1 other bump:2.42288 Ang N7.CG and D36.OD1 other bump:2.46217 Ang N7.CB and D36.CG other bump:2.39239 Ang N7.CG and D36.CG other bump:2.11572 Ang N7.OD1 and D36.CG other bump:3.07608 Ang N7.CB and D36.CB other bump:3.25209 Ang N7.CB and D36.CA other bump:2.70117 Ang I5.CG2 and V34.CG1 other bump:2.47352 Ang L28.CD2 and M32.CE other bump:2.86871 Ang L28.CG and M32.SD other bump:2.20917 Ang L28.CD2 and M32.SD other bump:2.95067 Ang L28.CD1 and M32.SD other bump:2.27098 Ang E20.CD and K24.NZ other bump:1.37195 Ang E20.OE2 and K24.NZ other bump:2.62443 Ang D18.OD1 and E20.C other bump:3.00272 Ang I5.CD1 and E20.OE2 self-bump: 1.34485 Ang M13.CA and M13.CB other bump:2.81175 Ang A8.C and P10.CD other bump:2.83688 Ang V2.CG1 and I4.C other bump:2.60825 Ang V2.CG1 and I4.O Number of specific fragments= 3 total=861 Number of alignments=157 # Reading fragments from alignment file # T0191 read from 1sayA-T0191-vit-adpstyle1.pw.a2m.gz # 1sayA read from 1sayA-T0191-vit-adpstyle1.pw.a2m.gz # found chain 1sayA in template set T0191 21 :VKDKNIVIYGAGGAAR 1sayA 165 :VKPGKVVILGGGVVGT Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 18 residues other bump:1.86192 Ang G11.O and A16.CB other bump:2.91693 Ang G11.C and A16.CB T0191 37 :AVAFELAKDNNIIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGLDVD 1sayA 182 :AAKMAVGLGAQVQIFDINVERLSYLETLFGSRVELLYSNSAEIETAVAE Fragment has 50 clashes (null) has 50 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 51 residues other bump:2.82127 Ang I14.CG1 and L47.CD2 other bump:2.10222 Ang I14.CD1 and L47.CD2 other bump:2.78249 Ang I14.CG1 and L47.CD1 other bump:1.62563 Ang I14.CD1 and L47.CD1 other bump:2.21343 Ang I14.CD1 and L47.CG other bump:2.4229 Ang G39.CA and F44.CZ other bump:2.58849 Ang G39.C and F44.CZ other bump:2.91171 Ang E40.N and F44.CZ other bump:2.60714 Ang G39.CA and F44.CE2 other bump:2.23498 Ang F38.CE2 and E40.OE2 other bump:3.12938 Ang F38.CE2 and E40.CD other bump:2.43637 Ang A27.N and K36.NZ other bump:2.79441 Ang L26.CA and K36.NZ other bump:2.3426 Ang L26.CB and K36.NZ other bump:2.68965 Ang L26.C and K36.NZ other bump:1.95789 Ang A23.O and K36.NZ other bump:2.79736 Ang L26.CB and K36.CE other bump:2.38585 Ang A23.O and K36.CE other bump:3.00484 Ang A23.C and K36.CE other bump:2.98708 Ang I30.CD1 and L34.CD2 other bump:2.54972 Ang I13.CD1 and L34.CD2 other bump:2.12102 Ang V3.CG1 and L34.CD2 other bump:2.46588 Ang I13.CG1 and L34.CD1 other bump:2.38607 Ang I13.CD1 and L34.CD1 other bump:2.47498 Ang I13.CG1 and L34.CG other bump:2.24959 Ang I13.CD1 and L34.CG other bump:2.39851 Ang L7.CD1 and K33.CE self-bump: 2.21791 Ang A31.CB and A31.C self-bump: 1.22414 Ang A31.CA and A31.CB other bump:1.70685 Ang V20.CG1 and E24.OE2 other bump:1.12933 Ang V20.O and E24.OE1 other bump:1.88395 Ang V20.C and E24.OE1 other bump:2.3869 Ang E21.CA and E24.OE1 other bump:2.75496 Ang V20.CG1 and E24.CD other bump:1.91758 Ang V20.O and E24.CD other bump:2.73332 Ang V20.C and E24.CD other bump:2.45045 Ang N17.CG and T19.OG1 other bump:1.45654 Ang N17.OD1 and T19.OG1 other bump:2.76041 Ang V3.CG2 and I15.CD1 other bump:2.96813 Ang V3.CG2 and I15.CG1 other bump:2.76621 Ang V3.CG1 and I13.CD1 other bump:2.92142 Ang N11.CG and I13.CG2 other bump:1.96143 Ang N11.ND2 and I13.CG2 other bump:1.27919 Ang E6.O and N11.OD1 other bump:1.93533 Ang E6.C and N11.OD1 other bump:2.69323 Ang E6.CA and N11.OD1 other bump:2.62783 Ang E6.CB and N11.ND2 other bump:2.50704 Ang E6.O and N11.CG other bump:2.99507 Ang E6.C and N11.CG other bump:3.09673 Ang E6.CB and N11.CG T0191 89 :VDIIINATPIGMYPNIDVEPIVKAEKLREDMVVMDL 1sayA 231 :ADLLIGAVLVPGRRAPILVPASLVEQMRTGSVIVDV Fragment has 23 clashes (null) has 23 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 38 residues other bump:2.76659 Ang N7.CB and D36.OD2 other bump:2.23101 Ang N7.CG and D36.OD2 other bump:1.36216 Ang N7.OD1 and D36.OD2 other bump:2.65553 Ang N7.CB and D36.OD1 other bump:2.42288 Ang N7.CG and D36.OD1 other bump:2.46217 Ang N7.CB and D36.CG other bump:2.39239 Ang N7.CG and D36.CG other bump:2.11572 Ang N7.OD1 and D36.CG other bump:3.07608 Ang N7.CB and D36.CB other bump:3.25209 Ang N7.CB and D36.CA other bump:2.70117 Ang I5.CG2 and V34.CG1 other bump:2.47352 Ang L28.CD2 and M32.CE other bump:2.86871 Ang L28.CG and M32.SD other bump:2.20917 Ang L28.CD2 and M32.SD other bump:2.95067 Ang L28.CD1 and M32.SD other bump:2.27098 Ang E20.CD and K24.NZ other bump:1.37195 Ang E20.OE2 and K24.NZ other bump:2.62443 Ang D18.OD1 and E20.C other bump:3.00272 Ang I5.CD1 and E20.OE2 self-bump: 1.34485 Ang M13.CA and M13.CB other bump:2.81175 Ang A8.C and P10.CD other bump:2.83688 Ang V2.CG1 and I4.C other bump:2.60825 Ang V2.CG1 and I4.O Number of specific fragments= 3 total=864 Number of alignments=158 # Reading fragments from alignment file # T0191 read from 1sayA-T0191-vit-adpstyle5.pw.a2m.gz # 1sayA read from 1sayA-T0191-vit-adpstyle5.pw.a2m.gz # found chain 1sayA in template set T0191 11 :RMALEEEIGRVKDKNIVIYGAGGAARAVA 1sayA 155 :RGVLLGGVPGVKPGKVVILGGGVVGTEAA Fragment has 36 clashes (null) has 36 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 31 residues other bump:1.86192 Ang G21.O and A26.CB other bump:2.91693 Ang G21.C and A26.CB other bump:2.36668 Ang E6.CD and K15.NZ other bump:1.70675 Ang E6.CG and K15.NZ other bump:2.6459 Ang E6.CG and K15.CE other bump:3.28898 Ang L5.C and K15.CG other bump:2.99765 Ang E6.N and K15.CG other bump:2.46514 Ang E6.CA and K15.CG other bump:3.03107 Ang E6.CA and K15.CB other bump:3.23339 Ang E8.CG and D14.C other bump:2.35617 Ang E8.OE1 and D14.OD2 other bump:1.89922 Ang E7.O and D14.OD1 other bump:2.65946 Ang E7.C and D14.OD1 other bump:2.10901 Ang E8.OE2 and D14.OD1 other bump:1.98112 Ang E8.CB and D14.OD1 other bump:1.82342 Ang E8.CG and D14.OD1 other bump:1.73063 Ang E8.CD and D14.OD1 other bump:1.74892 Ang E8.OE1 and D14.CG other bump:2.34411 Ang E8.OE2 and D14.CG other bump:3.09435 Ang E8.CB and D14.CG other bump:2.37494 Ang E8.CG and D14.CG other bump:1.70371 Ang E8.CD and D14.CG other bump:1.47636 Ang E8.OE1 and D14.CB other bump:2.456 Ang E8.CG and D14.CB other bump:2.10831 Ang E8.CD and D14.CB other bump:1.96371 Ang E8.OE1 and D14.CA other bump:3.21873 Ang E8.CB and D14.CA other bump:1.74937 Ang E8.CG and D14.CA other bump:2.13597 Ang E8.CD and D14.CA other bump:1.7689 Ang E8.OE1 and D14.N other bump:2.01333 Ang E8.CG and D14.N other bump:1.83427 Ang E8.CD and D14.N other bump:2.56301 Ang E8.CG and K13.C other bump:2.81307 Ang E8.CD and K13.C neighbor-bump: 2.11263 Ang E7.O and E8.CB neighbor-bump: 2.52822 Ang E7.C and E8.CB T0191 40 :FELAKDNNIIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGLDVD 1sayA 185 :MAVGLGAQVQIFDINVERLSYLETLFGSRVELLYSNSAEIETAVAE Fragment has 46 clashes (null) has 46 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 48 residues other bump:2.82127 Ang I11.CG1 and L44.CD2 other bump:2.10222 Ang I11.CD1 and L44.CD2 other bump:2.78249 Ang I11.CG1 and L44.CD1 other bump:1.62563 Ang I11.CD1 and L44.CD1 other bump:2.21343 Ang I11.CD1 and L44.CG other bump:2.4229 Ang G36.CA and F41.CZ other bump:2.58849 Ang G36.C and F41.CZ other bump:2.91171 Ang E37.N and F41.CZ other bump:2.60714 Ang G36.CA and F41.CE2 other bump:2.23498 Ang F35.CE2 and E37.OE2 other bump:3.12938 Ang F35.CE2 and E37.CD other bump:2.43637 Ang A24.N and K33.NZ other bump:2.79441 Ang L23.CA and K33.NZ other bump:2.3426 Ang L23.CB and K33.NZ other bump:2.68965 Ang L23.C and K33.NZ other bump:1.95789 Ang A20.O and K33.NZ other bump:2.79736 Ang L23.CB and K33.CE other bump:2.38585 Ang A20.O and K33.CE other bump:3.00484 Ang A20.C and K33.CE other bump:2.98708 Ang I27.CD1 and L31.CD2 other bump:2.54972 Ang I10.CD1 and L31.CD2 other bump:2.46588 Ang I10.CG1 and L31.CD1 other bump:2.38607 Ang I10.CD1 and L31.CD1 other bump:2.47498 Ang I10.CG1 and L31.CG other bump:2.24959 Ang I10.CD1 and L31.CG other bump:2.39851 Ang L4.CD1 and K30.CE self-bump: 2.21791 Ang A28.CB and A28.C self-bump: 1.22414 Ang A28.CA and A28.CB other bump:1.70685 Ang V17.CG1 and E21.OE2 other bump:1.12933 Ang V17.O and E21.OE1 other bump:1.88395 Ang V17.C and E21.OE1 other bump:2.3869 Ang E18.CA and E21.OE1 other bump:2.75496 Ang V17.CG1 and E21.CD other bump:1.91758 Ang V17.O and E21.CD other bump:2.73332 Ang V17.C and E21.CD other bump:2.45045 Ang N14.CG and T16.OG1 other bump:1.45654 Ang N14.OD1 and T16.OG1 other bump:2.92142 Ang N8.CG and I10.CG2 other bump:1.96143 Ang N8.ND2 and I10.CG2 other bump:1.27919 Ang E3.O and N8.OD1 other bump:1.93533 Ang E3.C and N8.OD1 other bump:2.69323 Ang E3.CA and N8.OD1 other bump:2.62783 Ang E3.CB and N8.ND2 other bump:2.50704 Ang E3.O and N8.CG other bump:2.99507 Ang E3.C and N8.CG other bump:3.09673 Ang E3.CB and N8.CG T0191 89 :VDIIINATPIGMYPNIDVEPIVKAEKLREDMVVMDL 1sayA 231 :ADLLIGAVLVPGRRAPILVPASLVEQMRTGSVIVDV Fragment has 23 clashes (null) has 23 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 38 residues other bump:2.76659 Ang N7.CB and D36.OD2 other bump:2.23101 Ang N7.CG and D36.OD2 other bump:1.36216 Ang N7.OD1 and D36.OD2 other bump:2.65553 Ang N7.CB and D36.OD1 other bump:2.42288 Ang N7.CG and D36.OD1 other bump:2.46217 Ang N7.CB and D36.CG other bump:2.39239 Ang N7.CG and D36.CG other bump:2.11572 Ang N7.OD1 and D36.CG other bump:3.07608 Ang N7.CB and D36.CB other bump:3.25209 Ang N7.CB and D36.CA other bump:2.70117 Ang I5.CG2 and V34.CG1 other bump:2.47352 Ang L28.CD2 and M32.CE other bump:2.86871 Ang L28.CG and M32.SD other bump:2.20917 Ang L28.CD2 and M32.SD other bump:2.95067 Ang L28.CD1 and M32.SD other bump:2.27098 Ang E20.CD and K24.NZ other bump:1.37195 Ang E20.OE2 and K24.NZ other bump:2.62443 Ang D18.OD1 and E20.C other bump:3.00272 Ang I5.CD1 and E20.OE2 self-bump: 1.34485 Ang M13.CA and M13.CB other bump:2.81175 Ang A8.C and P10.CD other bump:2.83688 Ang V2.CG1 and I4.C other bump:2.60825 Ang V2.CG1 and I4.O Number of specific fragments= 3 total=867 Number of alignments=159 # Reading fragments from alignment file # T0191 read from T0191-1sayA-2track-protein-EBGHSTL-global-adpstyle1.pw.a2m.gz # 1sayA read from T0191-1sayA-2track-protein-EBGHSTL-global-adpstyle1.pw.a2m.gz # found chain 1sayA in template set T0191 3 :YNTDGIGARMALEEEIGR 1sayA 15 :RVGLSPSSVRTLVEAGHT Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 20 residues neighbor-bump: 2.88783 Ang E16.C and I17.CG1 neighbor-bump: 2.09516 Ang E16.O and I17.CB neighbor-bump: 2.48211 Ang E16.C and I17.CB T0191 21 :VKDKNIVIYGAGGAARAVAFELAK 1sayA 165 :VKPGKVVILGGGVVGTEAAKMAVG Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 26 residues other bump:2.56061 Ang I7.CD1 and L23.CD2 other bump:2.48157 Ang I7.CG1 and L23.CD1 other bump:1.10128 Ang I7.CD1 and L23.CD1 other bump:1.86376 Ang I7.CD1 and L23.CG other bump:2.28339 Ang I7.CD1 and L23.CB other bump:1.86192 Ang G11.O and A16.CB other bump:2.91693 Ang G11.C and A16.CB T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLN 1sayA 190 :GAQVQIFDINVERLSYLETLFGSRVE Fragment has 19 clashes (null) has 19 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:2.98708 Ang I22.CD1 and L26.CD2 other bump:2.54972 Ang I5.CD1 and L26.CD2 other bump:2.38607 Ang I5.CD1 and L26.CD1 other bump:2.46588 Ang I5.CG1 and L26.CD1 other bump:2.24959 Ang I5.CD1 and L26.CG other bump:2.47498 Ang I5.CG1 and L26.CG self-bump: 2.21791 Ang A23.CB and A23.C self-bump: 1.22414 Ang A23.CA and A23.CB other bump:1.70685 Ang V12.CG1 and E16.OE2 other bump:1.12933 Ang V12.O and E16.OE1 other bump:1.88395 Ang V12.C and E16.OE1 other bump:2.3869 Ang E13.CA and E16.OE1 other bump:1.91758 Ang V12.O and E16.CD other bump:2.73332 Ang V12.C and E16.CD other bump:2.75496 Ang V12.CG1 and E16.CD other bump:1.45654 Ang N9.OD1 and T11.OG1 other bump:2.45045 Ang N9.CG and T11.OG1 other bump:2.92142 Ang N3.CG and I5.CG2 other bump:1.96143 Ang N3.ND2 and I5.CG2 T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLREDMVVMDLIY 1sayA 216 :LLYSNSAEIETAVAEADLLIGAVLVPGRRAPILVPASLVEQMRTGSVIVDVAV Fragment has 42 clashes (null) has 42 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 55 residues other bump:2.51253 Ang T24.N and I53.CD1 other bump:2.05606 Ang T24.C and I53.CD1 other bump:2.93499 Ang P25.N and I53.CD1 other bump:2.6843 Ang T24.CA and I53.CD1 other bump:2.99341 Ang T24.CB and I53.CD1 other bump:2.54819 Ang T24.OG1 and I53.CD1 other bump:1.58666 Ang T24.O and I53.CD1 other bump:3.04979 Ang T24.C and I53.CG1 other bump:2.76659 Ang N22.CB and D51.OD2 other bump:2.23101 Ang N22.CG and D51.OD2 other bump:1.36216 Ang N22.OD1 and D51.OD2 other bump:2.65553 Ang N22.CB and D51.OD1 other bump:2.42288 Ang N22.CG and D51.OD1 other bump:2.46217 Ang N22.CB and D51.CG other bump:2.39239 Ang N22.CG and D51.CG other bump:2.11572 Ang N22.OD1 and D51.CG other bump:3.07608 Ang N22.CB and D51.CB other bump:3.25209 Ang N22.CB and D51.CA other bump:2.70117 Ang I20.CG2 and V49.CG1 other bump:2.47352 Ang L43.CD2 and M47.CE other bump:2.86871 Ang L43.CG and M47.SD other bump:2.20917 Ang L43.CD2 and M47.SD other bump:2.95067 Ang L43.CD1 and M47.SD other bump:2.83464 Ang D15.OD1 and K42.C other bump:2.10641 Ang D15.OD1 and K42.O other bump:2.36746 Ang L14.CG and K39.NZ other bump:2.51947 Ang L14.CB and K39.NZ other bump:1.70521 Ang L14.CD1 and K39.NZ other bump:2.27098 Ang E35.CD and K39.NZ other bump:1.37195 Ang E35.OE2 and K39.NZ other bump:2.40629 Ang L14.CG and K39.CE other bump:2.66309 Ang L14.CB and K39.CE other bump:1.29673 Ang L14.CD1 and K39.CE other bump:2.74995 Ang L14.CD1 and K39.CD other bump:2.62443 Ang D33.OD1 and E35.C other bump:3.00272 Ang I20.CD1 and E35.OE2 other bump:2.91817 Ang L14.CD1 and E35.OE2 self-bump: 1.34485 Ang M28.CA and M28.CB other bump:2.81175 Ang A23.C and P25.CD other bump:2.50518 Ang L14.CD2 and I20.CD1 other bump:2.83688 Ang V17.CG1 and I19.C other bump:2.60825 Ang V17.CG1 and I19.O T0191 127 :NPLETVLLKEAKKVNAKTINGLGMLIYQGAVAFK 1sayA 299 :NMPGAVPWTATQALNNSTLPYVVKLANQGLKALE Fragment has 8 clashes (null) has 8 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 35 residues other bump:2.47398 Ang G24.O and Y28.CD1 self-bump: 1.38773 Ang Y28.CA and Y28.CB other bump:2.55961 Ang N16.O and I20.CD1 other bump:2.13052 Ang N16.O and I20.CG1 other bump:1.97811 Ang L4.CD2 and E11.OE2 other bump:3.01091 Ang L4.CB and E11.CD other bump:2.68628 Ang L4.CD2 and E11.CD other bump:2.78581 Ang N2.OD1 and E5.CB Number of specific fragments= 5 total=872 Number of alignments=160 # Reading fragments from alignment file # T0191 read from T0191-1sayA-2track-protein-EBGHSTL-global-adpstyle5.pw.a2m.gz # 1sayA read from T0191-1sayA-2track-protein-EBGHSTL-global-adpstyle5.pw.a2m.gz # found chain 1sayA in template set T0191 1 :I 1sayA 1 :M Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 2 residues T0191 3 :YNTDGIGARMALEEEIGR 1sayA 15 :RVGLSPSSVRTLVEAGHT Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 20 residues neighbor-bump: 2.88783 Ang E16.C and I17.CG1 neighbor-bump: 2.09516 Ang E16.O and I17.CB neighbor-bump: 2.48211 Ang E16.C and I17.CB T0191 21 :VKDKNIVIYGAGGAARAVAFELAK 1sayA 165 :VKPGKVVILGGGVVGTEAAKMAVG Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 26 residues other bump:2.56061 Ang I7.CD1 and L23.CD2 other bump:2.48157 Ang I7.CG1 and L23.CD1 other bump:1.10128 Ang I7.CD1 and L23.CD1 other bump:1.86376 Ang I7.CD1 and L23.CG other bump:2.28339 Ang I7.CD1 and L23.CB other bump:1.86192 Ang G11.O and A16.CB other bump:2.91693 Ang G11.C and A16.CB T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLN 1sayA 190 :GAQVQIFDINVERLSYLETLFGSRVE Fragment has 19 clashes (null) has 19 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:2.98708 Ang I22.CD1 and L26.CD2 other bump:2.54972 Ang I5.CD1 and L26.CD2 other bump:2.38607 Ang I5.CD1 and L26.CD1 other bump:2.46588 Ang I5.CG1 and L26.CD1 other bump:2.24959 Ang I5.CD1 and L26.CG other bump:2.47498 Ang I5.CG1 and L26.CG self-bump: 2.21791 Ang A23.CB and A23.C self-bump: 1.22414 Ang A23.CA and A23.CB other bump:1.70685 Ang V12.CG1 and E16.OE2 other bump:1.12933 Ang V12.O and E16.OE1 other bump:1.88395 Ang V12.C and E16.OE1 other bump:2.3869 Ang E13.CA and E16.OE1 other bump:1.91758 Ang V12.O and E16.CD other bump:2.73332 Ang V12.C and E16.CD other bump:2.75496 Ang V12.CG1 and E16.CD other bump:1.45654 Ang N9.OD1 and T11.OG1 other bump:2.45045 Ang N9.CG and T11.OG1 other bump:2.92142 Ang N3.CG and I5.CG2 other bump:1.96143 Ang N3.ND2 and I5.CG2 T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLREDMVVMDLIY 1sayA 216 :LLYSNSAEIETAVAEADLLIGAVLVPGRRAPILVPASLVEQMRTGSVIVDVAV Fragment has 42 clashes (null) has 42 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 55 residues other bump:2.51253 Ang T24.N and I53.CD1 other bump:2.05606 Ang T24.C and I53.CD1 other bump:2.93499 Ang P25.N and I53.CD1 other bump:2.6843 Ang T24.CA and I53.CD1 other bump:2.99341 Ang T24.CB and I53.CD1 other bump:2.54819 Ang T24.OG1 and I53.CD1 other bump:1.58666 Ang T24.O and I53.CD1 other bump:3.04979 Ang T24.C and I53.CG1 other bump:2.76659 Ang N22.CB and D51.OD2 other bump:2.23101 Ang N22.CG and D51.OD2 other bump:1.36216 Ang N22.OD1 and D51.OD2 other bump:2.65553 Ang N22.CB and D51.OD1 other bump:2.42288 Ang N22.CG and D51.OD1 other bump:2.46217 Ang N22.CB and D51.CG other bump:2.39239 Ang N22.CG and D51.CG other bump:2.11572 Ang N22.OD1 and D51.CG other bump:3.07608 Ang N22.CB and D51.CB other bump:3.25209 Ang N22.CB and D51.CA other bump:2.70117 Ang I20.CG2 and V49.CG1 other bump:2.47352 Ang L43.CD2 and M47.CE other bump:2.86871 Ang L43.CG and M47.SD other bump:2.20917 Ang L43.CD2 and M47.SD other bump:2.95067 Ang L43.CD1 and M47.SD other bump:2.83464 Ang D15.OD1 and K42.C other bump:2.10641 Ang D15.OD1 and K42.O other bump:2.36746 Ang L14.CG and K39.NZ other bump:2.51947 Ang L14.CB and K39.NZ other bump:1.70521 Ang L14.CD1 and K39.NZ other bump:2.27098 Ang E35.CD and K39.NZ other bump:1.37195 Ang E35.OE2 and K39.NZ other bump:2.40629 Ang L14.CG and K39.CE other bump:2.66309 Ang L14.CB and K39.CE other bump:1.29673 Ang L14.CD1 and K39.CE other bump:2.74995 Ang L14.CD1 and K39.CD other bump:2.62443 Ang D33.OD1 and E35.C other bump:3.00272 Ang I20.CD1 and E35.OE2 other bump:2.91817 Ang L14.CD1 and E35.OE2 self-bump: 1.34485 Ang M28.CA and M28.CB other bump:2.81175 Ang A23.C and P25.CD other bump:2.50518 Ang L14.CD2 and I20.CD1 other bump:2.83688 Ang V17.CG1 and I19.C other bump:2.60825 Ang V17.CG1 and I19.O T0191 127 :NPLETVLLKE 1sayA 300 :MPGAVPWTAT Fragment has 26 clashes (null) has 26 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 12 residues other bump:2.19759 Ang V7.CG1 and E11.OE2 other bump:3.21782 Ang V7.CG1 and E11.CD other bump:1.95353 Ang P3.N and K10.NZ other bump:1.14829 Ang P3.CA and K10.NZ other bump:2.37642 Ang P3.CB and K10.NZ other bump:1.73979 Ang P3.O and K10.NZ other bump:0.601303 Ang P3.C and K10.NZ other bump:1.41498 Ang L4.N and K10.NZ other bump:2.72408 Ang L4.CA and K10.NZ other bump:2.47162 Ang N2.C and K10.NZ other bump:2.86021 Ang P3.N and K10.CE other bump:1.4562 Ang P3.CA and K10.CE other bump:2.30412 Ang P3.CB and K10.CE other bump:1.30553 Ang P3.O and K10.CE other bump:1.36351 Ang P3.C and K10.CE other bump:2.69161 Ang L4.N and K10.CE other bump:2.62412 Ang P3.CA and K10.CD other bump:2.73784 Ang P3.CB and K10.CD other bump:1.26995 Ang P3.O and K10.CD other bump:2.00625 Ang P3.C and K10.CD other bump:2.39494 Ang N2.O and E5.OE2 other bump:2.73914 Ang N2.CA and E5.OE1 other bump:1.86299 Ang N2.C and E5.OE1 other bump:0.725532 Ang N2.O and E5.OE1 other bump:2.74209 Ang N2.C and E5.CD other bump:1.69955 Ang N2.O and E5.CD T0191 138 :KKVNAKTINGLGMLIYQGAVAFK 1sayA 310 :QALNNSTLPYVVKLANQGLKALE Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 24 residues other bump:2.47398 Ang G13.O and Y17.CD1 self-bump: 1.38773 Ang Y17.CA and Y17.CB other bump:2.55961 Ang N5.O and I9.CD1 other bump:2.13052 Ang N5.O and I9.CG1 Number of specific fragments= 7 total=879 Number of alignments=161 # Reading fragments from alignment file # T0191 read from T0191-1sayA-2track-protein-EBGHSTL-local-adpstyle1.pw.a2m.gz # 1sayA read from T0191-1sayA-2track-protein-EBGHSTL-local-adpstyle1.pw.a2m.gz # found chain 1sayA in template set T0191 25 :NIVIYGAGGAARAVAFELAK 1sayA 169 :KVVILGGGVVGTEAAKMAVG Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 22 residues other bump:2.56061 Ang I3.CD1 and L19.CD2 other bump:2.48157 Ang I3.CG1 and L19.CD1 other bump:1.10127 Ang I3.CD1 and L19.CD1 other bump:1.86377 Ang I3.CD1 and L19.CG other bump:2.28339 Ang I3.CD1 and L19.CB other bump:2.91693 Ang G7.C and A12.CB other bump:1.86192 Ang G7.O and A12.CB T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLN 1sayA 190 :GAQVQIFDINVERLSYLETLFGSRVE Fragment has 19 clashes (null) has 19 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:2.98708 Ang I22.CD1 and L26.CD2 other bump:2.54972 Ang I5.CD1 and L26.CD2 other bump:2.38607 Ang I5.CD1 and L26.CD1 other bump:2.46588 Ang I5.CG1 and L26.CD1 other bump:2.24959 Ang I5.CD1 and L26.CG other bump:2.47498 Ang I5.CG1 and L26.CG self-bump: 2.21791 Ang A23.CB and A23.C self-bump: 1.22414 Ang A23.CA and A23.CB other bump:1.70685 Ang V12.CG1 and E16.OE2 other bump:1.12933 Ang V12.O and E16.OE1 other bump:1.88395 Ang V12.C and E16.OE1 other bump:2.3869 Ang E13.CA and E16.OE1 other bump:1.91758 Ang V12.O and E16.CD other bump:2.73332 Ang V12.C and E16.CD other bump:2.75496 Ang V12.CG1 and E16.CD other bump:1.45654 Ang N9.OD1 and T11.OG1 other bump:2.45045 Ang N9.CG and T11.OG1 other bump:2.92142 Ang N3.CG and I5.CG2 other bump:1.96143 Ang N3.ND2 and I5.CG2 T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLREDMVVMDLIY 1sayA 216 :LLYSNSAEIETAVAEADLLIGAVLVPGRRAPILVPASLVEQMRTGSVIVDVAV Fragment has 42 clashes (null) has 42 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 55 residues other bump:2.51253 Ang T24.N and I53.CD1 other bump:2.05606 Ang T24.C and I53.CD1 other bump:2.93499 Ang P25.N and I53.CD1 other bump:2.6843 Ang T24.CA and I53.CD1 other bump:2.99341 Ang T24.CB and I53.CD1 other bump:2.54819 Ang T24.OG1 and I53.CD1 other bump:1.58666 Ang T24.O and I53.CD1 other bump:3.04979 Ang T24.C and I53.CG1 other bump:2.76659 Ang N22.CB and D51.OD2 other bump:2.23101 Ang N22.CG and D51.OD2 other bump:1.36216 Ang N22.OD1 and D51.OD2 other bump:2.65553 Ang N22.CB and D51.OD1 other bump:2.42288 Ang N22.CG and D51.OD1 other bump:2.46217 Ang N22.CB and D51.CG other bump:2.39239 Ang N22.CG and D51.CG other bump:2.11572 Ang N22.OD1 and D51.CG other bump:3.07608 Ang N22.CB and D51.CB other bump:3.25209 Ang N22.CB and D51.CA other bump:2.70117 Ang I20.CG2 and V49.CG1 other bump:2.47352 Ang L43.CD2 and M47.CE other bump:2.86871 Ang L43.CG and M47.SD other bump:2.20917 Ang L43.CD2 and M47.SD other bump:2.95067 Ang L43.CD1 and M47.SD other bump:2.83464 Ang D15.OD1 and K42.C other bump:2.10641 Ang D15.OD1 and K42.O other bump:2.36746 Ang L14.CG and K39.NZ other bump:2.51947 Ang L14.CB and K39.NZ other bump:1.70521 Ang L14.CD1 and K39.NZ other bump:2.27098 Ang E35.CD and K39.NZ other bump:1.37195 Ang E35.OE2 and K39.NZ other bump:2.40629 Ang L14.CG and K39.CE other bump:2.66309 Ang L14.CB and K39.CE other bump:1.29673 Ang L14.CD1 and K39.CE other bump:2.74995 Ang L14.CD1 and K39.CD other bump:2.62443 Ang D33.OD1 and E35.C other bump:3.00272 Ang I20.CD1 and E35.OE2 other bump:2.91817 Ang L14.CD1 and E35.OE2 self-bump: 1.34485 Ang M28.CA and M28.CB other bump:2.81175 Ang A23.C and P25.CD other bump:2.50518 Ang L14.CD2 and I20.CD1 other bump:2.83688 Ang V17.CG1 and I19.C other bump:2.60825 Ang V17.CG1 and I19.O Number of specific fragments= 3 total=882 Number of alignments=162 # Reading fragments from alignment file # T0191 read from T0191-1sayA-2track-protein-EBGHSTL-local-adpstyle5.pw.a2m.gz # 1sayA read from T0191-1sayA-2track-protein-EBGHSTL-local-adpstyle5.pw.a2m.gz # found chain 1sayA in template set T0191 19 :GRVKDKNIVIYGAGGAARAVAFELAK 1sayA 163 :PGVKPGKVVILGGGVVGTEAAKMAVG Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:2.56061 Ang I9.CD1 and L25.CD2 other bump:2.48157 Ang I9.CG1 and L25.CD1 other bump:1.10128 Ang I9.CD1 and L25.CD1 other bump:1.86376 Ang I9.CD1 and L25.CG other bump:2.28339 Ang I9.CD1 and L25.CB other bump:1.86192 Ang G13.O and A18.CB other bump:2.91693 Ang G13.C and A18.CB T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLN 1sayA 190 :GAQVQIFDINVERLSYLETLFGSRVE Fragment has 19 clashes (null) has 19 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:2.98708 Ang I22.CD1 and L26.CD2 other bump:2.54972 Ang I5.CD1 and L26.CD2 other bump:2.38607 Ang I5.CD1 and L26.CD1 other bump:2.46588 Ang I5.CG1 and L26.CD1 other bump:2.24959 Ang I5.CD1 and L26.CG other bump:2.47498 Ang I5.CG1 and L26.CG self-bump: 2.21791 Ang A23.CB and A23.C self-bump: 1.22414 Ang A23.CA and A23.CB other bump:1.70685 Ang V12.CG1 and E16.OE2 other bump:1.12933 Ang V12.O and E16.OE1 other bump:1.88395 Ang V12.C and E16.OE1 other bump:2.3869 Ang E13.CA and E16.OE1 other bump:1.91758 Ang V12.O and E16.CD other bump:2.73332 Ang V12.C and E16.CD other bump:2.75496 Ang V12.CG1 and E16.CD other bump:1.45654 Ang N9.OD1 and T11.OG1 other bump:2.45045 Ang N9.CG and T11.OG1 other bump:2.92142 Ang N3.CG and I5.CG2 other bump:1.96143 Ang N3.ND2 and I5.CG2 T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLREDMVVMDLIY 1sayA 216 :LLYSNSAEIETAVAEADLLIGAVLVPGRRAPILVPASLVEQMRTGSVIVDVAV Fragment has 42 clashes (null) has 42 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 55 residues other bump:2.51253 Ang T24.N and I53.CD1 other bump:2.05606 Ang T24.C and I53.CD1 other bump:2.93499 Ang P25.N and I53.CD1 other bump:2.6843 Ang T24.CA and I53.CD1 other bump:2.99341 Ang T24.CB and I53.CD1 other bump:2.54819 Ang T24.OG1 and I53.CD1 other bump:1.58666 Ang T24.O and I53.CD1 other bump:3.04979 Ang T24.C and I53.CG1 other bump:2.76659 Ang N22.CB and D51.OD2 other bump:2.23101 Ang N22.CG and D51.OD2 other bump:1.36216 Ang N22.OD1 and D51.OD2 other bump:2.65553 Ang N22.CB and D51.OD1 other bump:2.42288 Ang N22.CG and D51.OD1 other bump:2.46217 Ang N22.CB and D51.CG other bump:2.39239 Ang N22.CG and D51.CG other bump:2.11572 Ang N22.OD1 and D51.CG other bump:3.07608 Ang N22.CB and D51.CB other bump:3.25209 Ang N22.CB and D51.CA other bump:2.70117 Ang I20.CG2 and V49.CG1 other bump:2.47352 Ang L43.CD2 and M47.CE other bump:2.86871 Ang L43.CG and M47.SD other bump:2.20917 Ang L43.CD2 and M47.SD other bump:2.95067 Ang L43.CD1 and M47.SD other bump:2.83464 Ang D15.OD1 and K42.C other bump:2.10641 Ang D15.OD1 and K42.O other bump:2.36746 Ang L14.CG and K39.NZ other bump:2.51947 Ang L14.CB and K39.NZ other bump:1.70521 Ang L14.CD1 and K39.NZ other bump:2.27098 Ang E35.CD and K39.NZ other bump:1.37195 Ang E35.OE2 and K39.NZ other bump:2.40629 Ang L14.CG and K39.CE other bump:2.66309 Ang L14.CB and K39.CE other bump:1.29673 Ang L14.CD1 and K39.CE other bump:2.74995 Ang L14.CD1 and K39.CD other bump:2.62443 Ang D33.OD1 and E35.C other bump:3.00272 Ang I20.CD1 and E35.OE2 other bump:2.91817 Ang L14.CD1 and E35.OE2 self-bump: 1.34485 Ang M28.CA and M28.CB other bump:2.81175 Ang A23.C and P25.CD other bump:2.50518 Ang L14.CD2 and I20.CD1 other bump:2.83688 Ang V17.CG1 and I19.C other bump:2.60825 Ang V17.CG1 and I19.O Number of specific fragments= 3 total=885 Number of alignments=163 # Reading fragments from alignment file # T0191 read from T0191-1sayA-2track-protein-EBGHTL-global-adpstyle1.pw.a2m.gz # 1sayA read from T0191-1sayA-2track-protein-EBGHTL-global-adpstyle1.pw.a2m.gz # found chain 1sayA in template set T0191 3 :YNTDGIGARMALEEEIGR 1sayA 15 :RVGLSPSSVRTLVEAGHT Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 20 residues neighbor-bump: 2.88783 Ang E16.C and I17.CG1 neighbor-bump: 2.09516 Ang E16.O and I17.CB neighbor-bump: 2.48211 Ang E16.C and I17.CB T0191 21 :VKDKNIVIYGAGGAARAVAFELAK 1sayA 165 :VKPGKVVILGGGVVGTEAAKMAVG Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 26 residues other bump:2.56061 Ang I7.CD1 and L23.CD2 other bump:2.48157 Ang I7.CG1 and L23.CD1 other bump:1.10128 Ang I7.CD1 and L23.CD1 other bump:1.86376 Ang I7.CD1 and L23.CG other bump:2.28339 Ang I7.CD1 and L23.CB other bump:1.86192 Ang G11.O and A16.CB other bump:2.91693 Ang G11.C and A16.CB T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLN 1sayA 190 :GAQVQIFDINVERLSYLETLFGSRVE Fragment has 19 clashes (null) has 19 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:2.98708 Ang I22.CD1 and L26.CD2 other bump:2.54972 Ang I5.CD1 and L26.CD2 other bump:2.38607 Ang I5.CD1 and L26.CD1 other bump:2.46588 Ang I5.CG1 and L26.CD1 other bump:2.24959 Ang I5.CD1 and L26.CG other bump:2.47498 Ang I5.CG1 and L26.CG self-bump: 2.21791 Ang A23.CB and A23.C self-bump: 1.22414 Ang A23.CA and A23.CB other bump:1.70685 Ang V12.CG1 and E16.OE2 other bump:1.12933 Ang V12.O and E16.OE1 other bump:1.88395 Ang V12.C and E16.OE1 other bump:2.3869 Ang E13.CA and E16.OE1 other bump:1.91758 Ang V12.O and E16.CD other bump:2.73332 Ang V12.C and E16.CD other bump:2.75496 Ang V12.CG1 and E16.CD other bump:1.45654 Ang N9.OD1 and T11.OG1 other bump:2.45045 Ang N9.CG and T11.OG1 other bump:2.92142 Ang N3.CG and I5.CG2 other bump:1.96143 Ang N3.ND2 and I5.CG2 T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLREDMVVMDLIY 1sayA 216 :LLYSNSAEIETAVAEADLLIGAVLVPGRRAPILVPASLVEQMRTGSVIVDVAV Fragment has 42 clashes (null) has 42 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 55 residues other bump:2.51253 Ang T24.N and I53.CD1 other bump:2.05606 Ang T24.C and I53.CD1 other bump:2.93499 Ang P25.N and I53.CD1 other bump:2.6843 Ang T24.CA and I53.CD1 other bump:2.99341 Ang T24.CB and I53.CD1 other bump:2.54819 Ang T24.OG1 and I53.CD1 other bump:1.58666 Ang T24.O and I53.CD1 other bump:3.04979 Ang T24.C and I53.CG1 other bump:2.76659 Ang N22.CB and D51.OD2 other bump:2.23101 Ang N22.CG and D51.OD2 other bump:1.36216 Ang N22.OD1 and D51.OD2 other bump:2.65553 Ang N22.CB and D51.OD1 other bump:2.42288 Ang N22.CG and D51.OD1 other bump:2.46217 Ang N22.CB and D51.CG other bump:2.39239 Ang N22.CG and D51.CG other bump:2.11572 Ang N22.OD1 and D51.CG other bump:3.07608 Ang N22.CB and D51.CB other bump:3.25209 Ang N22.CB and D51.CA other bump:2.70117 Ang I20.CG2 and V49.CG1 other bump:2.47352 Ang L43.CD2 and M47.CE other bump:2.86871 Ang L43.CG and M47.SD other bump:2.20917 Ang L43.CD2 and M47.SD other bump:2.95067 Ang L43.CD1 and M47.SD other bump:2.83464 Ang D15.OD1 and K42.C other bump:2.10641 Ang D15.OD1 and K42.O other bump:2.36746 Ang L14.CG and K39.NZ other bump:2.51947 Ang L14.CB and K39.NZ other bump:1.70521 Ang L14.CD1 and K39.NZ other bump:2.27098 Ang E35.CD and K39.NZ other bump:1.37195 Ang E35.OE2 and K39.NZ other bump:2.40629 Ang L14.CG and K39.CE other bump:2.66309 Ang L14.CB and K39.CE other bump:1.29673 Ang L14.CD1 and K39.CE other bump:2.74995 Ang L14.CD1 and K39.CD other bump:2.62443 Ang D33.OD1 and E35.C other bump:3.00272 Ang I20.CD1 and E35.OE2 other bump:2.91817 Ang L14.CD1 and E35.OE2 self-bump: 1.34485 Ang M28.CA and M28.CB other bump:2.81175 Ang A23.C and P25.CD other bump:2.50518 Ang L14.CD2 and I20.CD1 other bump:2.83688 Ang V17.CG1 and I19.C other bump:2.60825 Ang V17.CG1 and I19.O T0191 127 :NPLETVLLKEAKKVNAKTINGLGMLIYQGAVAFK 1sayA 299 :NMPGAVPWTATQALNNSTLPYVVKLANQGLKALE Fragment has 8 clashes (null) has 8 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 35 residues other bump:2.47398 Ang G24.O and Y28.CD1 self-bump: 1.38773 Ang Y28.CA and Y28.CB other bump:2.55961 Ang N16.O and I20.CD1 other bump:2.13052 Ang N16.O and I20.CG1 other bump:1.97811 Ang L4.CD2 and E11.OE2 other bump:3.01091 Ang L4.CB and E11.CD other bump:2.68628 Ang L4.CD2 and E11.CD other bump:2.78581 Ang N2.OD1 and E5.CB Number of specific fragments= 5 total=890 Number of alignments=164 # Reading fragments from alignment file # T0191 read from T0191-1sayA-2track-protein-EBGHTL-global-adpstyle5.pw.a2m.gz # 1sayA read from T0191-1sayA-2track-protein-EBGHTL-global-adpstyle5.pw.a2m.gz # found chain 1sayA in template set T0191 1 :I 1sayA 1 :M Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 2 residues T0191 3 :YNTDGIGARMALEEEIGR 1sayA 15 :RVGLSPSSVRTLVEAGHT Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 20 residues neighbor-bump: 2.88783 Ang E16.C and I17.CG1 neighbor-bump: 2.09516 Ang E16.O and I17.CB neighbor-bump: 2.48211 Ang E16.C and I17.CB T0191 21 :VKDKNIVIYGAGGAARAVAFELAK 1sayA 165 :VKPGKVVILGGGVVGTEAAKMAVG Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 26 residues other bump:2.56061 Ang I7.CD1 and L23.CD2 other bump:2.48157 Ang I7.CG1 and L23.CD1 other bump:1.10128 Ang I7.CD1 and L23.CD1 other bump:1.86376 Ang I7.CD1 and L23.CG other bump:2.28339 Ang I7.CD1 and L23.CB other bump:1.86192 Ang G11.O and A16.CB other bump:2.91693 Ang G11.C and A16.CB T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLN 1sayA 190 :GAQVQIFDINVERLSYLETLFGSRVE Fragment has 19 clashes (null) has 19 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:2.98708 Ang I22.CD1 and L26.CD2 other bump:2.54972 Ang I5.CD1 and L26.CD2 other bump:2.38607 Ang I5.CD1 and L26.CD1 other bump:2.46588 Ang I5.CG1 and L26.CD1 other bump:2.24959 Ang I5.CD1 and L26.CG other bump:2.47498 Ang I5.CG1 and L26.CG self-bump: 2.21791 Ang A23.CB and A23.C self-bump: 1.22414 Ang A23.CA and A23.CB other bump:1.70685 Ang V12.CG1 and E16.OE2 other bump:1.12933 Ang V12.O and E16.OE1 other bump:1.88395 Ang V12.C and E16.OE1 other bump:2.3869 Ang E13.CA and E16.OE1 other bump:1.91758 Ang V12.O and E16.CD other bump:2.73332 Ang V12.C and E16.CD other bump:2.75496 Ang V12.CG1 and E16.CD other bump:1.45654 Ang N9.OD1 and T11.OG1 other bump:2.45045 Ang N9.CG and T11.OG1 other bump:2.92142 Ang N3.CG and I5.CG2 other bump:1.96143 Ang N3.ND2 and I5.CG2 T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLREDMVVMDLIY 1sayA 216 :LLYSNSAEIETAVAEADLLIGAVLVPGRRAPILVPASLVEQMRTGSVIVDVAV Fragment has 42 clashes (null) has 42 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 55 residues other bump:2.51253 Ang T24.N and I53.CD1 other bump:2.05606 Ang T24.C and I53.CD1 other bump:2.93499 Ang P25.N and I53.CD1 other bump:2.6843 Ang T24.CA and I53.CD1 other bump:2.99341 Ang T24.CB and I53.CD1 other bump:2.54819 Ang T24.OG1 and I53.CD1 other bump:1.58666 Ang T24.O and I53.CD1 other bump:3.04979 Ang T24.C and I53.CG1 other bump:2.76659 Ang N22.CB and D51.OD2 other bump:2.23101 Ang N22.CG and D51.OD2 other bump:1.36216 Ang N22.OD1 and D51.OD2 other bump:2.65553 Ang N22.CB and D51.OD1 other bump:2.42288 Ang N22.CG and D51.OD1 other bump:2.46217 Ang N22.CB and D51.CG other bump:2.39239 Ang N22.CG and D51.CG other bump:2.11572 Ang N22.OD1 and D51.CG other bump:3.07608 Ang N22.CB and D51.CB other bump:3.25209 Ang N22.CB and D51.CA other bump:2.70117 Ang I20.CG2 and V49.CG1 other bump:2.47352 Ang L43.CD2 and M47.CE other bump:2.86871 Ang L43.CG and M47.SD other bump:2.20917 Ang L43.CD2 and M47.SD other bump:2.95067 Ang L43.CD1 and M47.SD other bump:2.83464 Ang D15.OD1 and K42.C other bump:2.10641 Ang D15.OD1 and K42.O other bump:2.36746 Ang L14.CG and K39.NZ other bump:2.51947 Ang L14.CB and K39.NZ other bump:1.70521 Ang L14.CD1 and K39.NZ other bump:2.27098 Ang E35.CD and K39.NZ other bump:1.37195 Ang E35.OE2 and K39.NZ other bump:2.40629 Ang L14.CG and K39.CE other bump:2.66309 Ang L14.CB and K39.CE other bump:1.29673 Ang L14.CD1 and K39.CE other bump:2.74995 Ang L14.CD1 and K39.CD other bump:2.62443 Ang D33.OD1 and E35.C other bump:3.00272 Ang I20.CD1 and E35.OE2 other bump:2.91817 Ang L14.CD1 and E35.OE2 self-bump: 1.34485 Ang M28.CA and M28.CB other bump:2.81175 Ang A23.C and P25.CD other bump:2.50518 Ang L14.CD2 and I20.CD1 other bump:2.83688 Ang V17.CG1 and I19.C other bump:2.60825 Ang V17.CG1 and I19.O T0191 128 :PLETVL 1sayA 301 :PGAVPW Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 8 residues other bump:2.39494 Ang G1.O and E4.OE2 other bump:0.725532 Ang G1.O and E4.OE1 other bump:1.86299 Ang G1.C and E4.OE1 other bump:1.69955 Ang G1.O and E4.CD other bump:2.74209 Ang G1.C and E4.CD T0191 135 :KEAKKVNAKTINGLGMLIYQGAVAFK 1sayA 307 :TATQALNNSTLPYVVKLANQGLKALE Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 27 residues other bump:2.47398 Ang G16.O and Y20.CD1 self-bump: 1.38773 Ang Y20.CA and Y20.CB other bump:2.55961 Ang N8.O and I12.CD1 other bump:2.13052 Ang N8.O and I12.CG1 Number of specific fragments= 7 total=897 Number of alignments=165 # Reading fragments from alignment file # T0191 read from T0191-1sayA-2track-protein-EBGHTL-local-adpstyle1.pw.a2m.gz # 1sayA read from T0191-1sayA-2track-protein-EBGHTL-local-adpstyle1.pw.a2m.gz # found chain 1sayA in template set T0191 25 :NIVIYGAGGAARAVAFELAK 1sayA 169 :KVVILGGGVVGTEAAKMAVG Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 22 residues other bump:2.56061 Ang I3.CD1 and L19.CD2 other bump:2.48157 Ang I3.CG1 and L19.CD1 other bump:1.10127 Ang I3.CD1 and L19.CD1 other bump:1.86377 Ang I3.CD1 and L19.CG other bump:2.28339 Ang I3.CD1 and L19.CB other bump:2.91693 Ang G7.C and A12.CB other bump:1.86192 Ang G7.O and A12.CB T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLN 1sayA 190 :GAQVQIFDINVERLSYLETLFGSRVE Fragment has 19 clashes (null) has 19 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:2.98708 Ang I22.CD1 and L26.CD2 other bump:2.54972 Ang I5.CD1 and L26.CD2 other bump:2.38607 Ang I5.CD1 and L26.CD1 other bump:2.46588 Ang I5.CG1 and L26.CD1 other bump:2.24959 Ang I5.CD1 and L26.CG other bump:2.47498 Ang I5.CG1 and L26.CG self-bump: 2.21791 Ang A23.CB and A23.C self-bump: 1.22414 Ang A23.CA and A23.CB other bump:1.70685 Ang V12.CG1 and E16.OE2 other bump:1.12933 Ang V12.O and E16.OE1 other bump:1.88395 Ang V12.C and E16.OE1 other bump:2.3869 Ang E13.CA and E16.OE1 other bump:1.91758 Ang V12.O and E16.CD other bump:2.73332 Ang V12.C and E16.CD other bump:2.75496 Ang V12.CG1 and E16.CD other bump:1.45654 Ang N9.OD1 and T11.OG1 other bump:2.45045 Ang N9.CG and T11.OG1 other bump:2.92142 Ang N3.CG and I5.CG2 other bump:1.96143 Ang N3.ND2 and I5.CG2 T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLREDMVVMDLIYNP 1sayA 216 :LLYSNSAEIETAVAEADLLIGAVLVPGRRAPILVPASLVEQMRTGSVIVDVAVDQ Fragment has 42 clashes (null) has 42 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 57 residues other bump:2.51253 Ang T24.N and I53.CD1 other bump:2.05606 Ang T24.C and I53.CD1 other bump:2.93499 Ang P25.N and I53.CD1 other bump:2.6843 Ang T24.CA and I53.CD1 other bump:2.99341 Ang T24.CB and I53.CD1 other bump:2.54819 Ang T24.OG1 and I53.CD1 other bump:1.58666 Ang T24.O and I53.CD1 other bump:3.04979 Ang T24.C and I53.CG1 other bump:2.76659 Ang N22.CB and D51.OD2 other bump:2.23101 Ang N22.CG and D51.OD2 other bump:1.36216 Ang N22.OD1 and D51.OD2 other bump:2.65553 Ang N22.CB and D51.OD1 other bump:2.42288 Ang N22.CG and D51.OD1 other bump:2.46217 Ang N22.CB and D51.CG other bump:2.39239 Ang N22.CG and D51.CG other bump:2.11572 Ang N22.OD1 and D51.CG other bump:3.07608 Ang N22.CB and D51.CB other bump:3.25209 Ang N22.CB and D51.CA other bump:2.70117 Ang I20.CG2 and V49.CG1 other bump:2.47352 Ang L43.CD2 and M47.CE other bump:2.86871 Ang L43.CG and M47.SD other bump:2.20917 Ang L43.CD2 and M47.SD other bump:2.95067 Ang L43.CD1 and M47.SD other bump:2.83464 Ang D15.OD1 and K42.C other bump:2.10641 Ang D15.OD1 and K42.O other bump:2.36746 Ang L14.CG and K39.NZ other bump:2.51947 Ang L14.CB and K39.NZ other bump:1.70521 Ang L14.CD1 and K39.NZ other bump:2.27098 Ang E35.CD and K39.NZ other bump:1.37195 Ang E35.OE2 and K39.NZ other bump:2.40629 Ang L14.CG and K39.CE other bump:2.66309 Ang L14.CB and K39.CE other bump:1.29673 Ang L14.CD1 and K39.CE other bump:2.74995 Ang L14.CD1 and K39.CD other bump:2.62443 Ang D33.OD1 and E35.C other bump:3.00272 Ang I20.CD1 and E35.OE2 other bump:2.91817 Ang L14.CD1 and E35.OE2 self-bump: 1.34485 Ang M28.CA and M28.CB other bump:2.81175 Ang A23.C and P25.CD other bump:2.50518 Ang L14.CD2 and I20.CD1 other bump:2.83688 Ang V17.CG1 and I19.C other bump:2.60825 Ang V17.CG1 and I19.O Number of specific fragments= 3 total=900 Number of alignments=166 # Reading fragments from alignment file # T0191 read from T0191-1sayA-2track-protein-EBGHTL-local-adpstyle5.pw.a2m.gz # 1sayA read from T0191-1sayA-2track-protein-EBGHTL-local-adpstyle5.pw.a2m.gz # found chain 1sayA in template set T0191 18 :IGRVKDKNIVIYGAGGAARAVAFELAK 1sayA 162 :VPGVKPGKVVILGGGVVGTEAAKMAVG Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 29 residues other bump:2.56061 Ang I10.CD1 and L26.CD2 other bump:2.48157 Ang I10.CG1 and L26.CD1 other bump:1.10128 Ang I10.CD1 and L26.CD1 other bump:1.86376 Ang I10.CD1 and L26.CG other bump:2.28339 Ang I10.CD1 and L26.CB other bump:1.86192 Ang G14.O and A19.CB other bump:2.91693 Ang G14.C and A19.CB T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLN 1sayA 190 :GAQVQIFDINVERLSYLETLFGSRVE Fragment has 19 clashes (null) has 19 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:2.98708 Ang I22.CD1 and L26.CD2 other bump:2.54972 Ang I5.CD1 and L26.CD2 other bump:2.38607 Ang I5.CD1 and L26.CD1 other bump:2.46588 Ang I5.CG1 and L26.CD1 other bump:2.24959 Ang I5.CD1 and L26.CG other bump:2.47498 Ang I5.CG1 and L26.CG self-bump: 2.21791 Ang A23.CB and A23.C self-bump: 1.22414 Ang A23.CA and A23.CB other bump:1.70685 Ang V12.CG1 and E16.OE2 other bump:1.12933 Ang V12.O and E16.OE1 other bump:1.88395 Ang V12.C and E16.OE1 other bump:2.3869 Ang E13.CA and E16.OE1 other bump:1.91758 Ang V12.O and E16.CD other bump:2.73332 Ang V12.C and E16.CD other bump:2.75496 Ang V12.CG1 and E16.CD other bump:1.45654 Ang N9.OD1 and T11.OG1 other bump:2.45045 Ang N9.CG and T11.OG1 other bump:2.92142 Ang N3.CG and I5.CG2 other bump:1.96143 Ang N3.ND2 and I5.CG2 T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLREDMVVMDLIYNP 1sayA 216 :LLYSNSAEIETAVAEADLLIGAVLVPGRRAPILVPASLVEQMRTGSVIVDVAVDQ Fragment has 42 clashes (null) has 42 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 57 residues other bump:2.51253 Ang T24.N and I53.CD1 other bump:2.05606 Ang T24.C and I53.CD1 other bump:2.93499 Ang P25.N and I53.CD1 other bump:2.6843 Ang T24.CA and I53.CD1 other bump:2.99341 Ang T24.CB and I53.CD1 other bump:2.54819 Ang T24.OG1 and I53.CD1 other bump:1.58666 Ang T24.O and I53.CD1 other bump:3.04979 Ang T24.C and I53.CG1 other bump:2.76659 Ang N22.CB and D51.OD2 other bump:2.23101 Ang N22.CG and D51.OD2 other bump:1.36216 Ang N22.OD1 and D51.OD2 other bump:2.65553 Ang N22.CB and D51.OD1 other bump:2.42288 Ang N22.CG and D51.OD1 other bump:2.46217 Ang N22.CB and D51.CG other bump:2.39239 Ang N22.CG and D51.CG other bump:2.11572 Ang N22.OD1 and D51.CG other bump:3.07608 Ang N22.CB and D51.CB other bump:3.25209 Ang N22.CB and D51.CA other bump:2.70117 Ang I20.CG2 and V49.CG1 other bump:2.47352 Ang L43.CD2 and M47.CE other bump:2.86871 Ang L43.CG and M47.SD other bump:2.20917 Ang L43.CD2 and M47.SD other bump:2.95067 Ang L43.CD1 and M47.SD other bump:2.83464 Ang D15.OD1 and K42.C other bump:2.10641 Ang D15.OD1 and K42.O other bump:2.36746 Ang L14.CG and K39.NZ other bump:2.51947 Ang L14.CB and K39.NZ other bump:1.70521 Ang L14.CD1 and K39.NZ other bump:2.27098 Ang E35.CD and K39.NZ other bump:1.37195 Ang E35.OE2 and K39.NZ other bump:2.40629 Ang L14.CG and K39.CE other bump:2.66309 Ang L14.CB and K39.CE other bump:1.29673 Ang L14.CD1 and K39.CE other bump:2.74995 Ang L14.CD1 and K39.CD other bump:2.62443 Ang D33.OD1 and E35.C other bump:3.00272 Ang I20.CD1 and E35.OE2 other bump:2.91817 Ang L14.CD1 and E35.OE2 self-bump: 1.34485 Ang M28.CA and M28.CB other bump:2.81175 Ang A23.C and P25.CD other bump:2.50518 Ang L14.CD2 and I20.CD1 other bump:2.83688 Ang V17.CG1 and I19.C other bump:2.60825 Ang V17.CG1 and I19.O Number of specific fragments= 3 total=903 Number of alignments=167 # Reading fragments from alignment file # T0191 read from T0191-1sayA-2track-protein-STR-global-adpstyle1.pw.a2m.gz # 1sayA read from T0191-1sayA-2track-protein-STR-global-adpstyle1.pw.a2m.gz # found chain 1sayA in template set T0191 3 :YNTDGIGARMALEEEIGR 1sayA 15 :RVGLSPSSVRTLVEAGHT Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 20 residues neighbor-bump: 2.88783 Ang E16.C and I17.CG1 neighbor-bump: 2.09516 Ang E16.O and I17.CB neighbor-bump: 2.48211 Ang E16.C and I17.CB T0191 21 :VKDKNIVIYGAGGAARAVAFELAK 1sayA 165 :VKPGKVVILGGGVVGTEAAKMAVG Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 26 residues other bump:2.56061 Ang I7.CD1 and L23.CD2 other bump:2.48157 Ang I7.CG1 and L23.CD1 other bump:1.10128 Ang I7.CD1 and L23.CD1 other bump:1.86376 Ang I7.CD1 and L23.CG other bump:2.28339 Ang I7.CD1 and L23.CB other bump:1.86192 Ang G11.O and A16.CB other bump:2.91693 Ang G11.C and A16.CB T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLN 1sayA 190 :GAQVQIFDINVERLSYLETLFGSRVE Fragment has 19 clashes (null) has 19 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:2.98708 Ang I22.CD1 and L26.CD2 other bump:2.54972 Ang I5.CD1 and L26.CD2 other bump:2.38607 Ang I5.CD1 and L26.CD1 other bump:2.46588 Ang I5.CG1 and L26.CD1 other bump:2.24959 Ang I5.CD1 and L26.CG other bump:2.47498 Ang I5.CG1 and L26.CG self-bump: 2.21791 Ang A23.CB and A23.C self-bump: 1.22414 Ang A23.CA and A23.CB other bump:1.70685 Ang V12.CG1 and E16.OE2 other bump:1.12933 Ang V12.O and E16.OE1 other bump:1.88395 Ang V12.C and E16.OE1 other bump:2.3869 Ang E13.CA and E16.OE1 other bump:1.91758 Ang V12.O and E16.CD other bump:2.73332 Ang V12.C and E16.CD other bump:2.75496 Ang V12.CG1 and E16.CD other bump:1.45654 Ang N9.OD1 and T11.OG1 other bump:2.45045 Ang N9.CG and T11.OG1 other bump:2.92142 Ang N3.CG and I5.CG2 other bump:1.96143 Ang N3.ND2 and I5.CG2 T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLREDMVVMDLIY 1sayA 216 :LLYSNSAEIETAVAEADLLIGAVLVPGRRAPILVPASLVEQMRTGSVIVDVAV Fragment has 42 clashes (null) has 42 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 55 residues other bump:2.51253 Ang T24.N and I53.CD1 other bump:2.05606 Ang T24.C and I53.CD1 other bump:2.93499 Ang P25.N and I53.CD1 other bump:2.6843 Ang T24.CA and I53.CD1 other bump:2.99341 Ang T24.CB and I53.CD1 other bump:2.54819 Ang T24.OG1 and I53.CD1 other bump:1.58666 Ang T24.O and I53.CD1 other bump:3.04979 Ang T24.C and I53.CG1 other bump:2.76659 Ang N22.CB and D51.OD2 other bump:2.23101 Ang N22.CG and D51.OD2 other bump:1.36216 Ang N22.OD1 and D51.OD2 other bump:2.65553 Ang N22.CB and D51.OD1 other bump:2.42288 Ang N22.CG and D51.OD1 other bump:2.46217 Ang N22.CB and D51.CG other bump:2.39239 Ang N22.CG and D51.CG other bump:2.11572 Ang N22.OD1 and D51.CG other bump:3.07608 Ang N22.CB and D51.CB other bump:3.25209 Ang N22.CB and D51.CA other bump:2.70117 Ang I20.CG2 and V49.CG1 other bump:2.47352 Ang L43.CD2 and M47.CE other bump:2.86871 Ang L43.CG and M47.SD other bump:2.20917 Ang L43.CD2 and M47.SD other bump:2.95067 Ang L43.CD1 and M47.SD other bump:2.83464 Ang D15.OD1 and K42.C other bump:2.10641 Ang D15.OD1 and K42.O other bump:2.36746 Ang L14.CG and K39.NZ other bump:2.51947 Ang L14.CB and K39.NZ other bump:1.70521 Ang L14.CD1 and K39.NZ other bump:2.27098 Ang E35.CD and K39.NZ other bump:1.37195 Ang E35.OE2 and K39.NZ other bump:2.40629 Ang L14.CG and K39.CE other bump:2.66309 Ang L14.CB and K39.CE other bump:1.29673 Ang L14.CD1 and K39.CE other bump:2.74995 Ang L14.CD1 and K39.CD other bump:2.62443 Ang D33.OD1 and E35.C other bump:3.00272 Ang I20.CD1 and E35.OE2 other bump:2.91817 Ang L14.CD1 and E35.OE2 self-bump: 1.34485 Ang M28.CA and M28.CB other bump:2.81175 Ang A23.C and P25.CD other bump:2.50518 Ang L14.CD2 and I20.CD1 other bump:2.83688 Ang V17.CG1 and I19.C other bump:2.60825 Ang V17.CG1 and I19.O T0191 127 :NPLE 1sayA 297 :VPNM Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 6 residues other bump:2.22515 Ang N2.O and E5.OE2 T0191 131 :TVLLKEAKKVNAKTINGLGMLIYQGAVAFK 1sayA 303 :AVPWTATQALNNSTLPYVVKLANQGLKALE Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 31 residues other bump:2.47398 Ang G20.O and Y24.CD1 self-bump: 1.38773 Ang Y24.CA and Y24.CB other bump:2.55961 Ang N12.O and I16.CD1 other bump:2.13052 Ang N12.O and I16.CG1 Number of specific fragments= 6 total=909 Number of alignments=168 # Reading fragments from alignment file # T0191 read from T0191-1sayA-2track-protein-STR-global-adpstyle5.pw.a2m.gz # 1sayA read from T0191-1sayA-2track-protein-STR-global-adpstyle5.pw.a2m.gz # found chain 1sayA in template set T0191 1 :I 1sayA 1 :M Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 2 residues T0191 3 :YNTDGIGARMALEEEIGR 1sayA 15 :RVGLSPSSVRTLVEAGHT Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 20 residues neighbor-bump: 2.88783 Ang E16.C and I17.CG1 neighbor-bump: 2.09516 Ang E16.O and I17.CB neighbor-bump: 2.48211 Ang E16.C and I17.CB T0191 21 :VKDKNIVIYGAGGAARAVAFELAK 1sayA 165 :VKPGKVVILGGGVVGTEAAKMAVG Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 26 residues other bump:2.56061 Ang I7.CD1 and L23.CD2 other bump:2.48157 Ang I7.CG1 and L23.CD1 other bump:1.10128 Ang I7.CD1 and L23.CD1 other bump:1.86376 Ang I7.CD1 and L23.CG other bump:2.28339 Ang I7.CD1 and L23.CB other bump:1.86192 Ang G11.O and A16.CB other bump:2.91693 Ang G11.C and A16.CB T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLN 1sayA 190 :GAQVQIFDINVERLSYLETLFGSRVE Fragment has 19 clashes (null) has 19 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:2.98708 Ang I22.CD1 and L26.CD2 other bump:2.54972 Ang I5.CD1 and L26.CD2 other bump:2.38607 Ang I5.CD1 and L26.CD1 other bump:2.46588 Ang I5.CG1 and L26.CD1 other bump:2.24959 Ang I5.CD1 and L26.CG other bump:2.47498 Ang I5.CG1 and L26.CG self-bump: 2.21791 Ang A23.CB and A23.C self-bump: 1.22414 Ang A23.CA and A23.CB other bump:1.70685 Ang V12.CG1 and E16.OE2 other bump:1.12933 Ang V12.O and E16.OE1 other bump:1.88395 Ang V12.C and E16.OE1 other bump:2.3869 Ang E13.CA and E16.OE1 other bump:1.91758 Ang V12.O and E16.CD other bump:2.73332 Ang V12.C and E16.CD other bump:2.75496 Ang V12.CG1 and E16.CD other bump:1.45654 Ang N9.OD1 and T11.OG1 other bump:2.45045 Ang N9.CG and T11.OG1 other bump:2.92142 Ang N3.CG and I5.CG2 other bump:1.96143 Ang N3.ND2 and I5.CG2 T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLREDMVVMDLIY 1sayA 216 :LLYSNSAEIETAVAEADLLIGAVLVPGRRAPILVPASLVEQMRTGSVIVDVAV Fragment has 42 clashes (null) has 42 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 55 residues other bump:2.51253 Ang T24.N and I53.CD1 other bump:2.05606 Ang T24.C and I53.CD1 other bump:2.93499 Ang P25.N and I53.CD1 other bump:2.6843 Ang T24.CA and I53.CD1 other bump:2.99341 Ang T24.CB and I53.CD1 other bump:2.54819 Ang T24.OG1 and I53.CD1 other bump:1.58666 Ang T24.O and I53.CD1 other bump:3.04979 Ang T24.C and I53.CG1 other bump:2.76659 Ang N22.CB and D51.OD2 other bump:2.23101 Ang N22.CG and D51.OD2 other bump:1.36216 Ang N22.OD1 and D51.OD2 other bump:2.65553 Ang N22.CB and D51.OD1 other bump:2.42288 Ang N22.CG and D51.OD1 other bump:2.46217 Ang N22.CB and D51.CG other bump:2.39239 Ang N22.CG and D51.CG other bump:2.11572 Ang N22.OD1 and D51.CG other bump:3.07608 Ang N22.CB and D51.CB other bump:3.25209 Ang N22.CB and D51.CA other bump:2.70117 Ang I20.CG2 and V49.CG1 other bump:2.47352 Ang L43.CD2 and M47.CE other bump:2.86871 Ang L43.CG and M47.SD other bump:2.20917 Ang L43.CD2 and M47.SD other bump:2.95067 Ang L43.CD1 and M47.SD other bump:2.83464 Ang D15.OD1 and K42.C other bump:2.10641 Ang D15.OD1 and K42.O other bump:2.36746 Ang L14.CG and K39.NZ other bump:2.51947 Ang L14.CB and K39.NZ other bump:1.70521 Ang L14.CD1 and K39.NZ other bump:2.27098 Ang E35.CD and K39.NZ other bump:1.37195 Ang E35.OE2 and K39.NZ other bump:2.40629 Ang L14.CG and K39.CE other bump:2.66309 Ang L14.CB and K39.CE other bump:1.29673 Ang L14.CD1 and K39.CE other bump:2.74995 Ang L14.CD1 and K39.CD other bump:2.62443 Ang D33.OD1 and E35.C other bump:3.00272 Ang I20.CD1 and E35.OE2 other bump:2.91817 Ang L14.CD1 and E35.OE2 self-bump: 1.34485 Ang M28.CA and M28.CB other bump:2.81175 Ang A23.C and P25.CD other bump:2.50518 Ang L14.CD2 and I20.CD1 other bump:2.83688 Ang V17.CG1 and I19.C other bump:2.60825 Ang V17.CG1 and I19.O T0191 127 :NPLETV 1sayA 300 :MPGAVP Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 8 residues other bump:2.39494 Ang N2.O and E5.OE2 other bump:1.86299 Ang N2.C and E5.OE1 other bump:0.725532 Ang N2.O and E5.OE1 other bump:2.73914 Ang N2.CA and E5.OE1 other bump:2.74209 Ang N2.C and E5.CD other bump:1.69955 Ang N2.O and E5.CD T0191 134 :LKEAKKVNAKTINGLGMLIYQGAVAFK 1sayA 306 :WTATQALNNSTLPYVVKLANQGLKALE Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:2.47398 Ang G17.O and Y21.CD1 self-bump: 1.38773 Ang Y21.CA and Y21.CB other bump:2.55961 Ang N9.O and I13.CD1 other bump:2.13052 Ang N9.O and I13.CG1 Number of specific fragments= 7 total=916 Number of alignments=169 # Reading fragments from alignment file # T0191 read from T0191-1sayA-2track-protein-STR-local-adpstyle1.pw.a2m.gz # 1sayA read from T0191-1sayA-2track-protein-STR-local-adpstyle1.pw.a2m.gz # found chain 1sayA in template set T0191 2 :GYNTDGIGARMALEEEIGR 1sayA 137 :GRLSVQFGARFLERQQGGR Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 21 residues neighbor-bump: 2.40439 Ang E17.O and I18.CD1 neighbor-bump: 1.9122 Ang E17.O and I18.CG1 neighbor-bump: 2.5899 Ang E17.C and I18.CG1 neighbor-bump: 2.03206 Ang E17.O and I18.CB neighbor-bump: 2.51803 Ang E17.C and I18.CB neighbor-bump: 3.23064 Ang R11.NE and M12.CE T0191 21 :VKDKNIVIYGAGGAARAVAFELAK 1sayA 165 :VKPGKVVILGGGVVGTEAAKMAVG Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 26 residues other bump:2.56061 Ang I7.CD1 and L23.CD2 other bump:2.48157 Ang I7.CG1 and L23.CD1 other bump:1.10128 Ang I7.CD1 and L23.CD1 other bump:1.86376 Ang I7.CD1 and L23.CG other bump:2.28339 Ang I7.CD1 and L23.CB other bump:1.86192 Ang G11.O and A16.CB other bump:2.91693 Ang G11.C and A16.CB T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLN 1sayA 190 :GAQVQIFDINVERLSYLETLFGSRVE Fragment has 19 clashes (null) has 19 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:2.98708 Ang I22.CD1 and L26.CD2 other bump:2.54972 Ang I5.CD1 and L26.CD2 other bump:2.38607 Ang I5.CD1 and L26.CD1 other bump:2.46588 Ang I5.CG1 and L26.CD1 other bump:2.24959 Ang I5.CD1 and L26.CG other bump:2.47498 Ang I5.CG1 and L26.CG self-bump: 2.21791 Ang A23.CB and A23.C self-bump: 1.22414 Ang A23.CA and A23.CB other bump:1.70685 Ang V12.CG1 and E16.OE2 other bump:1.12933 Ang V12.O and E16.OE1 other bump:1.88395 Ang V12.C and E16.OE1 other bump:2.3869 Ang E13.CA and E16.OE1 other bump:1.91758 Ang V12.O and E16.CD other bump:2.73332 Ang V12.C and E16.CD other bump:2.75496 Ang V12.CG1 and E16.CD other bump:1.45654 Ang N9.OD1 and T11.OG1 other bump:2.45045 Ang N9.CG and T11.OG1 other bump:2.92142 Ang N3.CG and I5.CG2 other bump:1.96143 Ang N3.ND2 and I5.CG2 T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLREDMVVMDLIY 1sayA 216 :LLYSNSAEIETAVAEADLLIGAVLVPGRRAPILVPASLVEQMRTGSVIVDVAV Fragment has 42 clashes (null) has 42 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 55 residues other bump:2.51253 Ang T24.N and I53.CD1 other bump:2.05606 Ang T24.C and I53.CD1 other bump:2.93499 Ang P25.N and I53.CD1 other bump:2.6843 Ang T24.CA and I53.CD1 other bump:2.99341 Ang T24.CB and I53.CD1 other bump:2.54819 Ang T24.OG1 and I53.CD1 other bump:1.58666 Ang T24.O and I53.CD1 other bump:3.04979 Ang T24.C and I53.CG1 other bump:2.76659 Ang N22.CB and D51.OD2 other bump:2.23101 Ang N22.CG and D51.OD2 other bump:1.36216 Ang N22.OD1 and D51.OD2 other bump:2.65553 Ang N22.CB and D51.OD1 other bump:2.42288 Ang N22.CG and D51.OD1 other bump:2.46217 Ang N22.CB and D51.CG other bump:2.39239 Ang N22.CG and D51.CG other bump:2.11572 Ang N22.OD1 and D51.CG other bump:3.07608 Ang N22.CB and D51.CB other bump:3.25209 Ang N22.CB and D51.CA other bump:2.70117 Ang I20.CG2 and V49.CG1 other bump:2.47352 Ang L43.CD2 and M47.CE other bump:2.86871 Ang L43.CG and M47.SD other bump:2.20917 Ang L43.CD2 and M47.SD other bump:2.95067 Ang L43.CD1 and M47.SD other bump:2.83464 Ang D15.OD1 and K42.C other bump:2.10641 Ang D15.OD1 and K42.O other bump:2.36746 Ang L14.CG and K39.NZ other bump:2.51947 Ang L14.CB and K39.NZ other bump:1.70521 Ang L14.CD1 and K39.NZ other bump:2.27098 Ang E35.CD and K39.NZ other bump:1.37195 Ang E35.OE2 and K39.NZ other bump:2.40629 Ang L14.CG and K39.CE other bump:2.66309 Ang L14.CB and K39.CE other bump:1.29673 Ang L14.CD1 and K39.CE other bump:2.74995 Ang L14.CD1 and K39.CD other bump:2.62443 Ang D33.OD1 and E35.C other bump:3.00272 Ang I20.CD1 and E35.OE2 other bump:2.91817 Ang L14.CD1 and E35.OE2 self-bump: 1.34485 Ang M28.CA and M28.CB other bump:2.81175 Ang A23.C and P25.CD other bump:2.50518 Ang L14.CD2 and I20.CD1 other bump:2.83688 Ang V17.CG1 and I19.C other bump:2.60825 Ang V17.CG1 and I19.O Number of specific fragments= 4 total=920 Number of alignments=170 # Reading fragments from alignment file # T0191 read from T0191-1sayA-2track-protein-STR-local-adpstyle5.pw.a2m.gz # 1sayA read from T0191-1sayA-2track-protein-STR-local-adpstyle5.pw.a2m.gz # found chain 1sayA in template set T0191 6 :DGIGARMALEEEIGR 1sayA 141 :VQFGARFLERQQGGR Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 17 residues neighbor-bump: 2.40439 Ang E13.O and I14.CD1 neighbor-bump: 1.9122 Ang E13.O and I14.CG1 neighbor-bump: 2.5899 Ang E13.C and I14.CG1 neighbor-bump: 2.03206 Ang E13.O and I14.CB neighbor-bump: 2.51803 Ang E13.C and I14.CB neighbor-bump: 3.23064 Ang R7.NE and M8.CE T0191 21 :VKDKNIVIYGAGGAARAVAFELAK 1sayA 165 :VKPGKVVILGGGVVGTEAAKMAVG Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 26 residues other bump:2.56061 Ang I7.CD1 and L23.CD2 other bump:2.48157 Ang I7.CG1 and L23.CD1 other bump:1.10128 Ang I7.CD1 and L23.CD1 other bump:1.86376 Ang I7.CD1 and L23.CG other bump:2.28339 Ang I7.CD1 and L23.CB other bump:1.86192 Ang G11.O and A16.CB other bump:2.91693 Ang G11.C and A16.CB T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLN 1sayA 190 :GAQVQIFDINVERLSYLETLFGSRVE Fragment has 19 clashes (null) has 19 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:2.98708 Ang I22.CD1 and L26.CD2 other bump:2.54972 Ang I5.CD1 and L26.CD2 other bump:2.38607 Ang I5.CD1 and L26.CD1 other bump:2.46588 Ang I5.CG1 and L26.CD1 other bump:2.24959 Ang I5.CD1 and L26.CG other bump:2.47498 Ang I5.CG1 and L26.CG self-bump: 2.21791 Ang A23.CB and A23.C self-bump: 1.22414 Ang A23.CA and A23.CB other bump:1.70685 Ang V12.CG1 and E16.OE2 other bump:1.12933 Ang V12.O and E16.OE1 other bump:1.88395 Ang V12.C and E16.OE1 other bump:2.3869 Ang E13.CA and E16.OE1 other bump:1.91758 Ang V12.O and E16.CD other bump:2.73332 Ang V12.C and E16.CD other bump:2.75496 Ang V12.CG1 and E16.CD other bump:1.45654 Ang N9.OD1 and T11.OG1 other bump:2.45045 Ang N9.CG and T11.OG1 other bump:2.92142 Ang N3.CG and I5.CG2 other bump:1.96143 Ang N3.ND2 and I5.CG2 T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLREDMVVMDLIY 1sayA 216 :LLYSNSAEIETAVAEADLLIGAVLVPGRRAPILVPASLVEQMRTGSVIVDVAV Fragment has 42 clashes (null) has 42 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 55 residues other bump:2.51253 Ang T24.N and I53.CD1 other bump:2.05606 Ang T24.C and I53.CD1 other bump:2.93499 Ang P25.N and I53.CD1 other bump:2.6843 Ang T24.CA and I53.CD1 other bump:2.99341 Ang T24.CB and I53.CD1 other bump:2.54819 Ang T24.OG1 and I53.CD1 other bump:1.58666 Ang T24.O and I53.CD1 other bump:3.04979 Ang T24.C and I53.CG1 other bump:2.76659 Ang N22.CB and D51.OD2 other bump:2.23101 Ang N22.CG and D51.OD2 other bump:1.36216 Ang N22.OD1 and D51.OD2 other bump:2.65553 Ang N22.CB and D51.OD1 other bump:2.42288 Ang N22.CG and D51.OD1 other bump:2.46217 Ang N22.CB and D51.CG other bump:2.39239 Ang N22.CG and D51.CG other bump:2.11572 Ang N22.OD1 and D51.CG other bump:3.07608 Ang N22.CB and D51.CB other bump:3.25209 Ang N22.CB and D51.CA other bump:2.70117 Ang I20.CG2 and V49.CG1 other bump:2.47352 Ang L43.CD2 and M47.CE other bump:2.86871 Ang L43.CG and M47.SD other bump:2.20917 Ang L43.CD2 and M47.SD other bump:2.95067 Ang L43.CD1 and M47.SD other bump:2.83464 Ang D15.OD1 and K42.C other bump:2.10641 Ang D15.OD1 and K42.O other bump:2.36746 Ang L14.CG and K39.NZ other bump:2.51947 Ang L14.CB and K39.NZ other bump:1.70521 Ang L14.CD1 and K39.NZ other bump:2.27098 Ang E35.CD and K39.NZ other bump:1.37195 Ang E35.OE2 and K39.NZ other bump:2.40629 Ang L14.CG and K39.CE other bump:2.66309 Ang L14.CB and K39.CE other bump:1.29673 Ang L14.CD1 and K39.CE other bump:2.74995 Ang L14.CD1 and K39.CD other bump:2.62443 Ang D33.OD1 and E35.C other bump:3.00272 Ang I20.CD1 and E35.OE2 other bump:2.91817 Ang L14.CD1 and E35.OE2 self-bump: 1.34485 Ang M28.CA and M28.CB other bump:2.81175 Ang A23.C and P25.CD other bump:2.50518 Ang L14.CD2 and I20.CD1 other bump:2.83688 Ang V17.CG1 and I19.C other bump:2.60825 Ang V17.CG1 and I19.O Number of specific fragments= 4 total=924 Number of alignments=171 # Reading fragments from alignment file # T0191 read from T0191-1sayA-local-adpstyle1.pw.a2m.gz # 1sayA read from T0191-1sayA-local-adpstyle1.pw.a2m.gz # found chain 1sayA in template set T0191 9 :GARMALEEEIGRVKDKNIVIYGAGGAARAVAFELAK 1sayA 153 :GGRGVLLGGVPGVKPGKVVILGGGVVGTEAAKMAVG Fragment has 44 clashes (null) has 44 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 38 residues other bump:3.09278 Ang E9.CG and G38.CA other bump:3.04609 Ang E9.CD and G38.CA other bump:2.75608 Ang E9.OE2 and G38.CA other bump:2.56061 Ang I19.CD1 and L35.CD2 other bump:1.10128 Ang I19.CD1 and L35.CD1 other bump:2.48157 Ang I19.CG1 and L35.CD1 other bump:1.86376 Ang I19.CD1 and L35.CG other bump:2.28339 Ang I19.CD1 and L35.CB other bump:1.86192 Ang G23.O and A28.CB other bump:2.91693 Ang G23.C and A28.CB other bump:2.36668 Ang E8.CD and K17.NZ other bump:1.70675 Ang E8.CG and K17.NZ other bump:2.6459 Ang E8.CG and K17.CE other bump:3.28898 Ang L7.C and K17.CG other bump:2.99765 Ang E8.N and K17.CG other bump:2.46514 Ang E8.CA and K17.CG other bump:3.03107 Ang E8.CA and K17.CB other bump:3.23339 Ang E10.CG and D16.C other bump:2.35617 Ang E10.OE1 and D16.OD2 other bump:1.89922 Ang E9.O and D16.OD1 other bump:2.65946 Ang E9.C and D16.OD1 other bump:2.10901 Ang E10.OE2 and D16.OD1 other bump:1.98112 Ang E10.CB and D16.OD1 other bump:1.82342 Ang E10.CG and D16.OD1 other bump:1.73063 Ang E10.CD and D16.OD1 other bump:1.74892 Ang E10.OE1 and D16.CG other bump:2.34411 Ang E10.OE2 and D16.CG other bump:3.09435 Ang E10.CB and D16.CG other bump:2.37494 Ang E10.CG and D16.CG other bump:1.70371 Ang E10.CD and D16.CG other bump:1.47636 Ang E10.OE1 and D16.CB other bump:2.456 Ang E10.CG and D16.CB other bump:2.10831 Ang E10.CD and D16.CB other bump:1.96371 Ang E10.OE1 and D16.CA other bump:3.21873 Ang E10.CB and D16.CA other bump:1.74937 Ang E10.CG and D16.CA other bump:2.13597 Ang E10.CD and D16.CA other bump:1.7689 Ang E10.OE1 and D16.N other bump:2.01333 Ang E10.CG and D16.N other bump:1.83427 Ang E10.CD and D16.N other bump:2.56301 Ang E10.CG and K15.C other bump:2.81307 Ang E10.CD and K15.C neighbor-bump: 2.11263 Ang E9.O and E10.CB neighbor-bump: 2.52822 Ang E9.C and E10.CB T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLN 1sayA 190 :GAQVQIFDINVERLSYLETLFGSRVE Fragment has 19 clashes (null) has 19 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:2.98708 Ang I22.CD1 and L26.CD2 other bump:2.54972 Ang I5.CD1 and L26.CD2 other bump:2.38607 Ang I5.CD1 and L26.CD1 other bump:2.46588 Ang I5.CG1 and L26.CD1 other bump:2.24959 Ang I5.CD1 and L26.CG other bump:2.47498 Ang I5.CG1 and L26.CG self-bump: 2.21791 Ang A23.CB and A23.C self-bump: 1.22414 Ang A23.CA and A23.CB other bump:1.70685 Ang V12.CG1 and E16.OE2 other bump:1.12933 Ang V12.O and E16.OE1 other bump:1.88395 Ang V12.C and E16.OE1 other bump:2.3869 Ang E13.CA and E16.OE1 other bump:1.91758 Ang V12.O and E16.CD other bump:2.73332 Ang V12.C and E16.CD other bump:2.75496 Ang V12.CG1 and E16.CD other bump:1.45654 Ang N9.OD1 and T11.OG1 other bump:2.45045 Ang N9.CG and T11.OG1 other bump:2.92142 Ang N3.CG and I5.CG2 other bump:1.96143 Ang N3.ND2 and I5.CG2 T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLREDMVVMDLIY 1sayA 216 :LLYSNSAEIETAVAEADLLIGAVLVPGRRAPILVPASLVEQMRTGSVIVDVAV Fragment has 42 clashes (null) has 42 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 55 residues other bump:2.51253 Ang T24.N and I53.CD1 other bump:2.05606 Ang T24.C and I53.CD1 other bump:2.93499 Ang P25.N and I53.CD1 other bump:2.6843 Ang T24.CA and I53.CD1 other bump:2.99341 Ang T24.CB and I53.CD1 other bump:2.54819 Ang T24.OG1 and I53.CD1 other bump:1.58666 Ang T24.O and I53.CD1 other bump:3.04979 Ang T24.C and I53.CG1 other bump:2.76659 Ang N22.CB and D51.OD2 other bump:2.23101 Ang N22.CG and D51.OD2 other bump:1.36216 Ang N22.OD1 and D51.OD2 other bump:2.65553 Ang N22.CB and D51.OD1 other bump:2.42288 Ang N22.CG and D51.OD1 other bump:2.46217 Ang N22.CB and D51.CG other bump:2.39239 Ang N22.CG and D51.CG other bump:2.11572 Ang N22.OD1 and D51.CG other bump:3.07608 Ang N22.CB and D51.CB other bump:3.25209 Ang N22.CB and D51.CA other bump:2.70117 Ang I20.CG2 and V49.CG1 other bump:2.47352 Ang L43.CD2 and M47.CE other bump:2.86871 Ang L43.CG and M47.SD other bump:2.20917 Ang L43.CD2 and M47.SD other bump:2.95067 Ang L43.CD1 and M47.SD other bump:2.83464 Ang D15.OD1 and K42.C other bump:2.10641 Ang D15.OD1 and K42.O other bump:2.36746 Ang L14.CG and K39.NZ other bump:2.51947 Ang L14.CB and K39.NZ other bump:1.70521 Ang L14.CD1 and K39.NZ other bump:2.27098 Ang E35.CD and K39.NZ other bump:1.37195 Ang E35.OE2 and K39.NZ other bump:2.40629 Ang L14.CG and K39.CE other bump:2.66309 Ang L14.CB and K39.CE other bump:1.29673 Ang L14.CD1 and K39.CE other bump:2.74995 Ang L14.CD1 and K39.CD other bump:2.62443 Ang D33.OD1 and E35.C other bump:3.00272 Ang I20.CD1 and E35.OE2 other bump:2.91817 Ang L14.CD1 and E35.OE2 self-bump: 1.34485 Ang M28.CA and M28.CB other bump:2.81175 Ang A23.C and P25.CD other bump:2.50518 Ang L14.CD2 and I20.CD1 other bump:2.83688 Ang V17.CG1 and I19.C other bump:2.60825 Ang V17.CG1 and I19.O Number of specific fragments= 3 total=927 Number of alignments=172 # Reading fragments from alignment file # T0191 read from T0191-1sayA-local-adpstyle5.pw.a2m.gz # 1sayA read from T0191-1sayA-local-adpstyle5.pw.a2m.gz # found chain 1sayA in template set T0191 8 :IGARMALEEEIGRVKDKNIVIYGAGGAARAVAFELAK 1sayA 152 :QGGRGVLLGGVPGVKPGKVVILGGGVVGTEAAKMAVG Fragment has 44 clashes (null) has 44 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 39 residues other bump:3.09278 Ang E10.CG and G39.CA other bump:3.04609 Ang E10.CD and G39.CA other bump:2.75608 Ang E10.OE2 and G39.CA other bump:2.56061 Ang I20.CD1 and L36.CD2 other bump:1.10128 Ang I20.CD1 and L36.CD1 other bump:2.48157 Ang I20.CG1 and L36.CD1 other bump:1.86376 Ang I20.CD1 and L36.CG other bump:2.28339 Ang I20.CD1 and L36.CB other bump:1.86192 Ang G24.O and A29.CB other bump:2.91693 Ang G24.C and A29.CB other bump:2.36668 Ang E9.CD and K18.NZ other bump:1.70675 Ang E9.CG and K18.NZ other bump:2.6459 Ang E9.CG and K18.CE other bump:3.28898 Ang L8.C and K18.CG other bump:2.99765 Ang E9.N and K18.CG other bump:2.46514 Ang E9.CA and K18.CG other bump:3.03107 Ang E9.CA and K18.CB other bump:3.23339 Ang E11.CG and D17.C other bump:2.35617 Ang E11.OE1 and D17.OD2 other bump:1.89922 Ang E10.O and D17.OD1 other bump:2.65946 Ang E10.C and D17.OD1 other bump:1.73063 Ang E11.CD and D17.OD1 other bump:2.10901 Ang E11.OE2 and D17.OD1 other bump:1.98112 Ang E11.CB and D17.OD1 other bump:1.82342 Ang E11.CG and D17.OD1 other bump:1.70371 Ang E11.CD and D17.CG other bump:1.74892 Ang E11.OE1 and D17.CG other bump:2.34411 Ang E11.OE2 and D17.CG other bump:3.09435 Ang E11.CB and D17.CG other bump:2.37494 Ang E11.CG and D17.CG other bump:2.10831 Ang E11.CD and D17.CB other bump:1.47636 Ang E11.OE1 and D17.CB other bump:2.456 Ang E11.CG and D17.CB other bump:2.13597 Ang E11.CD and D17.CA other bump:1.96371 Ang E11.OE1 and D17.CA other bump:3.21873 Ang E11.CB and D17.CA other bump:1.74937 Ang E11.CG and D17.CA other bump:1.83427 Ang E11.CD and D17.N other bump:1.7689 Ang E11.OE1 and D17.N other bump:2.01333 Ang E11.CG and D17.N other bump:2.81307 Ang E11.CD and K16.C other bump:2.56301 Ang E11.CG and K16.C neighbor-bump: 2.11263 Ang E10.O and E11.CB neighbor-bump: 2.52822 Ang E10.C and E11.CB T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLN 1sayA 190 :GAQVQIFDINVERLSYLETLFGSRVE Fragment has 19 clashes (null) has 19 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:2.98708 Ang I22.CD1 and L26.CD2 other bump:2.54972 Ang I5.CD1 and L26.CD2 other bump:2.38607 Ang I5.CD1 and L26.CD1 other bump:2.46588 Ang I5.CG1 and L26.CD1 other bump:2.24959 Ang I5.CD1 and L26.CG other bump:2.47498 Ang I5.CG1 and L26.CG self-bump: 2.21791 Ang A23.CB and A23.C self-bump: 1.22414 Ang A23.CA and A23.CB other bump:1.70685 Ang V12.CG1 and E16.OE2 other bump:1.12933 Ang V12.O and E16.OE1 other bump:1.88395 Ang V12.C and E16.OE1 other bump:2.3869 Ang E13.CA and E16.OE1 other bump:1.91758 Ang V12.O and E16.CD other bump:2.73332 Ang V12.C and E16.CD other bump:2.75496 Ang V12.CG1 and E16.CD other bump:1.45654 Ang N9.OD1 and T11.OG1 other bump:2.45045 Ang N9.CG and T11.OG1 other bump:2.92142 Ang N3.CG and I5.CG2 other bump:1.96143 Ang N3.ND2 and I5.CG2 T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLREDMVVMDLIY 1sayA 216 :LLYSNSAEIETAVAEADLLIGAVLVPGRRAPILVPASLVEQMRTGSVIVDVAV Fragment has 42 clashes (null) has 42 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 55 residues other bump:2.51253 Ang T24.N and I53.CD1 other bump:2.05606 Ang T24.C and I53.CD1 other bump:2.93499 Ang P25.N and I53.CD1 other bump:2.6843 Ang T24.CA and I53.CD1 other bump:2.99341 Ang T24.CB and I53.CD1 other bump:2.54819 Ang T24.OG1 and I53.CD1 other bump:1.58666 Ang T24.O and I53.CD1 other bump:3.04979 Ang T24.C and I53.CG1 other bump:2.76659 Ang N22.CB and D51.OD2 other bump:2.23101 Ang N22.CG and D51.OD2 other bump:1.36216 Ang N22.OD1 and D51.OD2 other bump:2.65553 Ang N22.CB and D51.OD1 other bump:2.42288 Ang N22.CG and D51.OD1 other bump:2.46217 Ang N22.CB and D51.CG other bump:2.39239 Ang N22.CG and D51.CG other bump:2.11572 Ang N22.OD1 and D51.CG other bump:3.07608 Ang N22.CB and D51.CB other bump:3.25209 Ang N22.CB and D51.CA other bump:2.70117 Ang I20.CG2 and V49.CG1 other bump:2.47352 Ang L43.CD2 and M47.CE other bump:2.86871 Ang L43.CG and M47.SD other bump:2.20917 Ang L43.CD2 and M47.SD other bump:2.95067 Ang L43.CD1 and M47.SD other bump:2.83464 Ang D15.OD1 and K42.C other bump:2.10641 Ang D15.OD1 and K42.O other bump:2.36746 Ang L14.CG and K39.NZ other bump:2.51947 Ang L14.CB and K39.NZ other bump:1.70521 Ang L14.CD1 and K39.NZ other bump:2.27098 Ang E35.CD and K39.NZ other bump:1.37195 Ang E35.OE2 and K39.NZ other bump:2.40629 Ang L14.CG and K39.CE other bump:2.66309 Ang L14.CB and K39.CE other bump:1.29673 Ang L14.CD1 and K39.CE other bump:2.74995 Ang L14.CD1 and K39.CD other bump:2.62443 Ang D33.OD1 and E35.C other bump:3.00272 Ang I20.CD1 and E35.OE2 other bump:2.91817 Ang L14.CD1 and E35.OE2 self-bump: 1.34485 Ang M28.CA and M28.CB other bump:2.81175 Ang A23.C and P25.CD other bump:2.50518 Ang L14.CD2 and I20.CD1 other bump:2.83688 Ang V17.CG1 and I19.C other bump:2.60825 Ang V17.CG1 and I19.O Number of specific fragments= 3 total=930 Number of alignments=173 # Reading fragments from alignment file # T0191 read from T0191-1sayA-simpleSW-adpstyle1.pw.a2m.gz # 1sayA read from T0191-1sayA-simpleSW-adpstyle1.pw.a2m.gz # found chain 1sayA in template set T0191 9 :GARMALEEEIGRVKDKNIVIYGAG 1sayA 153 :GGRGVLLGGVPGVKPGKVVILGGG Fragment has 34 clashes (null) has 34 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 26 residues other bump:1.70675 Ang E8.CG and K17.NZ other bump:2.36668 Ang E8.CD and K17.NZ other bump:2.6459 Ang E8.CG and K17.CE other bump:2.99765 Ang E8.N and K17.CG other bump:2.46514 Ang E8.CA and K17.CG other bump:3.28898 Ang L7.C and K17.CG other bump:3.03107 Ang E8.CA and K17.CB other bump:3.23339 Ang E10.CG and D16.C other bump:2.35617 Ang E10.OE1 and D16.OD2 other bump:2.10901 Ang E10.OE2 and D16.OD1 other bump:1.98112 Ang E10.CB and D16.OD1 other bump:1.89922 Ang E9.O and D16.OD1 other bump:2.65946 Ang E9.C and D16.OD1 other bump:1.82342 Ang E10.CG and D16.OD1 other bump:1.73063 Ang E10.CD and D16.OD1 other bump:2.34411 Ang E10.OE2 and D16.CG other bump:3.09435 Ang E10.CB and D16.CG other bump:1.74892 Ang E10.OE1 and D16.CG other bump:2.37494 Ang E10.CG and D16.CG other bump:1.70371 Ang E10.CD and D16.CG other bump:1.47636 Ang E10.OE1 and D16.CB other bump:2.456 Ang E10.CG and D16.CB other bump:2.10831 Ang E10.CD and D16.CB other bump:3.21873 Ang E10.CB and D16.CA other bump:1.96371 Ang E10.OE1 and D16.CA other bump:1.74937 Ang E10.CG and D16.CA other bump:2.13597 Ang E10.CD and D16.CA other bump:1.7689 Ang E10.OE1 and D16.N other bump:2.01333 Ang E10.CG and D16.N other bump:1.83427 Ang E10.CD and D16.N other bump:2.56301 Ang E10.CG and K15.C other bump:2.81307 Ang E10.CD and K15.C neighbor-bump: 2.11263 Ang E9.O and E10.CB neighbor-bump: 2.52822 Ang E9.C and E10.CB Number of specific fragments= 1 total=931 Number of alignments=174 # Reading fragments from alignment file # T0191 read from T0191-1sayA-simpleSW-adpstyle5.pw.a2m.gz # 1sayA read from T0191-1sayA-simpleSW-adpstyle5.pw.a2m.gz # found chain 1sayA in template set T0191 8 :IGARMALEEEIGRVKDKNIVIYGAGGAA 1sayA 152 :QGGRGVLLGGVPGVKPGKVVILGGGVVG Fragment has 36 clashes (null) has 36 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 30 residues other bump:1.86192 Ang G24.O and A29.CB other bump:2.91692 Ang G24.C and A29.CB other bump:1.70675 Ang E9.CG and K18.NZ other bump:2.36668 Ang E9.CD and K18.NZ other bump:2.6459 Ang E9.CG and K18.CE other bump:2.99765 Ang E9.N and K18.CG other bump:2.46514 Ang E9.CA and K18.CG other bump:3.28898 Ang L8.C and K18.CG other bump:3.03107 Ang E9.CA and K18.CB other bump:3.23339 Ang E11.CG and D17.C other bump:2.35617 Ang E11.OE1 and D17.OD2 other bump:2.10901 Ang E11.OE2 and D17.OD1 other bump:1.98112 Ang E11.CB and D17.OD1 other bump:1.89922 Ang E10.O and D17.OD1 other bump:2.65946 Ang E10.C and D17.OD1 other bump:1.73063 Ang E11.CD and D17.OD1 other bump:1.82342 Ang E11.CG and D17.OD1 other bump:2.34411 Ang E11.OE2 and D17.CG other bump:3.09435 Ang E11.CB and D17.CG other bump:1.70371 Ang E11.CD and D17.CG other bump:1.74892 Ang E11.OE1 and D17.CG other bump:2.37494 Ang E11.CG and D17.CG other bump:2.10831 Ang E11.CD and D17.CB other bump:1.47636 Ang E11.OE1 and D17.CB other bump:2.456 Ang E11.CG and D17.CB other bump:3.21873 Ang E11.CB and D17.CA other bump:2.13597 Ang E11.CD and D17.CA other bump:1.96371 Ang E11.OE1 and D17.CA other bump:1.74937 Ang E11.CG and D17.CA other bump:1.83427 Ang E11.CD and D17.N other bump:1.7689 Ang E11.OE1 and D17.N other bump:2.01333 Ang E11.CG and D17.N other bump:2.81307 Ang E11.CD and K16.C other bump:2.56301 Ang E11.CG and K16.C neighbor-bump: 2.11263 Ang E10.O and E11.CB neighbor-bump: 2.52822 Ang E10.C and E11.CB T0191 36 :RAVAFELAKDNNIIIANRTVEKAEAL 1sayA 181 :EAAKMAVGLGAQVQIFDINVERLSYL Fragment has 21 clashes (null) has 21 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:1.70685 Ang V21.CG1 and E25.OE2 other bump:1.12933 Ang V21.O and E25.OE1 other bump:1.88395 Ang V21.C and E25.OE1 other bump:2.3869 Ang E22.CA and E25.OE1 other bump:1.91758 Ang V21.O and E25.CD other bump:2.73332 Ang V21.C and E25.CD other bump:2.75496 Ang V21.CG1 and E25.CD other bump:1.45654 Ang N18.OD1 and T20.OG1 other bump:2.45045 Ang N18.CG and T20.OG1 other bump:2.76041 Ang V4.CG2 and I16.CD1 other bump:2.96813 Ang V4.CG2 and I16.CG1 other bump:2.76621 Ang V4.CG1 and I14.CD1 other bump:2.92142 Ang N12.CG and I14.CG2 other bump:1.96143 Ang N12.ND2 and I14.CG2 other bump:1.27919 Ang E7.O and N12.OD1 other bump:1.93533 Ang E7.C and N12.OD1 other bump:2.69323 Ang E7.CA and N12.OD1 other bump:2.62783 Ang E7.CB and N12.ND2 other bump:2.50704 Ang E7.O and N12.CG other bump:2.99507 Ang E7.C and N12.CG other bump:3.09673 Ang E7.CB and N12.CG Number of specific fragments= 2 total=933 Number of alignments=175 # Reading fragments from alignment file # T0191 read from T0191-1sayA-vit-adpstyle1.pw.a2m.gz # 1sayA read from T0191-1sayA-vit-adpstyle1.pw.a2m.gz # found chain 1sayA in template set T0191 9 :GARMALEEEIGRVKDKNIVIYGAGGAARAVAFELAK 1sayA 153 :GGRGVLLGGVPGVKPGKVVILGGGVVGTEAAKMAVG Fragment has 44 clashes (null) has 44 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 38 residues other bump:3.09278 Ang E9.CG and G38.CA other bump:3.04609 Ang E9.CD and G38.CA other bump:2.75608 Ang E9.OE2 and G38.CA other bump:2.56061 Ang I19.CD1 and L35.CD2 other bump:1.10128 Ang I19.CD1 and L35.CD1 other bump:2.48157 Ang I19.CG1 and L35.CD1 other bump:1.86376 Ang I19.CD1 and L35.CG other bump:2.28339 Ang I19.CD1 and L35.CB other bump:1.86192 Ang G23.O and A28.CB other bump:2.91693 Ang G23.C and A28.CB other bump:2.36668 Ang E8.CD and K17.NZ other bump:1.70675 Ang E8.CG and K17.NZ other bump:2.6459 Ang E8.CG and K17.CE other bump:3.28898 Ang L7.C and K17.CG other bump:2.99765 Ang E8.N and K17.CG other bump:2.46514 Ang E8.CA and K17.CG other bump:3.03107 Ang E8.CA and K17.CB other bump:3.23339 Ang E10.CG and D16.C other bump:2.35617 Ang E10.OE1 and D16.OD2 other bump:1.89922 Ang E9.O and D16.OD1 other bump:2.65946 Ang E9.C and D16.OD1 other bump:2.10901 Ang E10.OE2 and D16.OD1 other bump:1.98112 Ang E10.CB and D16.OD1 other bump:1.82342 Ang E10.CG and D16.OD1 other bump:1.73063 Ang E10.CD and D16.OD1 other bump:1.74892 Ang E10.OE1 and D16.CG other bump:2.34411 Ang E10.OE2 and D16.CG other bump:3.09435 Ang E10.CB and D16.CG other bump:2.37494 Ang E10.CG and D16.CG other bump:1.70371 Ang E10.CD and D16.CG other bump:1.47636 Ang E10.OE1 and D16.CB other bump:2.456 Ang E10.CG and D16.CB other bump:2.10831 Ang E10.CD and D16.CB other bump:1.96371 Ang E10.OE1 and D16.CA other bump:3.21873 Ang E10.CB and D16.CA other bump:1.74937 Ang E10.CG and D16.CA other bump:2.13597 Ang E10.CD and D16.CA other bump:1.7689 Ang E10.OE1 and D16.N other bump:2.01333 Ang E10.CG and D16.N other bump:1.83427 Ang E10.CD and D16.N other bump:2.56301 Ang E10.CG and K15.C other bump:2.81307 Ang E10.CD and K15.C neighbor-bump: 2.11263 Ang E9.O and E10.CB neighbor-bump: 2.52822 Ang E9.C and E10.CB T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLN 1sayA 190 :GAQVQIFDINVERLSYLETLFGSRVE Fragment has 19 clashes (null) has 19 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:2.98708 Ang I22.CD1 and L26.CD2 other bump:2.54972 Ang I5.CD1 and L26.CD2 other bump:2.38607 Ang I5.CD1 and L26.CD1 other bump:2.46588 Ang I5.CG1 and L26.CD1 other bump:2.24959 Ang I5.CD1 and L26.CG other bump:2.47498 Ang I5.CG1 and L26.CG self-bump: 2.21791 Ang A23.CB and A23.C self-bump: 1.22414 Ang A23.CA and A23.CB other bump:1.70685 Ang V12.CG1 and E16.OE2 other bump:1.12933 Ang V12.O and E16.OE1 other bump:1.88395 Ang V12.C and E16.OE1 other bump:2.3869 Ang E13.CA and E16.OE1 other bump:1.91758 Ang V12.O and E16.CD other bump:2.73332 Ang V12.C and E16.CD other bump:2.75496 Ang V12.CG1 and E16.CD other bump:1.45654 Ang N9.OD1 and T11.OG1 other bump:2.45045 Ang N9.CG and T11.OG1 other bump:2.92142 Ang N3.CG and I5.CG2 other bump:1.96143 Ang N3.ND2 and I5.CG2 T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLREDMVVMDLIY 1sayA 216 :LLYSNSAEIETAVAEADLLIGAVLVPGRRAPILVPASLVEQMRTGSVIVDVAV Fragment has 42 clashes (null) has 42 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 55 residues other bump:2.51253 Ang T24.N and I53.CD1 other bump:2.05606 Ang T24.C and I53.CD1 other bump:2.93499 Ang P25.N and I53.CD1 other bump:2.6843 Ang T24.CA and I53.CD1 other bump:2.99341 Ang T24.CB and I53.CD1 other bump:2.54819 Ang T24.OG1 and I53.CD1 other bump:1.58666 Ang T24.O and I53.CD1 other bump:3.04979 Ang T24.C and I53.CG1 other bump:2.76659 Ang N22.CB and D51.OD2 other bump:2.23101 Ang N22.CG and D51.OD2 other bump:1.36216 Ang N22.OD1 and D51.OD2 other bump:2.65553 Ang N22.CB and D51.OD1 other bump:2.42288 Ang N22.CG and D51.OD1 other bump:2.46217 Ang N22.CB and D51.CG other bump:2.39239 Ang N22.CG and D51.CG other bump:2.11572 Ang N22.OD1 and D51.CG other bump:3.07608 Ang N22.CB and D51.CB other bump:3.25209 Ang N22.CB and D51.CA other bump:2.70117 Ang I20.CG2 and V49.CG1 other bump:2.47352 Ang L43.CD2 and M47.CE other bump:2.86871 Ang L43.CG and M47.SD other bump:2.20917 Ang L43.CD2 and M47.SD other bump:2.95067 Ang L43.CD1 and M47.SD other bump:2.83464 Ang D15.OD1 and K42.C other bump:2.10641 Ang D15.OD1 and K42.O other bump:2.36746 Ang L14.CG and K39.NZ other bump:2.51947 Ang L14.CB and K39.NZ other bump:1.70521 Ang L14.CD1 and K39.NZ other bump:2.27098 Ang E35.CD and K39.NZ other bump:1.37195 Ang E35.OE2 and K39.NZ other bump:2.40629 Ang L14.CG and K39.CE other bump:2.66309 Ang L14.CB and K39.CE other bump:1.29673 Ang L14.CD1 and K39.CE other bump:2.74995 Ang L14.CD1 and K39.CD other bump:2.62443 Ang D33.OD1 and E35.C other bump:3.00272 Ang I20.CD1 and E35.OE2 other bump:2.91817 Ang L14.CD1 and E35.OE2 self-bump: 1.34485 Ang M28.CA and M28.CB other bump:2.81175 Ang A23.C and P25.CD other bump:2.50518 Ang L14.CD2 and I20.CD1 other bump:2.83688 Ang V17.CG1 and I19.C other bump:2.60825 Ang V17.CG1 and I19.O Number of specific fragments= 3 total=936 Number of alignments=176 # Reading fragments from alignment file # T0191 read from T0191-1sayA-vit-adpstyle5.pw.a2m.gz # 1sayA read from T0191-1sayA-vit-adpstyle5.pw.a2m.gz # found chain 1sayA in template set T0191 8 :IGARMALEEEIGRVKDKNIVIYGAGGAARAVAFELAK 1sayA 152 :QGGRGVLLGGVPGVKPGKVVILGGGVVGTEAAKMAVG Fragment has 44 clashes (null) has 44 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 39 residues other bump:3.09278 Ang E10.CG and G39.CA other bump:3.04609 Ang E10.CD and G39.CA other bump:2.75608 Ang E10.OE2 and G39.CA other bump:2.56061 Ang I20.CD1 and L36.CD2 other bump:1.10128 Ang I20.CD1 and L36.CD1 other bump:2.48157 Ang I20.CG1 and L36.CD1 other bump:1.86376 Ang I20.CD1 and L36.CG other bump:2.28339 Ang I20.CD1 and L36.CB other bump:1.86192 Ang G24.O and A29.CB other bump:2.91693 Ang G24.C and A29.CB other bump:2.36668 Ang E9.CD and K18.NZ other bump:1.70675 Ang E9.CG and K18.NZ other bump:2.6459 Ang E9.CG and K18.CE other bump:3.28898 Ang L8.C and K18.CG other bump:2.99765 Ang E9.N and K18.CG other bump:2.46514 Ang E9.CA and K18.CG other bump:3.03107 Ang E9.CA and K18.CB other bump:3.23339 Ang E11.CG and D17.C other bump:2.35617 Ang E11.OE1 and D17.OD2 other bump:1.89922 Ang E10.O and D17.OD1 other bump:2.65946 Ang E10.C and D17.OD1 other bump:1.73063 Ang E11.CD and D17.OD1 other bump:2.10901 Ang E11.OE2 and D17.OD1 other bump:1.98112 Ang E11.CB and D17.OD1 other bump:1.82342 Ang E11.CG and D17.OD1 other bump:1.70371 Ang E11.CD and D17.CG other bump:1.74892 Ang E11.OE1 and D17.CG other bump:2.34411 Ang E11.OE2 and D17.CG other bump:3.09435 Ang E11.CB and D17.CG other bump:2.37494 Ang E11.CG and D17.CG other bump:2.10831 Ang E11.CD and D17.CB other bump:1.47636 Ang E11.OE1 and D17.CB other bump:2.456 Ang E11.CG and D17.CB other bump:2.13597 Ang E11.CD and D17.CA other bump:1.96371 Ang E11.OE1 and D17.CA other bump:3.21873 Ang E11.CB and D17.CA other bump:1.74937 Ang E11.CG and D17.CA other bump:1.83427 Ang E11.CD and D17.N other bump:1.7689 Ang E11.OE1 and D17.N other bump:2.01333 Ang E11.CG and D17.N other bump:2.81307 Ang E11.CD and K16.C other bump:2.56301 Ang E11.CG and K16.C neighbor-bump: 2.11263 Ang E10.O and E11.CB neighbor-bump: 2.52822 Ang E10.C and E11.CB T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLN 1sayA 190 :GAQVQIFDINVERLSYLETLFGSRVE Fragment has 19 clashes (null) has 19 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:2.98708 Ang I22.CD1 and L26.CD2 other bump:2.54972 Ang I5.CD1 and L26.CD2 other bump:2.38607 Ang I5.CD1 and L26.CD1 other bump:2.46588 Ang I5.CG1 and L26.CD1 other bump:2.24959 Ang I5.CD1 and L26.CG other bump:2.47498 Ang I5.CG1 and L26.CG self-bump: 2.21791 Ang A23.CB and A23.C self-bump: 1.22414 Ang A23.CA and A23.CB other bump:1.70685 Ang V12.CG1 and E16.OE2 other bump:1.12933 Ang V12.O and E16.OE1 other bump:1.88395 Ang V12.C and E16.OE1 other bump:2.3869 Ang E13.CA and E16.OE1 other bump:1.91758 Ang V12.O and E16.CD other bump:2.73332 Ang V12.C and E16.CD other bump:2.75496 Ang V12.CG1 and E16.CD other bump:1.45654 Ang N9.OD1 and T11.OG1 other bump:2.45045 Ang N9.CG and T11.OG1 other bump:2.92142 Ang N3.CG and I5.CG2 other bump:1.96143 Ang N3.ND2 and I5.CG2 T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLREDMVVMDLIY 1sayA 216 :LLYSNSAEIETAVAEADLLIGAVLVPGRRAPILVPASLVEQMRTGSVIVDVAV Fragment has 42 clashes (null) has 42 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 55 residues other bump:2.51253 Ang T24.N and I53.CD1 other bump:2.05606 Ang T24.C and I53.CD1 other bump:2.93499 Ang P25.N and I53.CD1 other bump:2.6843 Ang T24.CA and I53.CD1 other bump:2.99341 Ang T24.CB and I53.CD1 other bump:2.54819 Ang T24.OG1 and I53.CD1 other bump:1.58666 Ang T24.O and I53.CD1 other bump:3.04979 Ang T24.C and I53.CG1 other bump:2.76659 Ang N22.CB and D51.OD2 other bump:2.23101 Ang N22.CG and D51.OD2 other bump:1.36216 Ang N22.OD1 and D51.OD2 other bump:2.65553 Ang N22.CB and D51.OD1 other bump:2.42288 Ang N22.CG and D51.OD1 other bump:2.46217 Ang N22.CB and D51.CG other bump:2.39239 Ang N22.CG and D51.CG other bump:2.11572 Ang N22.OD1 and D51.CG other bump:3.07608 Ang N22.CB and D51.CB other bump:3.25209 Ang N22.CB and D51.CA other bump:2.70117 Ang I20.CG2 and V49.CG1 other bump:2.47352 Ang L43.CD2 and M47.CE other bump:2.86871 Ang L43.CG and M47.SD other bump:2.20917 Ang L43.CD2 and M47.SD other bump:2.95067 Ang L43.CD1 and M47.SD other bump:2.83464 Ang D15.OD1 and K42.C other bump:2.10641 Ang D15.OD1 and K42.O other bump:2.36746 Ang L14.CG and K39.NZ other bump:2.51947 Ang L14.CB and K39.NZ other bump:1.70521 Ang L14.CD1 and K39.NZ other bump:2.27098 Ang E35.CD and K39.NZ other bump:1.37195 Ang E35.OE2 and K39.NZ other bump:2.40629 Ang L14.CG and K39.CE other bump:2.66309 Ang L14.CB and K39.CE other bump:1.29673 Ang L14.CD1 and K39.CE other bump:2.74995 Ang L14.CD1 and K39.CD other bump:2.62443 Ang D33.OD1 and E35.C other bump:3.00272 Ang I20.CD1 and E35.OE2 other bump:2.91817 Ang L14.CD1 and E35.OE2 self-bump: 1.34485 Ang M28.CA and M28.CB other bump:2.81175 Ang A23.C and P25.CD other bump:2.50518 Ang L14.CD2 and I20.CD1 other bump:2.83688 Ang V17.CG1 and I19.C other bump:2.60825 Ang V17.CG1 and I19.O Number of specific fragments= 3 total=939 Number of alignments=177 # command:# Prefix for input files set to 1pjbA/ # command:# reading script from file read-alignments.under # Reading fragments from alignment file # T0191 read from 1pjbA-T0191-local-adpstyle1.pw.a2m.gz # 1pjbA read from 1pjbA-T0191-local-adpstyle1.pw.a2m.gz # found chain 1pjbA in template set T0191 21 :VKDKNIVIYGAGGAARA 1pjbA 165 :VKPGKVVILGGGVVGTE Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 19 residues other bump:1.92836 Ang G11.O and A16.CB other bump:2.95158 Ang G11.C and A16.CB T0191 39 :AFELAKDNN 1pjbA 182 :AAKMAVGLG Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.58929 Ang E4.O and D8.OD2 other bump:2.41211 Ang E4.C and D8.OD2 other bump:2.44211 Ang E4.O and D8.CG T0191 48 :IIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGL 1pjbA 193 :VQIFDINVERLSYLETLFGSRVELLYSNSAEIETA Fragment has 30 clashes (null) has 30 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 37 residues other bump:2.2043 Ang I3.CD1 and L36.CD2 other bump:2.89545 Ang I3.CG1 and L36.CD2 other bump:1.65274 Ang I3.CD1 and L36.CD1 other bump:2.29512 Ang I3.CD1 and L36.CG other bump:2.40287 Ang G28.CA and F33.CZ other bump:2.56167 Ang G28.C and F33.CZ other bump:2.91855 Ang E29.N and F33.CZ other bump:2.64081 Ang G28.CA and F33.CE2 other bump:3.22893 Ang G28.C and F33.CE1 other bump:1.9351 Ang A12.O and K25.NZ other bump:2.39626 Ang A16.N and K25.NZ other bump:2.84061 Ang L15.CA and K25.NZ other bump:2.46493 Ang L15.CB and K25.NZ other bump:2.68947 Ang L15.C and K25.NZ other bump:2.31608 Ang A12.O and K25.CE other bump:2.96515 Ang A12.C and K25.CE other bump:2.94969 Ang I19.CD1 and L23.CD2 other bump:2.44902 Ang I2.CG2 and L23.CD1 other bump:2.51921 Ang I2.CG2 and L23.CG self-bump: 2.20268 Ang A20.CB and A20.C self-bump: 1.22982 Ang A20.CA and A20.CB other bump:1.69946 Ang V9.CG1 and E13.OE2 other bump:2.29401 Ang E10.CA and E13.OE1 other bump:2.77824 Ang E10.C and E13.OE1 other bump:1.09857 Ang V9.O and E13.OE1 other bump:1.78251 Ang V9.C and E13.OE1 other bump:2.24801 Ang E10.N and E13.OE1 other bump:2.76124 Ang V9.CG1 and E13.CD other bump:1.88968 Ang V9.O and E13.CD other bump:2.64365 Ang V9.C and E13.CD T0191 86 :LDGVDIIINATPIGMYPNIDVEPIVKAEKLREDMVVMDL 1pjbA 228 :VAEADLLIGAVLVPGRRAPILVPASLVEQMRTGSVIVDV Fragment has 28 clashes (null) has 28 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 41 residues other bump:2.30318 Ang N10.CG and D39.OD2 other bump:1.41777 Ang N10.OD1 and D39.OD2 other bump:2.6915 Ang N10.CB and D39.OD1 other bump:2.41436 Ang N10.CG and D39.OD1 other bump:2.49701 Ang N10.CB and D39.CG other bump:2.42431 Ang N10.CG and D39.CG other bump:2.1063 Ang N10.OD1 and D39.CG other bump:3.11224 Ang N10.CB and D39.CB other bump:3.23977 Ang N10.CB and D39.CA other bump:3.03327 Ang I8.CG1 and V37.CG1 other bump:3.04491 Ang I8.CD1 and V37.CG1 other bump:1.36164 Ang V5.O and M35.CE other bump:2.3306 Ang V5.C and M35.CE other bump:2.69265 Ang D6.C and M35.SD other bump:2.41025 Ang V5.O and M35.SD other bump:3.08109 Ang D6.CA and M35.SD other bump:2.74048 Ang D6.O and M35.SD other bump:2.13004 Ang D3.OD1 and K30.O other bump:2.55501 Ang L2.CB and K27.NZ other bump:2.85577 Ang L2.CB and K27.CE other bump:2.63275 Ang D21.OD1 and E23.C other bump:3.03091 Ang L2.CD1 and E23.OE2 other bump:2.89138 Ang I8.CD1 and E23.OE1 self-bump: 1.34334 Ang M16.CA and M16.CB other bump:2.72802 Ang A11.C and P13.CD other bump:2.55923 Ang V5.CG1 and I8.CG2 other bump:2.87573 Ang V5.CG1 and I7.C other bump:2.67136 Ang V5.CG1 and I7.O Number of specific fragments= 4 total=943 Number of alignments=178 # Reading fragments from alignment file # T0191 read from 1pjbA-T0191-local-adpstyle5.pw.a2m.gz # 1pjbA read from 1pjbA-T0191-local-adpstyle5.pw.a2m.gz # found chain 1pjbA in template set T0191 12 :MALEEEIGRVKDKNIVIYGAGGAARA 1pjbA 156 :GVLLGGVPGVKPGKVVILGGGVVGTE Fragment has 32 clashes (null) has 32 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:1.92836 Ang G20.O and A25.CB other bump:2.95158 Ang G20.C and A25.CB other bump:1.87475 Ang E5.CG and K14.NZ other bump:2.57217 Ang E5.CD and K14.NZ other bump:2.77202 Ang E5.CG and K14.CE other bump:3.08341 Ang E5.N and K14.CG other bump:2.56817 Ang E5.CA and K14.CG other bump:3.07367 Ang E5.CA and K14.CB other bump:2.36681 Ang E7.OE1 and D13.OD2 other bump:1.95152 Ang E6.O and D13.OD1 other bump:2.69038 Ang E6.C and D13.OD1 other bump:1.73761 Ang E7.CD and D13.OD1 other bump:2.16492 Ang E7.OE2 and D13.OD1 other bump:2.11643 Ang E7.CB and D13.OD1 other bump:1.87989 Ang E7.CG and D13.OD1 other bump:1.78756 Ang E7.CD and D13.CG other bump:1.72944 Ang E7.OE1 and D13.CG other bump:2.44751 Ang E7.OE2 and D13.CG other bump:2.47637 Ang E7.CG and D13.CG other bump:2.21762 Ang E7.CD and D13.CB other bump:1.52107 Ang E7.OE1 and D13.CB other bump:2.58769 Ang E7.CG and D13.CB other bump:2.19718 Ang E7.CD and D13.CA other bump:1.95957 Ang E7.OE1 and D13.CA other bump:1.85675 Ang E7.CG and D13.CA other bump:1.83947 Ang E7.CD and D13.N other bump:1.71558 Ang E7.OE1 and D13.N other bump:2.04417 Ang E7.CG and D13.N other bump:2.76366 Ang E7.CD and K12.C other bump:2.53024 Ang E7.CG and K12.C neighbor-bump: 2.11869 Ang E6.O and E7.CB neighbor-bump: 2.534 Ang E6.C and E7.CB T0191 39 :AFELAKDNN 1pjbA 182 :AAKMAVGLG Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.58929 Ang E4.O and D8.OD2 other bump:2.41211 Ang E4.C and D8.OD2 other bump:2.44211 Ang E4.O and D8.CG T0191 48 :IIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGL 1pjbA 193 :VQIFDINVERLSYLETLFGSRVELLYSNSAEIETA Fragment has 30 clashes (null) has 30 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 37 residues other bump:2.2043 Ang I3.CD1 and L36.CD2 other bump:2.89545 Ang I3.CG1 and L36.CD2 other bump:1.65274 Ang I3.CD1 and L36.CD1 other bump:2.29512 Ang I3.CD1 and L36.CG other bump:2.40287 Ang G28.CA and F33.CZ other bump:2.56167 Ang G28.C and F33.CZ other bump:2.91855 Ang E29.N and F33.CZ other bump:2.64081 Ang G28.CA and F33.CE2 other bump:3.22893 Ang G28.C and F33.CE1 other bump:1.9351 Ang A12.O and K25.NZ other bump:2.39626 Ang A16.N and K25.NZ other bump:2.84061 Ang L15.CA and K25.NZ other bump:2.46493 Ang L15.CB and K25.NZ other bump:2.68947 Ang L15.C and K25.NZ other bump:2.31608 Ang A12.O and K25.CE other bump:2.96515 Ang A12.C and K25.CE other bump:2.94969 Ang I19.CD1 and L23.CD2 other bump:2.44902 Ang I2.CG2 and L23.CD1 other bump:2.51921 Ang I2.CG2 and L23.CG self-bump: 2.20268 Ang A20.CB and A20.C self-bump: 1.22982 Ang A20.CA and A20.CB other bump:1.69946 Ang V9.CG1 and E13.OE2 other bump:2.29401 Ang E10.CA and E13.OE1 other bump:2.77824 Ang E10.C and E13.OE1 other bump:1.09857 Ang V9.O and E13.OE1 other bump:1.78251 Ang V9.C and E13.OE1 other bump:2.24801 Ang E10.N and E13.OE1 other bump:2.76124 Ang V9.CG1 and E13.CD other bump:1.88968 Ang V9.O and E13.CD other bump:2.64365 Ang V9.C and E13.CD T0191 86 :LDGVDIIINATPIGM 1pjbA 228 :VAEADLLIGAVLVPG Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 17 residues self-bump: 1.34334 Ang M16.CA and M16.CB other bump:2.72802 Ang A11.C and P13.CD other bump:2.55923 Ang V5.CG1 and I8.CG2 other bump:2.87573 Ang V5.CG1 and I7.C other bump:2.67136 Ang V5.CG1 and I7.O T0191 105 :DVEPIVKAEKLREDM 1pjbA 243 :RRAPILVPASLVEQM Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 17 residues T0191 120 :VVMDL 1pjbA 262 :VIVDV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 7 residues Number of specific fragments= 6 total=949 Number of alignments=179 # Reading fragments from alignment file # T0191 read from 1pjbA-T0191-vit-adpstyle1.pw.a2m.gz # 1pjbA read from 1pjbA-T0191-vit-adpstyle1.pw.a2m.gz # found chain 1pjbA in template set T0191 21 :VKDKNIVIYGAGGAARA 1pjbA 165 :VKPGKVVILGGGVVGTE Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 19 residues other bump:1.92836 Ang G11.O and A16.CB other bump:2.95158 Ang G11.C and A16.CB T0191 39 :AFELAKDNN 1pjbA 182 :AAKMAVGLG Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.58929 Ang E4.O and D8.OD2 other bump:2.41211 Ang E4.C and D8.OD2 other bump:2.44211 Ang E4.O and D8.CG T0191 48 :IIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGL 1pjbA 193 :VQIFDINVERLSYLETLFGSRVELLYSNSAEIETA Fragment has 30 clashes (null) has 30 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 37 residues other bump:2.2043 Ang I3.CD1 and L36.CD2 other bump:2.89545 Ang I3.CG1 and L36.CD2 other bump:1.65274 Ang I3.CD1 and L36.CD1 other bump:2.29512 Ang I3.CD1 and L36.CG other bump:2.40287 Ang G28.CA and F33.CZ other bump:2.56167 Ang G28.C and F33.CZ other bump:2.91855 Ang E29.N and F33.CZ other bump:2.64081 Ang G28.CA and F33.CE2 other bump:3.22893 Ang G28.C and F33.CE1 other bump:1.9351 Ang A12.O and K25.NZ other bump:2.39626 Ang A16.N and K25.NZ other bump:2.84061 Ang L15.CA and K25.NZ other bump:2.46493 Ang L15.CB and K25.NZ other bump:2.68947 Ang L15.C and K25.NZ other bump:2.31608 Ang A12.O and K25.CE other bump:2.96515 Ang A12.C and K25.CE other bump:2.94969 Ang I19.CD1 and L23.CD2 other bump:2.44902 Ang I2.CG2 and L23.CD1 other bump:2.51921 Ang I2.CG2 and L23.CG self-bump: 2.20268 Ang A20.CB and A20.C self-bump: 1.22982 Ang A20.CA and A20.CB other bump:1.69946 Ang V9.CG1 and E13.OE2 other bump:2.29401 Ang E10.CA and E13.OE1 other bump:2.77824 Ang E10.C and E13.OE1 other bump:1.09857 Ang V9.O and E13.OE1 other bump:1.78251 Ang V9.C and E13.OE1 other bump:2.24801 Ang E10.N and E13.OE1 other bump:2.76124 Ang V9.CG1 and E13.CD other bump:1.88968 Ang V9.O and E13.CD other bump:2.64365 Ang V9.C and E13.CD T0191 86 :LDGVDIIINATPIGMYPNIDVEPIVKAEKLREDMVVMDL 1pjbA 228 :VAEADLLIGAVLVPGRRAPILVPASLVEQMRTGSVIVDV Fragment has 28 clashes (null) has 28 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 41 residues other bump:2.30318 Ang N10.CG and D39.OD2 other bump:1.41777 Ang N10.OD1 and D39.OD2 other bump:2.6915 Ang N10.CB and D39.OD1 other bump:2.41436 Ang N10.CG and D39.OD1 other bump:2.49701 Ang N10.CB and D39.CG other bump:2.42431 Ang N10.CG and D39.CG other bump:2.1063 Ang N10.OD1 and D39.CG other bump:3.11224 Ang N10.CB and D39.CB other bump:3.23977 Ang N10.CB and D39.CA other bump:3.03327 Ang I8.CG1 and V37.CG1 other bump:3.04491 Ang I8.CD1 and V37.CG1 other bump:1.36164 Ang V5.O and M35.CE other bump:2.3306 Ang V5.C and M35.CE other bump:2.69265 Ang D6.C and M35.SD other bump:2.41025 Ang V5.O and M35.SD other bump:3.08109 Ang D6.CA and M35.SD other bump:2.74048 Ang D6.O and M35.SD other bump:2.13004 Ang D3.OD1 and K30.O other bump:2.55501 Ang L2.CB and K27.NZ other bump:2.85577 Ang L2.CB and K27.CE other bump:2.63275 Ang D21.OD1 and E23.C other bump:3.03091 Ang L2.CD1 and E23.OE2 other bump:2.89138 Ang I8.CD1 and E23.OE1 self-bump: 1.34334 Ang M16.CA and M16.CB other bump:2.72802 Ang A11.C and P13.CD other bump:2.55923 Ang V5.CG1 and I8.CG2 other bump:2.87573 Ang V5.CG1 and I7.C other bump:2.67136 Ang V5.CG1 and I7.O Number of specific fragments= 4 total=953 Number of alignments=180 # Reading fragments from alignment file # T0191 read from 1pjbA-T0191-vit-adpstyle5.pw.a2m.gz # 1pjbA read from 1pjbA-T0191-vit-adpstyle5.pw.a2m.gz # found chain 1pjbA in template set T0191 12 :MALEEEIGRVKDKNIVIYGAGGAARA 1pjbA 156 :GVLLGGVPGVKPGKVVILGGGVVGTE Fragment has 32 clashes (null) has 32 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:1.92836 Ang G20.O and A25.CB other bump:2.95158 Ang G20.C and A25.CB other bump:1.87475 Ang E5.CG and K14.NZ other bump:2.57217 Ang E5.CD and K14.NZ other bump:2.77202 Ang E5.CG and K14.CE other bump:3.08341 Ang E5.N and K14.CG other bump:2.56817 Ang E5.CA and K14.CG other bump:3.07367 Ang E5.CA and K14.CB other bump:2.36681 Ang E7.OE1 and D13.OD2 other bump:1.95152 Ang E6.O and D13.OD1 other bump:2.69038 Ang E6.C and D13.OD1 other bump:1.73761 Ang E7.CD and D13.OD1 other bump:2.16492 Ang E7.OE2 and D13.OD1 other bump:2.11643 Ang E7.CB and D13.OD1 other bump:1.87989 Ang E7.CG and D13.OD1 other bump:1.78756 Ang E7.CD and D13.CG other bump:1.72944 Ang E7.OE1 and D13.CG other bump:2.44751 Ang E7.OE2 and D13.CG other bump:2.47637 Ang E7.CG and D13.CG other bump:2.21762 Ang E7.CD and D13.CB other bump:1.52107 Ang E7.OE1 and D13.CB other bump:2.58769 Ang E7.CG and D13.CB other bump:2.19718 Ang E7.CD and D13.CA other bump:1.95957 Ang E7.OE1 and D13.CA other bump:1.85675 Ang E7.CG and D13.CA other bump:1.83947 Ang E7.CD and D13.N other bump:1.71558 Ang E7.OE1 and D13.N other bump:2.04417 Ang E7.CG and D13.N other bump:2.76366 Ang E7.CD and K12.C other bump:2.53024 Ang E7.CG and K12.C neighbor-bump: 2.11869 Ang E6.O and E7.CB neighbor-bump: 2.534 Ang E6.C and E7.CB T0191 39 :AFELAKDNN 1pjbA 182 :AAKMAVGLG Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.58929 Ang E4.O and D8.OD2 other bump:2.41211 Ang E4.C and D8.OD2 other bump:2.44211 Ang E4.O and D8.CG T0191 48 :IIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGL 1pjbA 193 :VQIFDINVERLSYLETLFGSRVELLYSNSAEIETA Fragment has 30 clashes (null) has 30 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 37 residues other bump:2.2043 Ang I3.CD1 and L36.CD2 other bump:2.89545 Ang I3.CG1 and L36.CD2 other bump:1.65274 Ang I3.CD1 and L36.CD1 other bump:2.29512 Ang I3.CD1 and L36.CG other bump:2.40287 Ang G28.CA and F33.CZ other bump:2.56167 Ang G28.C and F33.CZ other bump:2.91855 Ang E29.N and F33.CZ other bump:2.64081 Ang G28.CA and F33.CE2 other bump:3.22893 Ang G28.C and F33.CE1 other bump:1.9351 Ang A12.O and K25.NZ other bump:2.39626 Ang A16.N and K25.NZ other bump:2.84061 Ang L15.CA and K25.NZ other bump:2.46493 Ang L15.CB and K25.NZ other bump:2.68947 Ang L15.C and K25.NZ other bump:2.31608 Ang A12.O and K25.CE other bump:2.96515 Ang A12.C and K25.CE other bump:2.94969 Ang I19.CD1 and L23.CD2 other bump:2.44902 Ang I2.CG2 and L23.CD1 other bump:2.51921 Ang I2.CG2 and L23.CG self-bump: 2.20268 Ang A20.CB and A20.C self-bump: 1.22982 Ang A20.CA and A20.CB other bump:1.69946 Ang V9.CG1 and E13.OE2 other bump:2.29401 Ang E10.CA and E13.OE1 other bump:2.77824 Ang E10.C and E13.OE1 other bump:1.09857 Ang V9.O and E13.OE1 other bump:1.78251 Ang V9.C and E13.OE1 other bump:2.24801 Ang E10.N and E13.OE1 other bump:2.76124 Ang V9.CG1 and E13.CD other bump:1.88968 Ang V9.O and E13.CD other bump:2.64365 Ang V9.C and E13.CD T0191 86 :LDGVDIIINATPIGM 1pjbA 228 :VAEADLLIGAVLVPG Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 17 residues self-bump: 1.34334 Ang M16.CA and M16.CB other bump:2.72802 Ang A11.C and P13.CD other bump:2.55923 Ang V5.CG1 and I8.CG2 other bump:2.87573 Ang V5.CG1 and I7.C other bump:2.67136 Ang V5.CG1 and I7.O T0191 105 :DVEPIVKAEKLREDM 1pjbA 243 :RRAPILVPASLVEQM Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 17 residues T0191 120 :VVMDL 1pjbA 262 :VIVDV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 7 residues Number of specific fragments= 6 total=959 Number of alignments=181 # Reading fragments from alignment file # T0191 read from T0191-1pjbA-2track-protein-EBGHSTL-global-adpstyle1.pw.a2m.gz # 1pjbA read from T0191-1pjbA-2track-protein-EBGHSTL-global-adpstyle1.pw.a2m.gz # found chain 1pjbA in template set T0191 3 :YNTDGIGARMALEEEIGR 1pjbA 15 :RVGLSPSSVRTLVEAGHT Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 20 residues neighbor-bump: 3.03583 Ang E16.C and I17.CG1 other bump:1.66542 Ang I7.CD1 and R10.NH2 other bump:2.5917 Ang I7.CD1 and R10.CZ other bump:2.84015 Ang I7.CD1 and R10.NE T0191 21 :VKDKNIVIYGAGGAARAVAFELAK 1pjbA 165 :VKPGKVVILGGGVVGTEAAKMAVG Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 26 residues other bump:2.87104 Ang I7.CD1 and L23.CD2 other bump:2.48007 Ang I7.CG1 and L23.CD1 other bump:1.07324 Ang I7.CD1 and L23.CD1 other bump:2.03151 Ang I7.CD1 and L23.CG other bump:2.39615 Ang I7.CD1 and L23.CB other bump:1.92836 Ang G11.O and A16.CB other bump:2.95158 Ang G11.C and A16.CB T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLN 1pjbA 190 :GAQVQIFDINVERLSYLETLFGSRVE Fragment has 19 clashes (null) has 19 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:2.94969 Ang I22.CD1 and L26.CD2 other bump:2.86667 Ang I5.CD1 and L26.CD2 other bump:2.7084 Ang I5.CG1 and L26.CD1 other bump:2.69185 Ang I5.CD1 and L26.CD1 other bump:2.68568 Ang I5.CG1 and L26.CG other bump:2.55449 Ang I5.CD1 and L26.CG self-bump: 2.20268 Ang A23.CB and A23.C self-bump: 1.22982 Ang A23.CA and A23.CB other bump:1.69946 Ang V12.CG1 and E16.OE2 other bump:1.09857 Ang V12.O and E16.OE1 other bump:1.78251 Ang V12.C and E16.OE1 other bump:2.24801 Ang E13.N and E16.OE1 other bump:2.29401 Ang E13.CA and E16.OE1 other bump:2.77824 Ang E13.C and E16.OE1 other bump:1.88968 Ang V12.O and E16.CD other bump:2.64365 Ang V12.C and E16.CD other bump:2.76124 Ang V12.CG1 and E16.CD other bump:2.98556 Ang N3.CG and I5.CG2 other bump:1.94842 Ang N3.ND2 and I5.CG2 T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLREDMVVMDLIY 1pjbA 216 :LLYSNSAEIETAVAEADLLIGAVLVPGRRAPILVPASLVEQMRTGSVIVDVAV Fragment has 41 clashes (null) has 41 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 55 residues other bump:2.62164 Ang T24.N and I53.CD1 other bump:2.72237 Ang T24.CA and I53.CD1 other bump:1.83179 Ang T24.C and I53.CD1 other bump:2.54505 Ang P25.N and I53.CD1 other bump:2.42416 Ang P25.CG and I53.CD1 other bump:2.88348 Ang P25.CD and I53.CD1 other bump:2.9826 Ang P25.CA and I53.CD1 other bump:3.02195 Ang P25.CB and I53.CD1 other bump:3.01 Ang T24.OG1 and I53.CD1 other bump:1.39498 Ang T24.O and I53.CD1 other bump:2.27341 Ang P25.CG and I53.CG1 other bump:2.56688 Ang P25.CB and I53.CG1 other bump:2.30318 Ang N22.CG and D51.OD2 other bump:1.41777 Ang N22.OD1 and D51.OD2 other bump:2.6915 Ang N22.CB and D51.OD1 other bump:2.41436 Ang N22.CG and D51.OD1 other bump:2.49701 Ang N22.CB and D51.CG other bump:2.42431 Ang N22.CG and D51.CG other bump:2.1063 Ang N22.OD1 and D51.CG other bump:3.11224 Ang N22.CB and D51.CB other bump:3.23977 Ang N22.CB and D51.CA other bump:3.03327 Ang I20.CG1 and V49.CG1 other bump:3.04491 Ang I20.CD1 and V49.CG1 other bump:1.36164 Ang V17.O and M47.CE other bump:2.3306 Ang V17.C and M47.CE other bump:2.41025 Ang V17.O and M47.SD other bump:3.08109 Ang D18.CA and M47.SD other bump:2.74048 Ang D18.O and M47.SD other bump:2.69265 Ang D18.C and M47.SD other bump:2.13005 Ang D15.OD1 and K42.O other bump:2.55501 Ang L14.CB and K39.NZ other bump:2.85577 Ang L14.CB and K39.CE other bump:2.63275 Ang D33.OD1 and E35.C other bump:3.03091 Ang L14.CD1 and E35.OE2 other bump:2.89138 Ang I20.CD1 and E35.OE1 self-bump: 1.34334 Ang M28.CA and M28.CB other bump:2.72802 Ang A23.C and P25.CD other bump:2.55923 Ang V17.CG1 and I20.CG2 other bump:2.87573 Ang V17.CG1 and I19.C other bump:2.67136 Ang V17.CG1 and I19.O other bump:2.76978 Ang V5.CG1 and L10.CD1 T0191 127 :NPLETVLLKEAKKVNAKTINGLGML 1pjbA 313 :NNSTLPYVVKLANQGLKALETDDAL Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 27 residues other bump:2.63332 Ang L23.CD2 and L26.CG other bump:2.85064 Ang L23.CD2 and L26.CB other bump:2.48405 Ang V15.CB and T19.OG1 other bump:2.54944 Ang V15.CG1 and T19.OG1 other bump:3.30289 Ang V15.CG1 and T19.CA other bump:2.75684 Ang V15.CG1 and T19.N other bump:2.7826 Ang L9.CD2 and K13.NZ T0191 152 :IYQGAVAF 1pjbA 353 :VQQVFPDL Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 10 residues other bump:2.61155 Ang A6.CB and F9.CD2 Number of specific fragments= 6 total=965 Number of alignments=182 # Reading fragments from alignment file # T0191 read from T0191-1pjbA-2track-protein-EBGHSTL-global-adpstyle5.pw.a2m.gz # 1pjbA read from T0191-1pjbA-2track-protein-EBGHSTL-global-adpstyle5.pw.a2m.gz # found chain 1pjbA in template set T0191 1 :I 1pjbA 1 :M Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 2 residues T0191 3 :YNTDGIGARMALEEEIGR 1pjbA 15 :RVGLSPSSVRTLVEAGHT Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 20 residues neighbor-bump: 3.03583 Ang E16.C and I17.CG1 other bump:1.66542 Ang I7.CD1 and R10.NH2 other bump:2.5917 Ang I7.CD1 and R10.CZ other bump:2.84015 Ang I7.CD1 and R10.NE T0191 21 :VKDKNIVIYGAGGAARAVAFELAK 1pjbA 165 :VKPGKVVILGGGVVGTEAAKMAVG Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 26 residues other bump:2.87104 Ang I7.CD1 and L23.CD2 other bump:2.48007 Ang I7.CG1 and L23.CD1 other bump:1.07324 Ang I7.CD1 and L23.CD1 other bump:2.03151 Ang I7.CD1 and L23.CG other bump:2.39615 Ang I7.CD1 and L23.CB other bump:1.92836 Ang G11.O and A16.CB other bump:2.95158 Ang G11.C and A16.CB T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLN 1pjbA 190 :GAQVQIFDINVERLSYLETLFGSRVE Fragment has 19 clashes (null) has 19 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:2.94969 Ang I22.CD1 and L26.CD2 other bump:2.86667 Ang I5.CD1 and L26.CD2 other bump:2.7084 Ang I5.CG1 and L26.CD1 other bump:2.69185 Ang I5.CD1 and L26.CD1 other bump:2.68568 Ang I5.CG1 and L26.CG other bump:2.55449 Ang I5.CD1 and L26.CG self-bump: 2.20268 Ang A23.CB and A23.C self-bump: 1.22982 Ang A23.CA and A23.CB other bump:1.69946 Ang V12.CG1 and E16.OE2 other bump:1.09857 Ang V12.O and E16.OE1 other bump:1.78251 Ang V12.C and E16.OE1 other bump:2.24801 Ang E13.N and E16.OE1 other bump:2.29401 Ang E13.CA and E16.OE1 other bump:2.77824 Ang E13.C and E16.OE1 other bump:1.88968 Ang V12.O and E16.CD other bump:2.64365 Ang V12.C and E16.CD other bump:2.76124 Ang V12.CG1 and E16.CD other bump:2.98556 Ang N3.CG and I5.CG2 other bump:1.94842 Ang N3.ND2 and I5.CG2 T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLREDMVVMDLIY 1pjbA 216 :LLYSNSAEIETAVAEADLLIGAVLVPGRRAPILVPASLVEQMRTGSVIVDVAV Fragment has 41 clashes (null) has 41 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 55 residues other bump:2.62164 Ang T24.N and I53.CD1 other bump:2.72237 Ang T24.CA and I53.CD1 other bump:1.83179 Ang T24.C and I53.CD1 other bump:2.54505 Ang P25.N and I53.CD1 other bump:2.42416 Ang P25.CG and I53.CD1 other bump:2.88348 Ang P25.CD and I53.CD1 other bump:2.9826 Ang P25.CA and I53.CD1 other bump:3.02195 Ang P25.CB and I53.CD1 other bump:3.01 Ang T24.OG1 and I53.CD1 other bump:1.39498 Ang T24.O and I53.CD1 other bump:2.27341 Ang P25.CG and I53.CG1 other bump:2.56688 Ang P25.CB and I53.CG1 other bump:2.30318 Ang N22.CG and D51.OD2 other bump:1.41777 Ang N22.OD1 and D51.OD2 other bump:2.6915 Ang N22.CB and D51.OD1 other bump:2.41436 Ang N22.CG and D51.OD1 other bump:2.49701 Ang N22.CB and D51.CG other bump:2.42431 Ang N22.CG and D51.CG other bump:2.1063 Ang N22.OD1 and D51.CG other bump:3.11224 Ang N22.CB and D51.CB other bump:3.23977 Ang N22.CB and D51.CA other bump:3.03327 Ang I20.CG1 and V49.CG1 other bump:3.04491 Ang I20.CD1 and V49.CG1 other bump:1.36164 Ang V17.O and M47.CE other bump:2.3306 Ang V17.C and M47.CE other bump:2.41025 Ang V17.O and M47.SD other bump:3.08109 Ang D18.CA and M47.SD other bump:2.74048 Ang D18.O and M47.SD other bump:2.69265 Ang D18.C and M47.SD other bump:2.13005 Ang D15.OD1 and K42.O other bump:2.55501 Ang L14.CB and K39.NZ other bump:2.85577 Ang L14.CB and K39.CE other bump:2.63275 Ang D33.OD1 and E35.C other bump:3.03091 Ang L14.CD1 and E35.OE2 other bump:2.89138 Ang I20.CD1 and E35.OE1 self-bump: 1.34334 Ang M28.CA and M28.CB other bump:2.72802 Ang A23.C and P25.CD other bump:2.55923 Ang V17.CG1 and I20.CG2 other bump:2.87573 Ang V17.CG1 and I19.C other bump:2.67136 Ang V17.CG1 and I19.O other bump:2.76978 Ang V5.CG1 and L10.CD1 T0191 127 :NPLETVLLKEAK 1pjbA 300 :MPGAVPWTATQA Fragment has 22 clashes (null) has 22 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:1.39222 Ang P3.O and K10.NZ other bump:1.98397 Ang P3.CA and K10.NZ other bump:1.00776 Ang P3.C and K10.NZ other bump:1.71932 Ang L4.N and K10.NZ other bump:2.27991 Ang E5.N and K10.NZ other bump:2.54131 Ang L4.CA and K10.NZ other bump:2.6814 Ang L4.C and K10.NZ other bump:2.91086 Ang T6.OG1 and K10.CE other bump:1.24655 Ang P3.O and K10.CE other bump:1.77816 Ang P3.CA and K10.CE other bump:2.64849 Ang P3.CB and K10.CE other bump:1.53435 Ang P3.C and K10.CE other bump:2.82646 Ang L4.N and K10.CE other bump:1.18951 Ang P3.O and K10.CD other bump:2.71893 Ang P3.CA and K10.CD other bump:2.88312 Ang P3.CB and K10.CD other bump:2.04429 Ang P3.C and K10.CD other bump:2.36953 Ang N2.O and E5.OE2 other bump:0.798592 Ang N2.O and E5.OE1 other bump:1.96335 Ang N2.C and E5.OE1 other bump:1.739 Ang N2.O and E5.CD other bump:2.80186 Ang N2.C and E5.CD T0191 139 :KVNAKTINGLGML 1pjbA 325 :NQGLKALETDDAL Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues other bump:2.63332 Ang L11.CD2 and L14.CG other bump:2.85064 Ang L11.CD2 and L14.CB other bump:2.48405 Ang V3.CB and T7.OG1 other bump:2.54944 Ang V3.CG1 and T7.OG1 other bump:3.30289 Ang V3.CG1 and T7.CA other bump:2.75684 Ang V3.CG1 and T7.N T0191 152 :IYQGAVAF 1pjbA 353 :VQQVFPDL Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 10 residues other bump:2.61155 Ang A6.CB and F9.CD2 Number of specific fragments= 8 total=973 Number of alignments=183 # Reading fragments from alignment file # T0191 read from T0191-1pjbA-2track-protein-EBGHSTL-local-adpstyle1.pw.a2m.gz # 1pjbA read from T0191-1pjbA-2track-protein-EBGHSTL-local-adpstyle1.pw.a2m.gz # found chain 1pjbA in template set T0191 25 :NIVIYGAGGAARAVAFELAK 1pjbA 169 :KVVILGGGVVGTEAAKMAVG Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 22 residues other bump:2.87103 Ang I3.CD1 and L19.CD2 other bump:2.48007 Ang I3.CG1 and L19.CD1 other bump:1.07324 Ang I3.CD1 and L19.CD1 other bump:2.03151 Ang I3.CD1 and L19.CG other bump:2.39616 Ang I3.CD1 and L19.CB other bump:1.92836 Ang G7.O and A12.CB other bump:2.95158 Ang G7.C and A12.CB T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLN 1pjbA 190 :GAQVQIFDINVERLSYLETLFGSRVE Fragment has 19 clashes (null) has 19 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:2.94969 Ang I22.CD1 and L26.CD2 other bump:2.86667 Ang I5.CD1 and L26.CD2 other bump:2.7084 Ang I5.CG1 and L26.CD1 other bump:2.69185 Ang I5.CD1 and L26.CD1 other bump:2.68568 Ang I5.CG1 and L26.CG other bump:2.55449 Ang I5.CD1 and L26.CG self-bump: 2.20268 Ang A23.CB and A23.C self-bump: 1.22982 Ang A23.CA and A23.CB other bump:1.69946 Ang V12.CG1 and E16.OE2 other bump:1.09857 Ang V12.O and E16.OE1 other bump:1.78251 Ang V12.C and E16.OE1 other bump:2.24801 Ang E13.N and E16.OE1 other bump:2.29401 Ang E13.CA and E16.OE1 other bump:2.77824 Ang E13.C and E16.OE1 other bump:1.88968 Ang V12.O and E16.CD other bump:2.64365 Ang V12.C and E16.CD other bump:2.76124 Ang V12.CG1 and E16.CD other bump:2.98556 Ang N3.CG and I5.CG2 other bump:1.94842 Ang N3.ND2 and I5.CG2 T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLREDMVVMDLIY 1pjbA 216 :LLYSNSAEIETAVAEADLLIGAVLVPGRRAPILVPASLVEQMRTGSVIVDVAV Fragment has 41 clashes (null) has 41 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 55 residues other bump:2.62164 Ang T24.N and I53.CD1 other bump:2.72237 Ang T24.CA and I53.CD1 other bump:1.83179 Ang T24.C and I53.CD1 other bump:2.54505 Ang P25.N and I53.CD1 other bump:2.42416 Ang P25.CG and I53.CD1 other bump:2.88348 Ang P25.CD and I53.CD1 other bump:2.9826 Ang P25.CA and I53.CD1 other bump:3.02195 Ang P25.CB and I53.CD1 other bump:3.01 Ang T24.OG1 and I53.CD1 other bump:1.39498 Ang T24.O and I53.CD1 other bump:2.27341 Ang P25.CG and I53.CG1 other bump:2.56688 Ang P25.CB and I53.CG1 other bump:2.30318 Ang N22.CG and D51.OD2 other bump:1.41777 Ang N22.OD1 and D51.OD2 other bump:2.6915 Ang N22.CB and D51.OD1 other bump:2.41436 Ang N22.CG and D51.OD1 other bump:2.49701 Ang N22.CB and D51.CG other bump:2.42431 Ang N22.CG and D51.CG other bump:2.1063 Ang N22.OD1 and D51.CG other bump:3.11224 Ang N22.CB and D51.CB other bump:3.23977 Ang N22.CB and D51.CA other bump:3.03327 Ang I20.CG1 and V49.CG1 other bump:3.04491 Ang I20.CD1 and V49.CG1 other bump:1.36164 Ang V17.O and M47.CE other bump:2.3306 Ang V17.C and M47.CE other bump:2.41025 Ang V17.O and M47.SD other bump:3.08109 Ang D18.CA and M47.SD other bump:2.74048 Ang D18.O and M47.SD other bump:2.69265 Ang D18.C and M47.SD other bump:2.13005 Ang D15.OD1 and K42.O other bump:2.55501 Ang L14.CB and K39.NZ other bump:2.85577 Ang L14.CB and K39.CE other bump:2.63275 Ang D33.OD1 and E35.C other bump:3.03091 Ang L14.CD1 and E35.OE2 other bump:2.89138 Ang I20.CD1 and E35.OE1 self-bump: 1.34334 Ang M28.CA and M28.CB other bump:2.72802 Ang A23.C and P25.CD other bump:2.55923 Ang V17.CG1 and I20.CG2 other bump:2.87573 Ang V17.CG1 and I19.C other bump:2.67136 Ang V17.CG1 and I19.O other bump:2.76978 Ang V5.CG1 and L10.CD1 Number of specific fragments= 3 total=976 Number of alignments=184 # Reading fragments from alignment file # T0191 read from T0191-1pjbA-2track-protein-EBGHSTL-local-adpstyle5.pw.a2m.gz # 1pjbA read from T0191-1pjbA-2track-protein-EBGHSTL-local-adpstyle5.pw.a2m.gz # found chain 1pjbA in template set T0191 18 :IGRVKDKNIVIYGAGGAARAVAFELAK 1pjbA 162 :VPGVKPGKVVILGGGVVGTEAAKMAVG Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 29 residues other bump:2.87104 Ang I10.CD1 and L26.CD2 other bump:2.48007 Ang I10.CG1 and L26.CD1 other bump:1.07324 Ang I10.CD1 and L26.CD1 other bump:2.03151 Ang I10.CD1 and L26.CG other bump:2.39615 Ang I10.CD1 and L26.CB other bump:1.92836 Ang G14.O and A19.CB other bump:2.95158 Ang G14.C and A19.CB T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLN 1pjbA 190 :GAQVQIFDINVERLSYLETLFGSRVE Fragment has 19 clashes (null) has 19 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:2.94969 Ang I22.CD1 and L26.CD2 other bump:2.86667 Ang I5.CD1 and L26.CD2 other bump:2.7084 Ang I5.CG1 and L26.CD1 other bump:2.69185 Ang I5.CD1 and L26.CD1 other bump:2.68568 Ang I5.CG1 and L26.CG other bump:2.55449 Ang I5.CD1 and L26.CG self-bump: 2.20268 Ang A23.CB and A23.C self-bump: 1.22982 Ang A23.CA and A23.CB other bump:1.69946 Ang V12.CG1 and E16.OE2 other bump:1.09857 Ang V12.O and E16.OE1 other bump:1.78251 Ang V12.C and E16.OE1 other bump:2.24801 Ang E13.N and E16.OE1 other bump:2.29401 Ang E13.CA and E16.OE1 other bump:2.77824 Ang E13.C and E16.OE1 other bump:1.88968 Ang V12.O and E16.CD other bump:2.64365 Ang V12.C and E16.CD other bump:2.76124 Ang V12.CG1 and E16.CD other bump:2.98556 Ang N3.CG and I5.CG2 other bump:1.94842 Ang N3.ND2 and I5.CG2 T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLREDMVVMDLIY 1pjbA 216 :LLYSNSAEIETAVAEADLLIGAVLVPGRRAPILVPASLVEQMRTGSVIVDVAV Fragment has 41 clashes (null) has 41 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 55 residues other bump:2.62164 Ang T24.N and I53.CD1 other bump:2.72237 Ang T24.CA and I53.CD1 other bump:1.83179 Ang T24.C and I53.CD1 other bump:2.54505 Ang P25.N and I53.CD1 other bump:2.42416 Ang P25.CG and I53.CD1 other bump:2.88348 Ang P25.CD and I53.CD1 other bump:2.9826 Ang P25.CA and I53.CD1 other bump:3.02195 Ang P25.CB and I53.CD1 other bump:3.01 Ang T24.OG1 and I53.CD1 other bump:1.39498 Ang T24.O and I53.CD1 other bump:2.27341 Ang P25.CG and I53.CG1 other bump:2.56688 Ang P25.CB and I53.CG1 other bump:2.30318 Ang N22.CG and D51.OD2 other bump:1.41777 Ang N22.OD1 and D51.OD2 other bump:2.6915 Ang N22.CB and D51.OD1 other bump:2.41436 Ang N22.CG and D51.OD1 other bump:2.49701 Ang N22.CB and D51.CG other bump:2.42431 Ang N22.CG and D51.CG other bump:2.1063 Ang N22.OD1 and D51.CG other bump:3.11224 Ang N22.CB and D51.CB other bump:3.23977 Ang N22.CB and D51.CA other bump:3.03327 Ang I20.CG1 and V49.CG1 other bump:3.04491 Ang I20.CD1 and V49.CG1 other bump:1.36164 Ang V17.O and M47.CE other bump:2.3306 Ang V17.C and M47.CE other bump:2.41025 Ang V17.O and M47.SD other bump:3.08109 Ang D18.CA and M47.SD other bump:2.74048 Ang D18.O and M47.SD other bump:2.69265 Ang D18.C and M47.SD other bump:2.13005 Ang D15.OD1 and K42.O other bump:2.55501 Ang L14.CB and K39.NZ other bump:2.85577 Ang L14.CB and K39.CE other bump:2.63275 Ang D33.OD1 and E35.C other bump:3.03091 Ang L14.CD1 and E35.OE2 other bump:2.89138 Ang I20.CD1 and E35.OE1 self-bump: 1.34334 Ang M28.CA and M28.CB other bump:2.72802 Ang A23.C and P25.CD other bump:2.55923 Ang V17.CG1 and I20.CG2 other bump:2.87573 Ang V17.CG1 and I19.C other bump:2.67136 Ang V17.CG1 and I19.O other bump:2.76978 Ang V5.CG1 and L10.CD1 Number of specific fragments= 3 total=979 Number of alignments=185 # Reading fragments from alignment file # T0191 read from T0191-1pjbA-2track-protein-EBGHTL-global-adpstyle1.pw.a2m.gz # 1pjbA read from T0191-1pjbA-2track-protein-EBGHTL-global-adpstyle1.pw.a2m.gz # found chain 1pjbA in template set T0191 3 :YNTDGIGARMALEEEIGR 1pjbA 15 :RVGLSPSSVRTLVEAGHT Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 20 residues neighbor-bump: 3.03583 Ang E16.C and I17.CG1 other bump:1.66542 Ang I7.CD1 and R10.NH2 other bump:2.5917 Ang I7.CD1 and R10.CZ other bump:2.84015 Ang I7.CD1 and R10.NE T0191 21 :VKDKNIVIYGAGGAARAVAFELAK 1pjbA 165 :VKPGKVVILGGGVVGTEAAKMAVG Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 26 residues other bump:2.87104 Ang I7.CD1 and L23.CD2 other bump:2.48007 Ang I7.CG1 and L23.CD1 other bump:1.07324 Ang I7.CD1 and L23.CD1 other bump:2.03151 Ang I7.CD1 and L23.CG other bump:2.39615 Ang I7.CD1 and L23.CB other bump:1.92836 Ang G11.O and A16.CB other bump:2.95158 Ang G11.C and A16.CB T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLN 1pjbA 190 :GAQVQIFDINVERLSYLETLFGSRVE Fragment has 19 clashes (null) has 19 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:2.94969 Ang I22.CD1 and L26.CD2 other bump:2.86667 Ang I5.CD1 and L26.CD2 other bump:2.7084 Ang I5.CG1 and L26.CD1 other bump:2.69185 Ang I5.CD1 and L26.CD1 other bump:2.68568 Ang I5.CG1 and L26.CG other bump:2.55449 Ang I5.CD1 and L26.CG self-bump: 2.20268 Ang A23.CB and A23.C self-bump: 1.22982 Ang A23.CA and A23.CB other bump:1.69946 Ang V12.CG1 and E16.OE2 other bump:1.09857 Ang V12.O and E16.OE1 other bump:1.78251 Ang V12.C and E16.OE1 other bump:2.24801 Ang E13.N and E16.OE1 other bump:2.29401 Ang E13.CA and E16.OE1 other bump:2.77824 Ang E13.C and E16.OE1 other bump:1.88968 Ang V12.O and E16.CD other bump:2.64365 Ang V12.C and E16.CD other bump:2.76124 Ang V12.CG1 and E16.CD other bump:2.98556 Ang N3.CG and I5.CG2 other bump:1.94842 Ang N3.ND2 and I5.CG2 T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLREDMVVMDLIYNP 1pjbA 216 :LLYSNSAEIETAVAEADLLIGAVLVPGRRAPILVPASLVEQMRTGSVIVDVAVDQ Fragment has 41 clashes (null) has 41 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 57 residues other bump:2.62164 Ang T24.N and I53.CD1 other bump:2.72237 Ang T24.CA and I53.CD1 other bump:1.83179 Ang T24.C and I53.CD1 other bump:2.54505 Ang P25.N and I53.CD1 other bump:2.42416 Ang P25.CG and I53.CD1 other bump:2.88348 Ang P25.CD and I53.CD1 other bump:2.9826 Ang P25.CA and I53.CD1 other bump:3.02195 Ang P25.CB and I53.CD1 other bump:3.01 Ang T24.OG1 and I53.CD1 other bump:1.39498 Ang T24.O and I53.CD1 other bump:2.27341 Ang P25.CG and I53.CG1 other bump:2.56688 Ang P25.CB and I53.CG1 other bump:2.30318 Ang N22.CG and D51.OD2 other bump:1.41777 Ang N22.OD1 and D51.OD2 other bump:2.6915 Ang N22.CB and D51.OD1 other bump:2.41436 Ang N22.CG and D51.OD1 other bump:2.49701 Ang N22.CB and D51.CG other bump:2.42431 Ang N22.CG and D51.CG other bump:2.1063 Ang N22.OD1 and D51.CG other bump:3.11224 Ang N22.CB and D51.CB other bump:3.23977 Ang N22.CB and D51.CA other bump:3.03327 Ang I20.CG1 and V49.CG1 other bump:3.04491 Ang I20.CD1 and V49.CG1 other bump:1.36164 Ang V17.O and M47.CE other bump:2.3306 Ang V17.C and M47.CE other bump:2.41025 Ang V17.O and M47.SD other bump:3.08109 Ang D18.CA and M47.SD other bump:2.74048 Ang D18.O and M47.SD other bump:2.69265 Ang D18.C and M47.SD other bump:2.13005 Ang D15.OD1 and K42.O other bump:2.55501 Ang L14.CB and K39.NZ other bump:2.85577 Ang L14.CB and K39.CE other bump:2.63275 Ang D33.OD1 and E35.C other bump:3.03091 Ang L14.CD1 and E35.OE2 other bump:2.89138 Ang I20.CD1 and E35.OE1 self-bump: 1.34334 Ang M28.CA and M28.CB other bump:2.72802 Ang A23.C and P25.CD other bump:2.55923 Ang V17.CG1 and I20.CG2 other bump:2.87573 Ang V17.CG1 and I19.C other bump:2.67136 Ang V17.CG1 and I19.O other bump:2.76978 Ang V5.CG1 and L10.CD1 T0191 129 :LETVLLKEAKKVNAKTINGLGMLIYQGAVAF 1pjbA 330 :ALETDDALAKGLNVQAHRLVHPAVQQVFPDL Fragment has 23 clashes (null) has 23 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 33 residues other bump:2.61155 Ang A29.CB and F32.CD2 other bump:2.75813 Ang L21.CA and Y26.OH other bump:0.66176 Ang G20.O and Y26.OH other bump:1.68792 Ang G20.C and Y26.OH other bump:2.49388 Ang L21.N and Y26.OH other bump:3.22575 Ang L21.CA and Y26.CZ other bump:1.13919 Ang G20.O and Y26.CZ other bump:2.16483 Ang G20.C and Y26.CZ other bump:2.35109 Ang G20.O and Y26.CE2 other bump:2.99717 Ang G20.CA and Y26.CE1 other bump:1.91463 Ang G20.O and Y26.CE1 other bump:2.54377 Ang G20.C and Y26.CE1 other bump:2.74009 Ang N14.ND2 and I25.CD1 neighbor-bump: 2.31499 Ang T17.O and I18.CB neighbor-bump: 2.5356 Ang T17.C and I18.CB other bump:3.19283 Ang V13.CG1 and K16.CD other bump:2.24308 Ang E3.CD and V13.CG2 other bump:1.4834 Ang E3.OE1 and V13.CG2 other bump:2.59737 Ang E3.OE2 and V13.CG2 other bump:2.72745 Ang E3.OE1 and V13.CB other bump:2.32358 Ang L6.CD2 and E9.CD other bump:2.05383 Ang L6.CD2 and E9.CG other bump:2.89026 Ang L6.CD2 and E9.CB Number of specific fragments= 5 total=984 Number of alignments=186 # Reading fragments from alignment file # T0191 read from T0191-1pjbA-2track-protein-EBGHTL-global-adpstyle5.pw.a2m.gz # 1pjbA read from T0191-1pjbA-2track-protein-EBGHTL-global-adpstyle5.pw.a2m.gz # found chain 1pjbA in template set T0191 1 :I 1pjbA 1 :M Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 2 residues T0191 3 :YNTDGIGARMALEEEIGR 1pjbA 15 :RVGLSPSSVRTLVEAGHT Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 20 residues neighbor-bump: 3.03583 Ang E16.C and I17.CG1 other bump:1.66542 Ang I7.CD1 and R10.NH2 other bump:2.5917 Ang I7.CD1 and R10.CZ other bump:2.84015 Ang I7.CD1 and R10.NE T0191 21 :VKDKNIVIYGAGGAARAVAFELAK 1pjbA 165 :VKPGKVVILGGGVVGTEAAKMAVG Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 26 residues other bump:2.87104 Ang I7.CD1 and L23.CD2 other bump:2.48007 Ang I7.CG1 and L23.CD1 other bump:1.07324 Ang I7.CD1 and L23.CD1 other bump:2.03151 Ang I7.CD1 and L23.CG other bump:2.39615 Ang I7.CD1 and L23.CB other bump:1.92836 Ang G11.O and A16.CB other bump:2.95158 Ang G11.C and A16.CB T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLN 1pjbA 190 :GAQVQIFDINVERLSYLETLFGSRVE Fragment has 19 clashes (null) has 19 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:2.94969 Ang I22.CD1 and L26.CD2 other bump:2.86667 Ang I5.CD1 and L26.CD2 other bump:2.7084 Ang I5.CG1 and L26.CD1 other bump:2.69185 Ang I5.CD1 and L26.CD1 other bump:2.68568 Ang I5.CG1 and L26.CG other bump:2.55449 Ang I5.CD1 and L26.CG self-bump: 2.20268 Ang A23.CB and A23.C self-bump: 1.22982 Ang A23.CA and A23.CB other bump:1.69946 Ang V12.CG1 and E16.OE2 other bump:1.09857 Ang V12.O and E16.OE1 other bump:1.78251 Ang V12.C and E16.OE1 other bump:2.24801 Ang E13.N and E16.OE1 other bump:2.29401 Ang E13.CA and E16.OE1 other bump:2.77824 Ang E13.C and E16.OE1 other bump:1.88968 Ang V12.O and E16.CD other bump:2.64365 Ang V12.C and E16.CD other bump:2.76124 Ang V12.CG1 and E16.CD other bump:2.98556 Ang N3.CG and I5.CG2 other bump:1.94842 Ang N3.ND2 and I5.CG2 T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLREDMVVMDLIY 1pjbA 216 :LLYSNSAEIETAVAEADLLIGAVLVPGRRAPILVPASLVEQMRTGSVIVDVAV Fragment has 41 clashes (null) has 41 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 55 residues other bump:2.62164 Ang T24.N and I53.CD1 other bump:2.72237 Ang T24.CA and I53.CD1 other bump:1.83179 Ang T24.C and I53.CD1 other bump:2.54505 Ang P25.N and I53.CD1 other bump:2.42416 Ang P25.CG and I53.CD1 other bump:2.88348 Ang P25.CD and I53.CD1 other bump:2.9826 Ang P25.CA and I53.CD1 other bump:3.02195 Ang P25.CB and I53.CD1 other bump:3.01 Ang T24.OG1 and I53.CD1 other bump:1.39498 Ang T24.O and I53.CD1 other bump:2.27341 Ang P25.CG and I53.CG1 other bump:2.56688 Ang P25.CB and I53.CG1 other bump:2.30318 Ang N22.CG and D51.OD2 other bump:1.41777 Ang N22.OD1 and D51.OD2 other bump:2.6915 Ang N22.CB and D51.OD1 other bump:2.41436 Ang N22.CG and D51.OD1 other bump:2.49701 Ang N22.CB and D51.CG other bump:2.42431 Ang N22.CG and D51.CG other bump:2.1063 Ang N22.OD1 and D51.CG other bump:3.11224 Ang N22.CB and D51.CB other bump:3.23977 Ang N22.CB and D51.CA other bump:3.03327 Ang I20.CG1 and V49.CG1 other bump:3.04491 Ang I20.CD1 and V49.CG1 other bump:1.36164 Ang V17.O and M47.CE other bump:2.3306 Ang V17.C and M47.CE other bump:2.41025 Ang V17.O and M47.SD other bump:3.08109 Ang D18.CA and M47.SD other bump:2.74048 Ang D18.O and M47.SD other bump:2.69265 Ang D18.C and M47.SD other bump:2.13005 Ang D15.OD1 and K42.O other bump:2.55501 Ang L14.CB and K39.NZ other bump:2.85577 Ang L14.CB and K39.CE other bump:2.63275 Ang D33.OD1 and E35.C other bump:3.03091 Ang L14.CD1 and E35.OE2 other bump:2.89138 Ang I20.CD1 and E35.OE1 self-bump: 1.34334 Ang M28.CA and M28.CB other bump:2.72802 Ang A23.C and P25.CD other bump:2.55923 Ang V17.CG1 and I20.CG2 other bump:2.87573 Ang V17.CG1 and I19.C other bump:2.67136 Ang V17.CG1 and I19.O other bump:2.76978 Ang V5.CG1 and L10.CD1 T0191 128 :PLETVLLK 1pjbA 301 :PGAVPWTA Fragment has 19 clashes (null) has 19 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 10 residues other bump:1.89612 Ang P2.O and K9.NZ other bump:1.75829 Ang P2.CA and K9.NZ other bump:2.74996 Ang P2.CB and K9.NZ other bump:1.96896 Ang P2.C and K9.NZ other bump:1.59662 Ang P2.O and K9.CE other bump:2.77457 Ang P2.N and K9.CE other bump:1.30935 Ang P2.CA and K9.CE other bump:1.64139 Ang P2.CB and K9.CE other bump:1.41928 Ang P2.C and K9.CE other bump:2.66145 Ang L3.N and K9.CE other bump:1.53757 Ang P2.O and K9.CD other bump:2.79145 Ang P2.CA and K9.CD other bump:2.71025 Ang P2.CB and K9.CD other bump:2.2027 Ang P2.C and K9.CD other bump:2.36953 Ang G1.O and E4.OE2 other bump:1.96335 Ang G1.C and E4.OE1 other bump:0.798592 Ang G1.O and E4.OE1 other bump:2.80186 Ang G1.C and E4.CD other bump:1.739 Ang G1.O and E4.CD T0191 137 :AKKVNAKTINGLGMLIYQGAVAFK 1pjbA 309 :TQALNNSTLPYVVKLANQGLKALE Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 25 residues other bump:2.08492 Ang G14.O and Y18.CD1 other bump:2.51879 Ang N6.O and I10.CD1 other bump:2.18227 Ang N6.O and I10.CG1 Number of specific fragments= 7 total=991 Number of alignments=187 # Reading fragments from alignment file # T0191 read from T0191-1pjbA-2track-protein-EBGHTL-local-adpstyle1.pw.a2m.gz # 1pjbA read from T0191-1pjbA-2track-protein-EBGHTL-local-adpstyle1.pw.a2m.gz # found chain 1pjbA in template set T0191 25 :NIVIYGAGGAARAVAFELAK 1pjbA 169 :KVVILGGGVVGTEAAKMAVG Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 22 residues other bump:2.87103 Ang I3.CD1 and L19.CD2 other bump:2.48007 Ang I3.CG1 and L19.CD1 other bump:1.07324 Ang I3.CD1 and L19.CD1 other bump:2.03151 Ang I3.CD1 and L19.CG other bump:2.39616 Ang I3.CD1 and L19.CB other bump:1.92836 Ang G7.O and A12.CB other bump:2.95158 Ang G7.C and A12.CB T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLN 1pjbA 190 :GAQVQIFDINVERLSYLETLFGSRVE Fragment has 19 clashes (null) has 19 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:2.94969 Ang I22.CD1 and L26.CD2 other bump:2.86667 Ang I5.CD1 and L26.CD2 other bump:2.7084 Ang I5.CG1 and L26.CD1 other bump:2.69185 Ang I5.CD1 and L26.CD1 other bump:2.68568 Ang I5.CG1 and L26.CG other bump:2.55449 Ang I5.CD1 and L26.CG self-bump: 2.20268 Ang A23.CB and A23.C self-bump: 1.22982 Ang A23.CA and A23.CB other bump:1.69946 Ang V12.CG1 and E16.OE2 other bump:1.09857 Ang V12.O and E16.OE1 other bump:1.78251 Ang V12.C and E16.OE1 other bump:2.24801 Ang E13.N and E16.OE1 other bump:2.29401 Ang E13.CA and E16.OE1 other bump:2.77824 Ang E13.C and E16.OE1 other bump:1.88968 Ang V12.O and E16.CD other bump:2.64365 Ang V12.C and E16.CD other bump:2.76124 Ang V12.CG1 and E16.CD other bump:2.98556 Ang N3.CG and I5.CG2 other bump:1.94842 Ang N3.ND2 and I5.CG2 T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLREDMVVMDLIYNP 1pjbA 216 :LLYSNSAEIETAVAEADLLIGAVLVPGRRAPILVPASLVEQMRTGSVIVDVAVDQ Fragment has 41 clashes (null) has 41 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 57 residues other bump:2.62164 Ang T24.N and I53.CD1 other bump:2.72237 Ang T24.CA and I53.CD1 other bump:1.83179 Ang T24.C and I53.CD1 other bump:2.54505 Ang P25.N and I53.CD1 other bump:2.42416 Ang P25.CG and I53.CD1 other bump:2.88348 Ang P25.CD and I53.CD1 other bump:2.9826 Ang P25.CA and I53.CD1 other bump:3.02195 Ang P25.CB and I53.CD1 other bump:3.01 Ang T24.OG1 and I53.CD1 other bump:1.39498 Ang T24.O and I53.CD1 other bump:2.27341 Ang P25.CG and I53.CG1 other bump:2.56688 Ang P25.CB and I53.CG1 other bump:2.30318 Ang N22.CG and D51.OD2 other bump:1.41777 Ang N22.OD1 and D51.OD2 other bump:2.6915 Ang N22.CB and D51.OD1 other bump:2.41436 Ang N22.CG and D51.OD1 other bump:2.49701 Ang N22.CB and D51.CG other bump:2.42431 Ang N22.CG and D51.CG other bump:2.1063 Ang N22.OD1 and D51.CG other bump:3.11224 Ang N22.CB and D51.CB other bump:3.23977 Ang N22.CB and D51.CA other bump:3.03327 Ang I20.CG1 and V49.CG1 other bump:3.04491 Ang I20.CD1 and V49.CG1 other bump:1.36164 Ang V17.O and M47.CE other bump:2.3306 Ang V17.C and M47.CE other bump:2.41025 Ang V17.O and M47.SD other bump:3.08109 Ang D18.CA and M47.SD other bump:2.74048 Ang D18.O and M47.SD other bump:2.69265 Ang D18.C and M47.SD other bump:2.13005 Ang D15.OD1 and K42.O other bump:2.55501 Ang L14.CB and K39.NZ other bump:2.85577 Ang L14.CB and K39.CE other bump:2.63275 Ang D33.OD1 and E35.C other bump:3.03091 Ang L14.CD1 and E35.OE2 other bump:2.89138 Ang I20.CD1 and E35.OE1 self-bump: 1.34334 Ang M28.CA and M28.CB other bump:2.72802 Ang A23.C and P25.CD other bump:2.55923 Ang V17.CG1 and I20.CG2 other bump:2.87573 Ang V17.CG1 and I19.C other bump:2.67136 Ang V17.CG1 and I19.O other bump:2.76978 Ang V5.CG1 and L10.CD1 Number of specific fragments= 3 total=994 Number of alignments=188 # Reading fragments from alignment file # T0191 read from T0191-1pjbA-2track-protein-EBGHTL-local-adpstyle5.pw.a2m.gz # 1pjbA read from T0191-1pjbA-2track-protein-EBGHTL-local-adpstyle5.pw.a2m.gz # found chain 1pjbA in template set T0191 18 :IGRVKDKNIVIYGAGGAARAVAFELAK 1pjbA 162 :VPGVKPGKVVILGGGVVGTEAAKMAVG Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 29 residues other bump:2.87104 Ang I10.CD1 and L26.CD2 other bump:2.48007 Ang I10.CG1 and L26.CD1 other bump:1.07324 Ang I10.CD1 and L26.CD1 other bump:2.03151 Ang I10.CD1 and L26.CG other bump:2.39615 Ang I10.CD1 and L26.CB other bump:1.92836 Ang G14.O and A19.CB other bump:2.95158 Ang G14.C and A19.CB T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLN 1pjbA 190 :GAQVQIFDINVERLSYLETLFGSRVE Fragment has 19 clashes (null) has 19 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:2.94969 Ang I22.CD1 and L26.CD2 other bump:2.86667 Ang I5.CD1 and L26.CD2 other bump:2.7084 Ang I5.CG1 and L26.CD1 other bump:2.69185 Ang I5.CD1 and L26.CD1 other bump:2.68568 Ang I5.CG1 and L26.CG other bump:2.55449 Ang I5.CD1 and L26.CG self-bump: 2.20268 Ang A23.CB and A23.C self-bump: 1.22982 Ang A23.CA and A23.CB other bump:1.69946 Ang V12.CG1 and E16.OE2 other bump:1.09857 Ang V12.O and E16.OE1 other bump:1.78251 Ang V12.C and E16.OE1 other bump:2.24801 Ang E13.N and E16.OE1 other bump:2.29401 Ang E13.CA and E16.OE1 other bump:2.77824 Ang E13.C and E16.OE1 other bump:1.88968 Ang V12.O and E16.CD other bump:2.64365 Ang V12.C and E16.CD other bump:2.76124 Ang V12.CG1 and E16.CD other bump:2.98556 Ang N3.CG and I5.CG2 other bump:1.94842 Ang N3.ND2 and I5.CG2 T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLREDMVVMDLIYNP 1pjbA 216 :LLYSNSAEIETAVAEADLLIGAVLVPGRRAPILVPASLVEQMRTGSVIVDVAVDQ Fragment has 41 clashes (null) has 41 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 57 residues other bump:2.62164 Ang T24.N and I53.CD1 other bump:2.72237 Ang T24.CA and I53.CD1 other bump:1.83179 Ang T24.C and I53.CD1 other bump:2.54505 Ang P25.N and I53.CD1 other bump:2.42416 Ang P25.CG and I53.CD1 other bump:2.88348 Ang P25.CD and I53.CD1 other bump:2.9826 Ang P25.CA and I53.CD1 other bump:3.02195 Ang P25.CB and I53.CD1 other bump:3.01 Ang T24.OG1 and I53.CD1 other bump:1.39498 Ang T24.O and I53.CD1 other bump:2.27341 Ang P25.CG and I53.CG1 other bump:2.56688 Ang P25.CB and I53.CG1 other bump:2.30318 Ang N22.CG and D51.OD2 other bump:1.41777 Ang N22.OD1 and D51.OD2 other bump:2.6915 Ang N22.CB and D51.OD1 other bump:2.41436 Ang N22.CG and D51.OD1 other bump:2.49701 Ang N22.CB and D51.CG other bump:2.42431 Ang N22.CG and D51.CG other bump:2.1063 Ang N22.OD1 and D51.CG other bump:3.11224 Ang N22.CB and D51.CB other bump:3.23977 Ang N22.CB and D51.CA other bump:3.03327 Ang I20.CG1 and V49.CG1 other bump:3.04491 Ang I20.CD1 and V49.CG1 other bump:1.36164 Ang V17.O and M47.CE other bump:2.3306 Ang V17.C and M47.CE other bump:2.41025 Ang V17.O and M47.SD other bump:3.08109 Ang D18.CA and M47.SD other bump:2.74048 Ang D18.O and M47.SD other bump:2.69265 Ang D18.C and M47.SD other bump:2.13005 Ang D15.OD1 and K42.O other bump:2.55501 Ang L14.CB and K39.NZ other bump:2.85577 Ang L14.CB and K39.CE other bump:2.63275 Ang D33.OD1 and E35.C other bump:3.03091 Ang L14.CD1 and E35.OE2 other bump:2.89138 Ang I20.CD1 and E35.OE1 self-bump: 1.34334 Ang M28.CA and M28.CB other bump:2.72802 Ang A23.C and P25.CD other bump:2.55923 Ang V17.CG1 and I20.CG2 other bump:2.87573 Ang V17.CG1 and I19.C other bump:2.67136 Ang V17.CG1 and I19.O other bump:2.76978 Ang V5.CG1 and L10.CD1 Number of specific fragments= 3 total=997 Number of alignments=189 # Reading fragments from alignment file # T0191 read from T0191-1pjbA-2track-protein-STR-global-adpstyle1.pw.a2m.gz # 1pjbA read from T0191-1pjbA-2track-protein-STR-global-adpstyle1.pw.a2m.gz # found chain 1pjbA in template set T0191 3 :YNTDGIGARMALEEEIGR 1pjbA 15 :RVGLSPSSVRTLVEAGHT Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 20 residues neighbor-bump: 3.03583 Ang E16.C and I17.CG1 other bump:1.66542 Ang I7.CD1 and R10.NH2 other bump:2.5917 Ang I7.CD1 and R10.CZ other bump:2.84015 Ang I7.CD1 and R10.NE T0191 21 :VKDKNIVIYGAGGAARAVAFELAK 1pjbA 165 :VKPGKVVILGGGVVGTEAAKMAVG Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 26 residues other bump:2.87104 Ang I7.CD1 and L23.CD2 other bump:2.48007 Ang I7.CG1 and L23.CD1 other bump:1.07324 Ang I7.CD1 and L23.CD1 other bump:2.03151 Ang I7.CD1 and L23.CG other bump:2.39615 Ang I7.CD1 and L23.CB other bump:1.92836 Ang G11.O and A16.CB other bump:2.95158 Ang G11.C and A16.CB T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLN 1pjbA 190 :GAQVQIFDINVERLSYLETLFGSRVE Fragment has 19 clashes (null) has 19 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:2.94969 Ang I22.CD1 and L26.CD2 other bump:2.86667 Ang I5.CD1 and L26.CD2 other bump:2.7084 Ang I5.CG1 and L26.CD1 other bump:2.69185 Ang I5.CD1 and L26.CD1 other bump:2.68568 Ang I5.CG1 and L26.CG other bump:2.55449 Ang I5.CD1 and L26.CG self-bump: 2.20268 Ang A23.CB and A23.C self-bump: 1.22982 Ang A23.CA and A23.CB other bump:1.69946 Ang V12.CG1 and E16.OE2 other bump:1.09857 Ang V12.O and E16.OE1 other bump:1.78251 Ang V12.C and E16.OE1 other bump:2.24801 Ang E13.N and E16.OE1 other bump:2.29401 Ang E13.CA and E16.OE1 other bump:2.77824 Ang E13.C and E16.OE1 other bump:1.88968 Ang V12.O and E16.CD other bump:2.64365 Ang V12.C and E16.CD other bump:2.76124 Ang V12.CG1 and E16.CD other bump:2.98556 Ang N3.CG and I5.CG2 other bump:1.94842 Ang N3.ND2 and I5.CG2 T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLREDMVVMDLIY 1pjbA 216 :LLYSNSAEIETAVAEADLLIGAVLVPGRRAPILVPASLVEQMRTGSVIVDVAV Fragment has 41 clashes (null) has 41 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 55 residues other bump:2.62164 Ang T24.N and I53.CD1 other bump:2.72237 Ang T24.CA and I53.CD1 other bump:1.83179 Ang T24.C and I53.CD1 other bump:2.54505 Ang P25.N and I53.CD1 other bump:2.42416 Ang P25.CG and I53.CD1 other bump:2.88348 Ang P25.CD and I53.CD1 other bump:2.9826 Ang P25.CA and I53.CD1 other bump:3.02195 Ang P25.CB and I53.CD1 other bump:3.01 Ang T24.OG1 and I53.CD1 other bump:1.39498 Ang T24.O and I53.CD1 other bump:2.27341 Ang P25.CG and I53.CG1 other bump:2.56688 Ang P25.CB and I53.CG1 other bump:2.30318 Ang N22.CG and D51.OD2 other bump:1.41777 Ang N22.OD1 and D51.OD2 other bump:2.6915 Ang N22.CB and D51.OD1 other bump:2.41436 Ang N22.CG and D51.OD1 other bump:2.49701 Ang N22.CB and D51.CG other bump:2.42431 Ang N22.CG and D51.CG other bump:2.1063 Ang N22.OD1 and D51.CG other bump:3.11224 Ang N22.CB and D51.CB other bump:3.23977 Ang N22.CB and D51.CA other bump:3.03327 Ang I20.CG1 and V49.CG1 other bump:3.04491 Ang I20.CD1 and V49.CG1 other bump:1.36164 Ang V17.O and M47.CE other bump:2.3306 Ang V17.C and M47.CE other bump:2.41025 Ang V17.O and M47.SD other bump:3.08109 Ang D18.CA and M47.SD other bump:2.74048 Ang D18.O and M47.SD other bump:2.69265 Ang D18.C and M47.SD other bump:2.13005 Ang D15.OD1 and K42.O other bump:2.55501 Ang L14.CB and K39.NZ other bump:2.85577 Ang L14.CB and K39.CE other bump:2.63275 Ang D33.OD1 and E35.C other bump:3.03091 Ang L14.CD1 and E35.OE2 other bump:2.89138 Ang I20.CD1 and E35.OE1 self-bump: 1.34334 Ang M28.CA and M28.CB other bump:2.72802 Ang A23.C and P25.CD other bump:2.55923 Ang V17.CG1 and I20.CG2 other bump:2.87573 Ang V17.CG1 and I19.C other bump:2.67136 Ang V17.CG1 and I19.O other bump:2.76978 Ang V5.CG1 and L10.CD1 T0191 127 :NPLETVLLKEAKKVNAKTINGLGMLIYQGAVAFK 1pjbA 299 :NMPGAVPWTATQALNNSTLPYVVKLANQGLKALE Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 35 residues other bump:2.08492 Ang G24.O and Y28.CD1 other bump:2.51879 Ang N16.O and I20.CD1 other bump:2.18227 Ang N16.O and I20.CG1 other bump:2.02711 Ang L4.CD2 and E11.OE2 other bump:2.69655 Ang L4.CD2 and E11.CD other bump:3.06183 Ang L4.CB and E11.CD other bump:2.53725 Ang N2.OD1 and E5.CB Number of specific fragments= 5 total=1002 Number of alignments=190 # Reading fragments from alignment file # T0191 read from T0191-1pjbA-2track-protein-STR-global-adpstyle5.pw.a2m.gz # 1pjbA read from T0191-1pjbA-2track-protein-STR-global-adpstyle5.pw.a2m.gz # found chain 1pjbA in template set T0191 1 :I 1pjbA 1 :M Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 2 residues T0191 3 :YNTDGIGARMALEEEIGR 1pjbA 15 :RVGLSPSSVRTLVEAGHT Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 20 residues neighbor-bump: 3.03583 Ang E16.C and I17.CG1 other bump:1.66542 Ang I7.CD1 and R10.NH2 other bump:2.5917 Ang I7.CD1 and R10.CZ other bump:2.84015 Ang I7.CD1 and R10.NE T0191 21 :VKDKNIVIYGAGGAARAVAFELAK 1pjbA 165 :VKPGKVVILGGGVVGTEAAKMAVG Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 26 residues other bump:2.87104 Ang I7.CD1 and L23.CD2 other bump:2.48007 Ang I7.CG1 and L23.CD1 other bump:1.07324 Ang I7.CD1 and L23.CD1 other bump:2.03151 Ang I7.CD1 and L23.CG other bump:2.39615 Ang I7.CD1 and L23.CB other bump:1.92836 Ang G11.O and A16.CB other bump:2.95158 Ang G11.C and A16.CB T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLN 1pjbA 190 :GAQVQIFDINVERLSYLETLFGSRVE Fragment has 19 clashes (null) has 19 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:2.94969 Ang I22.CD1 and L26.CD2 other bump:2.86667 Ang I5.CD1 and L26.CD2 other bump:2.7084 Ang I5.CG1 and L26.CD1 other bump:2.69185 Ang I5.CD1 and L26.CD1 other bump:2.68568 Ang I5.CG1 and L26.CG other bump:2.55449 Ang I5.CD1 and L26.CG self-bump: 2.20268 Ang A23.CB and A23.C self-bump: 1.22982 Ang A23.CA and A23.CB other bump:1.69946 Ang V12.CG1 and E16.OE2 other bump:1.09857 Ang V12.O and E16.OE1 other bump:1.78251 Ang V12.C and E16.OE1 other bump:2.24801 Ang E13.N and E16.OE1 other bump:2.29401 Ang E13.CA and E16.OE1 other bump:2.77824 Ang E13.C and E16.OE1 other bump:1.88968 Ang V12.O and E16.CD other bump:2.64365 Ang V12.C and E16.CD other bump:2.76124 Ang V12.CG1 and E16.CD other bump:2.98556 Ang N3.CG and I5.CG2 other bump:1.94842 Ang N3.ND2 and I5.CG2 T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLREDMVVMDLIY 1pjbA 216 :LLYSNSAEIETAVAEADLLIGAVLVPGRRAPILVPASLVEQMRTGSVIVDVAV Fragment has 41 clashes (null) has 41 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 55 residues other bump:2.62164 Ang T24.N and I53.CD1 other bump:2.72237 Ang T24.CA and I53.CD1 other bump:1.83179 Ang T24.C and I53.CD1 other bump:2.54505 Ang P25.N and I53.CD1 other bump:2.42416 Ang P25.CG and I53.CD1 other bump:2.88348 Ang P25.CD and I53.CD1 other bump:2.9826 Ang P25.CA and I53.CD1 other bump:3.02195 Ang P25.CB and I53.CD1 other bump:3.01 Ang T24.OG1 and I53.CD1 other bump:1.39498 Ang T24.O and I53.CD1 other bump:2.27341 Ang P25.CG and I53.CG1 other bump:2.56688 Ang P25.CB and I53.CG1 other bump:2.30318 Ang N22.CG and D51.OD2 other bump:1.41777 Ang N22.OD1 and D51.OD2 other bump:2.6915 Ang N22.CB and D51.OD1 other bump:2.41436 Ang N22.CG and D51.OD1 other bump:2.49701 Ang N22.CB and D51.CG other bump:2.42431 Ang N22.CG and D51.CG other bump:2.1063 Ang N22.OD1 and D51.CG other bump:3.11224 Ang N22.CB and D51.CB other bump:3.23977 Ang N22.CB and D51.CA other bump:3.03327 Ang I20.CG1 and V49.CG1 other bump:3.04491 Ang I20.CD1 and V49.CG1 other bump:1.36164 Ang V17.O and M47.CE other bump:2.3306 Ang V17.C and M47.CE other bump:2.41025 Ang V17.O and M47.SD other bump:3.08109 Ang D18.CA and M47.SD other bump:2.74048 Ang D18.O and M47.SD other bump:2.69265 Ang D18.C and M47.SD other bump:2.13005 Ang D15.OD1 and K42.O other bump:2.55501 Ang L14.CB and K39.NZ other bump:2.85577 Ang L14.CB and K39.CE other bump:2.63275 Ang D33.OD1 and E35.C other bump:3.03091 Ang L14.CD1 and E35.OE2 other bump:2.89138 Ang I20.CD1 and E35.OE1 self-bump: 1.34334 Ang M28.CA and M28.CB other bump:2.72802 Ang A23.C and P25.CD other bump:2.55923 Ang V17.CG1 and I20.CG2 other bump:2.87573 Ang V17.CG1 and I19.C other bump:2.67136 Ang V17.CG1 and I19.O other bump:2.76978 Ang V5.CG1 and L10.CD1 T0191 127 :NPLETVLL 1pjbA 300 :MPGAVPWT Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 10 residues other bump:2.36953 Ang N2.O and E5.OE2 other bump:1.96335 Ang N2.C and E5.OE1 other bump:0.798592 Ang N2.O and E5.OE1 other bump:2.80186 Ang N2.C and E5.CD other bump:1.739 Ang N2.O and E5.CD T0191 136 :EAKKVNAKTINGLGMLIYQGAVAFK 1pjbA 308 :ATQALNNSTLPYVVKLANQGLKALE Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 26 residues other bump:2.08492 Ang G15.O and Y19.CD1 other bump:2.51879 Ang N7.O and I11.CD1 other bump:2.18227 Ang N7.O and I11.CG1 Number of specific fragments= 7 total=1009 Number of alignments=191 # Reading fragments from alignment file # T0191 read from T0191-1pjbA-2track-protein-STR-local-adpstyle1.pw.a2m.gz # 1pjbA read from T0191-1pjbA-2track-protein-STR-local-adpstyle1.pw.a2m.gz # found chain 1pjbA in template set T0191 2 :GYNTDGIGARMALEEEIGR 1pjbA 137 :GRLSVQFGARFLERQQGGR Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 21 residues neighbor-bump: 2.35254 Ang E17.O and I18.CD1 neighbor-bump: 1.89109 Ang E17.O and I18.CG1 neighbor-bump: 2.50232 Ang E17.C and I18.CG1 neighbor-bump: 1.87766 Ang E17.O and I18.CB neighbor-bump: 2.40335 Ang E17.C and I18.CB T0191 21 :VKDKNIVIYGAGGAARAVAFELAK 1pjbA 165 :VKPGKVVILGGGVVGTEAAKMAVG Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 26 residues other bump:2.87104 Ang I7.CD1 and L23.CD2 other bump:2.48007 Ang I7.CG1 and L23.CD1 other bump:1.07324 Ang I7.CD1 and L23.CD1 other bump:2.03151 Ang I7.CD1 and L23.CG other bump:2.39615 Ang I7.CD1 and L23.CB other bump:1.92836 Ang G11.O and A16.CB other bump:2.95158 Ang G11.C and A16.CB T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLN 1pjbA 190 :GAQVQIFDINVERLSYLETLFGSRVE Fragment has 19 clashes (null) has 19 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:2.94969 Ang I22.CD1 and L26.CD2 other bump:2.86667 Ang I5.CD1 and L26.CD2 other bump:2.7084 Ang I5.CG1 and L26.CD1 other bump:2.69185 Ang I5.CD1 and L26.CD1 other bump:2.68568 Ang I5.CG1 and L26.CG other bump:2.55449 Ang I5.CD1 and L26.CG self-bump: 2.20268 Ang A23.CB and A23.C self-bump: 1.22982 Ang A23.CA and A23.CB other bump:1.69946 Ang V12.CG1 and E16.OE2 other bump:1.09857 Ang V12.O and E16.OE1 other bump:1.78251 Ang V12.C and E16.OE1 other bump:2.24801 Ang E13.N and E16.OE1 other bump:2.29401 Ang E13.CA and E16.OE1 other bump:2.77824 Ang E13.C and E16.OE1 other bump:1.88968 Ang V12.O and E16.CD other bump:2.64365 Ang V12.C and E16.CD other bump:2.76124 Ang V12.CG1 and E16.CD other bump:2.98556 Ang N3.CG and I5.CG2 other bump:1.94842 Ang N3.ND2 and I5.CG2 T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLREDMVVMDLIY 1pjbA 216 :LLYSNSAEIETAVAEADLLIGAVLVPGRRAPILVPASLVEQMRTGSVIVDVAV Fragment has 41 clashes (null) has 41 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 55 residues other bump:2.62164 Ang T24.N and I53.CD1 other bump:2.72237 Ang T24.CA and I53.CD1 other bump:1.83179 Ang T24.C and I53.CD1 other bump:2.54505 Ang P25.N and I53.CD1 other bump:2.42416 Ang P25.CG and I53.CD1 other bump:2.88348 Ang P25.CD and I53.CD1 other bump:2.9826 Ang P25.CA and I53.CD1 other bump:3.02195 Ang P25.CB and I53.CD1 other bump:3.01 Ang T24.OG1 and I53.CD1 other bump:1.39498 Ang T24.O and I53.CD1 other bump:2.27341 Ang P25.CG and I53.CG1 other bump:2.56688 Ang P25.CB and I53.CG1 other bump:2.30318 Ang N22.CG and D51.OD2 other bump:1.41777 Ang N22.OD1 and D51.OD2 other bump:2.6915 Ang N22.CB and D51.OD1 other bump:2.41436 Ang N22.CG and D51.OD1 other bump:2.49701 Ang N22.CB and D51.CG other bump:2.42431 Ang N22.CG and D51.CG other bump:2.1063 Ang N22.OD1 and D51.CG other bump:3.11224 Ang N22.CB and D51.CB other bump:3.23977 Ang N22.CB and D51.CA other bump:3.03327 Ang I20.CG1 and V49.CG1 other bump:3.04491 Ang I20.CD1 and V49.CG1 other bump:1.36164 Ang V17.O and M47.CE other bump:2.3306 Ang V17.C and M47.CE other bump:2.41025 Ang V17.O and M47.SD other bump:3.08109 Ang D18.CA and M47.SD other bump:2.74048 Ang D18.O and M47.SD other bump:2.69265 Ang D18.C and M47.SD other bump:2.13005 Ang D15.OD1 and K42.O other bump:2.55501 Ang L14.CB and K39.NZ other bump:2.85577 Ang L14.CB and K39.CE other bump:2.63275 Ang D33.OD1 and E35.C other bump:3.03091 Ang L14.CD1 and E35.OE2 other bump:2.89138 Ang I20.CD1 and E35.OE1 self-bump: 1.34334 Ang M28.CA and M28.CB other bump:2.72802 Ang A23.C and P25.CD other bump:2.55923 Ang V17.CG1 and I20.CG2 other bump:2.87573 Ang V17.CG1 and I19.C other bump:2.67136 Ang V17.CG1 and I19.O other bump:2.76978 Ang V5.CG1 and L10.CD1 Number of specific fragments= 4 total=1013 Number of alignments=192 # Reading fragments from alignment file # T0191 read from T0191-1pjbA-2track-protein-STR-local-adpstyle5.pw.a2m.gz # 1pjbA read from T0191-1pjbA-2track-protein-STR-local-adpstyle5.pw.a2m.gz # found chain 1pjbA in template set T0191 7 :GIGARMALEEEIGR 1pjbA 142 :QFGARFLERQQGGR Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 16 residues neighbor-bump: 2.35254 Ang E12.O and I13.CD1 neighbor-bump: 1.89109 Ang E12.O and I13.CG1 neighbor-bump: 2.50232 Ang E12.C and I13.CG1 neighbor-bump: 1.87766 Ang E12.O and I13.CB neighbor-bump: 2.40335 Ang E12.C and I13.CB T0191 21 :VKDKNIVIYGAGGAARAVAFELAK 1pjbA 165 :VKPGKVVILGGGVVGTEAAKMAVG Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 26 residues other bump:2.87104 Ang I7.CD1 and L23.CD2 other bump:2.48007 Ang I7.CG1 and L23.CD1 other bump:1.07324 Ang I7.CD1 and L23.CD1 other bump:2.03151 Ang I7.CD1 and L23.CG other bump:2.39615 Ang I7.CD1 and L23.CB other bump:1.92836 Ang G11.O and A16.CB other bump:2.95158 Ang G11.C and A16.CB T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLN 1pjbA 190 :GAQVQIFDINVERLSYLETLFGSRVE Fragment has 19 clashes (null) has 19 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:2.94969 Ang I22.CD1 and L26.CD2 other bump:2.86667 Ang I5.CD1 and L26.CD2 other bump:2.7084 Ang I5.CG1 and L26.CD1 other bump:2.69185 Ang I5.CD1 and L26.CD1 other bump:2.68568 Ang I5.CG1 and L26.CG other bump:2.55449 Ang I5.CD1 and L26.CG self-bump: 2.20268 Ang A23.CB and A23.C self-bump: 1.22982 Ang A23.CA and A23.CB other bump:1.69946 Ang V12.CG1 and E16.OE2 other bump:1.09857 Ang V12.O and E16.OE1 other bump:1.78251 Ang V12.C and E16.OE1 other bump:2.24801 Ang E13.N and E16.OE1 other bump:2.29401 Ang E13.CA and E16.OE1 other bump:2.77824 Ang E13.C and E16.OE1 other bump:1.88968 Ang V12.O and E16.CD other bump:2.64365 Ang V12.C and E16.CD other bump:2.76124 Ang V12.CG1 and E16.CD other bump:2.98556 Ang N3.CG and I5.CG2 other bump:1.94842 Ang N3.ND2 and I5.CG2 T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLREDMVVMDLIY 1pjbA 216 :LLYSNSAEIETAVAEADLLIGAVLVPGRRAPILVPASLVEQMRTGSVIVDVAV Fragment has 41 clashes (null) has 41 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 55 residues other bump:2.62164 Ang T24.N and I53.CD1 other bump:2.72237 Ang T24.CA and I53.CD1 other bump:1.83179 Ang T24.C and I53.CD1 other bump:2.54505 Ang P25.N and I53.CD1 other bump:2.42416 Ang P25.CG and I53.CD1 other bump:2.88348 Ang P25.CD and I53.CD1 other bump:2.9826 Ang P25.CA and I53.CD1 other bump:3.02195 Ang P25.CB and I53.CD1 other bump:3.01 Ang T24.OG1 and I53.CD1 other bump:1.39498 Ang T24.O and I53.CD1 other bump:2.27341 Ang P25.CG and I53.CG1 other bump:2.56688 Ang P25.CB and I53.CG1 other bump:2.30318 Ang N22.CG and D51.OD2 other bump:1.41777 Ang N22.OD1 and D51.OD2 other bump:2.6915 Ang N22.CB and D51.OD1 other bump:2.41436 Ang N22.CG and D51.OD1 other bump:2.49701 Ang N22.CB and D51.CG other bump:2.42431 Ang N22.CG and D51.CG other bump:2.1063 Ang N22.OD1 and D51.CG other bump:3.11224 Ang N22.CB and D51.CB other bump:3.23977 Ang N22.CB and D51.CA other bump:3.03327 Ang I20.CG1 and V49.CG1 other bump:3.04491 Ang I20.CD1 and V49.CG1 other bump:1.36164 Ang V17.O and M47.CE other bump:2.3306 Ang V17.C and M47.CE other bump:2.41025 Ang V17.O and M47.SD other bump:3.08109 Ang D18.CA and M47.SD other bump:2.74048 Ang D18.O and M47.SD other bump:2.69265 Ang D18.C and M47.SD other bump:2.13005 Ang D15.OD1 and K42.O other bump:2.55501 Ang L14.CB and K39.NZ other bump:2.85577 Ang L14.CB and K39.CE other bump:2.63275 Ang D33.OD1 and E35.C other bump:3.03091 Ang L14.CD1 and E35.OE2 other bump:2.89138 Ang I20.CD1 and E35.OE1 self-bump: 1.34334 Ang M28.CA and M28.CB other bump:2.72802 Ang A23.C and P25.CD other bump:2.55923 Ang V17.CG1 and I20.CG2 other bump:2.87573 Ang V17.CG1 and I19.C other bump:2.67136 Ang V17.CG1 and I19.O other bump:2.76978 Ang V5.CG1 and L10.CD1 Number of specific fragments= 4 total=1017 Number of alignments=193 # Reading fragments from alignment file # T0191 read from T0191-1pjbA-local-adpstyle1.pw.a2m.gz # 1pjbA read from T0191-1pjbA-local-adpstyle1.pw.a2m.gz # found chain 1pjbA in template set T0191 9 :GARMALEEEIGRVKDKNIVIYGAGGAARAVAFELAK 1pjbA 153 :GGRGVLLGGVPGVKPGKVVILGGGVVGTEAAKMAVG Fragment has 40 clashes (null) has 40 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 38 residues other bump:3.13575 Ang E9.CD and G38.CA other bump:2.82771 Ang E9.OE2 and G38.CA other bump:3.17299 Ang E9.CG and G38.CA other bump:2.87104 Ang I19.CD1 and L35.CD2 other bump:1.07324 Ang I19.CD1 and L35.CD1 other bump:2.48007 Ang I19.CG1 and L35.CD1 other bump:2.03151 Ang I19.CD1 and L35.CG other bump:2.39615 Ang I19.CD1 and L35.CB other bump:1.92836 Ang G23.O and A28.CB other bump:2.95158 Ang G23.C and A28.CB other bump:1.87475 Ang E8.CG and K17.NZ other bump:2.57217 Ang E8.CD and K17.NZ other bump:2.77202 Ang E8.CG and K17.CE other bump:3.08341 Ang E8.N and K17.CG other bump:2.56817 Ang E8.CA and K17.CG other bump:3.07367 Ang E8.CA and K17.CB other bump:2.36681 Ang E10.OE1 and D16.OD2 other bump:1.95152 Ang E9.O and D16.OD1 other bump:2.69038 Ang E9.C and D16.OD1 other bump:2.16492 Ang E10.OE2 and D16.OD1 other bump:2.11643 Ang E10.CB and D16.OD1 other bump:1.87989 Ang E10.CG and D16.OD1 other bump:1.73761 Ang E10.CD and D16.OD1 other bump:1.72944 Ang E10.OE1 and D16.CG other bump:2.44751 Ang E10.OE2 and D16.CG other bump:2.47637 Ang E10.CG and D16.CG other bump:1.78756 Ang E10.CD and D16.CG other bump:1.52107 Ang E10.OE1 and D16.CB other bump:2.58769 Ang E10.CG and D16.CB other bump:2.21762 Ang E10.CD and D16.CB other bump:1.95957 Ang E10.OE1 and D16.CA other bump:1.85675 Ang E10.CG and D16.CA other bump:2.19718 Ang E10.CD and D16.CA other bump:1.71558 Ang E10.OE1 and D16.N other bump:2.04417 Ang E10.CG and D16.N other bump:1.83947 Ang E10.CD and D16.N other bump:2.53024 Ang E10.CG and K15.C other bump:2.76366 Ang E10.CD and K15.C neighbor-bump: 2.11869 Ang E9.O and E10.CB neighbor-bump: 2.534 Ang E9.C and E10.CB T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLN 1pjbA 190 :GAQVQIFDINVERLSYLETLFGSRVE Fragment has 19 clashes (null) has 19 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:2.94969 Ang I22.CD1 and L26.CD2 other bump:2.86667 Ang I5.CD1 and L26.CD2 other bump:2.7084 Ang I5.CG1 and L26.CD1 other bump:2.69185 Ang I5.CD1 and L26.CD1 other bump:2.68568 Ang I5.CG1 and L26.CG other bump:2.55449 Ang I5.CD1 and L26.CG self-bump: 2.20268 Ang A23.CB and A23.C self-bump: 1.22982 Ang A23.CA and A23.CB other bump:1.69946 Ang V12.CG1 and E16.OE2 other bump:1.09857 Ang V12.O and E16.OE1 other bump:1.78251 Ang V12.C and E16.OE1 other bump:2.24801 Ang E13.N and E16.OE1 other bump:2.29401 Ang E13.CA and E16.OE1 other bump:2.77824 Ang E13.C and E16.OE1 other bump:1.88968 Ang V12.O and E16.CD other bump:2.64365 Ang V12.C and E16.CD other bump:2.76124 Ang V12.CG1 and E16.CD other bump:2.98556 Ang N3.CG and I5.CG2 other bump:1.94842 Ang N3.ND2 and I5.CG2 T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLREDMVVMDLIY 1pjbA 216 :LLYSNSAEIETAVAEADLLIGAVLVPGRRAPILVPASLVEQMRTGSVIVDVAV Fragment has 41 clashes (null) has 41 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 55 residues other bump:2.62164 Ang T24.N and I53.CD1 other bump:2.72237 Ang T24.CA and I53.CD1 other bump:1.83179 Ang T24.C and I53.CD1 other bump:2.54505 Ang P25.N and I53.CD1 other bump:2.42416 Ang P25.CG and I53.CD1 other bump:2.88348 Ang P25.CD and I53.CD1 other bump:2.9826 Ang P25.CA and I53.CD1 other bump:3.02195 Ang P25.CB and I53.CD1 other bump:3.01 Ang T24.OG1 and I53.CD1 other bump:1.39498 Ang T24.O and I53.CD1 other bump:2.27341 Ang P25.CG and I53.CG1 other bump:2.56688 Ang P25.CB and I53.CG1 other bump:2.30318 Ang N22.CG and D51.OD2 other bump:1.41777 Ang N22.OD1 and D51.OD2 other bump:2.6915 Ang N22.CB and D51.OD1 other bump:2.41436 Ang N22.CG and D51.OD1 other bump:2.49701 Ang N22.CB and D51.CG other bump:2.42431 Ang N22.CG and D51.CG other bump:2.1063 Ang N22.OD1 and D51.CG other bump:3.11224 Ang N22.CB and D51.CB other bump:3.23977 Ang N22.CB and D51.CA other bump:3.03327 Ang I20.CG1 and V49.CG1 other bump:3.04491 Ang I20.CD1 and V49.CG1 other bump:1.36164 Ang V17.O and M47.CE other bump:2.3306 Ang V17.C and M47.CE other bump:2.41025 Ang V17.O and M47.SD other bump:3.08109 Ang D18.CA and M47.SD other bump:2.74048 Ang D18.O and M47.SD other bump:2.69265 Ang D18.C and M47.SD other bump:2.13005 Ang D15.OD1 and K42.O other bump:2.55501 Ang L14.CB and K39.NZ other bump:2.85577 Ang L14.CB and K39.CE other bump:2.63275 Ang D33.OD1 and E35.C other bump:3.03091 Ang L14.CD1 and E35.OE2 other bump:2.89138 Ang I20.CD1 and E35.OE1 self-bump: 1.34334 Ang M28.CA and M28.CB other bump:2.72802 Ang A23.C and P25.CD other bump:2.55923 Ang V17.CG1 and I20.CG2 other bump:2.87573 Ang V17.CG1 and I19.C other bump:2.67136 Ang V17.CG1 and I19.O other bump:2.76978 Ang V5.CG1 and L10.CD1 Number of specific fragments= 3 total=1020 Number of alignments=194 # Reading fragments from alignment file # T0191 read from T0191-1pjbA-local-adpstyle5.pw.a2m.gz # 1pjbA read from T0191-1pjbA-local-adpstyle5.pw.a2m.gz # found chain 1pjbA in template set T0191 8 :IGARMALEEEIGRVKDKNIVIYGAGGAARAVAFELAK 1pjbA 152 :QGGRGVLLGGVPGVKPGKVVILGGGVVGTEAAKMAVG Fragment has 40 clashes (null) has 40 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 39 residues other bump:3.13575 Ang E10.CD and G39.CA other bump:2.82771 Ang E10.OE2 and G39.CA other bump:3.17299 Ang E10.CG and G39.CA other bump:2.87104 Ang I20.CD1 and L36.CD2 other bump:1.07324 Ang I20.CD1 and L36.CD1 other bump:2.48007 Ang I20.CG1 and L36.CD1 other bump:2.03151 Ang I20.CD1 and L36.CG other bump:2.39615 Ang I20.CD1 and L36.CB other bump:1.92836 Ang G24.O and A29.CB other bump:2.95158 Ang G24.C and A29.CB other bump:1.87475 Ang E9.CG and K18.NZ other bump:2.57217 Ang E9.CD and K18.NZ other bump:2.77202 Ang E9.CG and K18.CE other bump:3.08341 Ang E9.N and K18.CG other bump:2.56817 Ang E9.CA and K18.CG other bump:3.07367 Ang E9.CA and K18.CB other bump:2.36681 Ang E11.OE1 and D17.OD2 other bump:1.95152 Ang E10.O and D17.OD1 other bump:2.69038 Ang E10.C and D17.OD1 other bump:1.73761 Ang E11.CD and D17.OD1 other bump:2.16492 Ang E11.OE2 and D17.OD1 other bump:2.11643 Ang E11.CB and D17.OD1 other bump:1.87989 Ang E11.CG and D17.OD1 other bump:1.78756 Ang E11.CD and D17.CG other bump:1.72944 Ang E11.OE1 and D17.CG other bump:2.44751 Ang E11.OE2 and D17.CG other bump:2.47637 Ang E11.CG and D17.CG other bump:2.21762 Ang E11.CD and D17.CB other bump:1.52107 Ang E11.OE1 and D17.CB other bump:2.58769 Ang E11.CG and D17.CB other bump:2.19718 Ang E11.CD and D17.CA other bump:1.95957 Ang E11.OE1 and D17.CA other bump:1.85675 Ang E11.CG and D17.CA other bump:1.83947 Ang E11.CD and D17.N other bump:1.71558 Ang E11.OE1 and D17.N other bump:2.04417 Ang E11.CG and D17.N other bump:2.76366 Ang E11.CD and K16.C other bump:2.53024 Ang E11.CG and K16.C neighbor-bump: 2.11869 Ang E10.O and E11.CB neighbor-bump: 2.534 Ang E10.C and E11.CB T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLN 1pjbA 190 :GAQVQIFDINVERLSYLETLFGSRVE Fragment has 19 clashes (null) has 19 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:2.94969 Ang I22.CD1 and L26.CD2 other bump:2.86667 Ang I5.CD1 and L26.CD2 other bump:2.7084 Ang I5.CG1 and L26.CD1 other bump:2.69185 Ang I5.CD1 and L26.CD1 other bump:2.68568 Ang I5.CG1 and L26.CG other bump:2.55449 Ang I5.CD1 and L26.CG self-bump: 2.20268 Ang A23.CB and A23.C self-bump: 1.22982 Ang A23.CA and A23.CB other bump:1.69946 Ang V12.CG1 and E16.OE2 other bump:1.09857 Ang V12.O and E16.OE1 other bump:1.78251 Ang V12.C and E16.OE1 other bump:2.24801 Ang E13.N and E16.OE1 other bump:2.29401 Ang E13.CA and E16.OE1 other bump:2.77824 Ang E13.C and E16.OE1 other bump:1.88968 Ang V12.O and E16.CD other bump:2.64365 Ang V12.C and E16.CD other bump:2.76124 Ang V12.CG1 and E16.CD other bump:2.98556 Ang N3.CG and I5.CG2 other bump:1.94842 Ang N3.ND2 and I5.CG2 T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLREDMVVMDLIY 1pjbA 216 :LLYSNSAEIETAVAEADLLIGAVLVPGRRAPILVPASLVEQMRTGSVIVDVAV Fragment has 41 clashes (null) has 41 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 55 residues other bump:2.62164 Ang T24.N and I53.CD1 other bump:2.72237 Ang T24.CA and I53.CD1 other bump:1.83179 Ang T24.C and I53.CD1 other bump:2.54505 Ang P25.N and I53.CD1 other bump:2.42416 Ang P25.CG and I53.CD1 other bump:2.88348 Ang P25.CD and I53.CD1 other bump:2.9826 Ang P25.CA and I53.CD1 other bump:3.02195 Ang P25.CB and I53.CD1 other bump:3.01 Ang T24.OG1 and I53.CD1 other bump:1.39498 Ang T24.O and I53.CD1 other bump:2.27341 Ang P25.CG and I53.CG1 other bump:2.56688 Ang P25.CB and I53.CG1 other bump:2.30318 Ang N22.CG and D51.OD2 other bump:1.41777 Ang N22.OD1 and D51.OD2 other bump:2.6915 Ang N22.CB and D51.OD1 other bump:2.41436 Ang N22.CG and D51.OD1 other bump:2.49701 Ang N22.CB and D51.CG other bump:2.42431 Ang N22.CG and D51.CG other bump:2.1063 Ang N22.OD1 and D51.CG other bump:3.11224 Ang N22.CB and D51.CB other bump:3.23977 Ang N22.CB and D51.CA other bump:3.03327 Ang I20.CG1 and V49.CG1 other bump:3.04491 Ang I20.CD1 and V49.CG1 other bump:1.36164 Ang V17.O and M47.CE other bump:2.3306 Ang V17.C and M47.CE other bump:2.41025 Ang V17.O and M47.SD other bump:3.08109 Ang D18.CA and M47.SD other bump:2.74048 Ang D18.O and M47.SD other bump:2.69265 Ang D18.C and M47.SD other bump:2.13005 Ang D15.OD1 and K42.O other bump:2.55501 Ang L14.CB and K39.NZ other bump:2.85577 Ang L14.CB and K39.CE other bump:2.63275 Ang D33.OD1 and E35.C other bump:3.03091 Ang L14.CD1 and E35.OE2 other bump:2.89138 Ang I20.CD1 and E35.OE1 self-bump: 1.34334 Ang M28.CA and M28.CB other bump:2.72802 Ang A23.C and P25.CD other bump:2.55923 Ang V17.CG1 and I20.CG2 other bump:2.87573 Ang V17.CG1 and I19.C other bump:2.67136 Ang V17.CG1 and I19.O other bump:2.76978 Ang V5.CG1 and L10.CD1 Number of specific fragments= 3 total=1023 Number of alignments=195 # Reading fragments from alignment file # T0191 read from T0191-1pjbA-simpleSW-adpstyle1.pw.a2m.gz # 1pjbA read from T0191-1pjbA-simpleSW-adpstyle1.pw.a2m.gz # found chain 1pjbA in template set T0191 9 :GARMALEEEIGRVKDKNIVIYGAG 1pjbA 153 :GGRGVLLGGVPGVKPGKVVILGGG Fragment has 30 clashes (null) has 30 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 26 residues other bump:1.87475 Ang E8.CG and K17.NZ other bump:2.57217 Ang E8.CD and K17.NZ other bump:2.77202 Ang E8.CG and K17.CE other bump:3.08341 Ang E8.N and K17.CG other bump:2.56817 Ang E8.CA and K17.CG other bump:3.07367 Ang E8.CA and K17.CB other bump:2.36681 Ang E10.OE1 and D16.OD2 other bump:2.16492 Ang E10.OE2 and D16.OD1 other bump:2.11643 Ang E10.CB and D16.OD1 other bump:1.95152 Ang E9.O and D16.OD1 other bump:2.69038 Ang E9.C and D16.OD1 other bump:1.87989 Ang E10.CG and D16.OD1 other bump:1.73761 Ang E10.CD and D16.OD1 other bump:2.44751 Ang E10.OE2 and D16.CG other bump:1.72944 Ang E10.OE1 and D16.CG other bump:2.47637 Ang E10.CG and D16.CG other bump:1.78756 Ang E10.CD and D16.CG other bump:1.52107 Ang E10.OE1 and D16.CB other bump:2.58769 Ang E10.CG and D16.CB other bump:2.21762 Ang E10.CD and D16.CB other bump:1.95957 Ang E10.OE1 and D16.CA other bump:1.85675 Ang E10.CG and D16.CA other bump:2.19718 Ang E10.CD and D16.CA other bump:1.71558 Ang E10.OE1 and D16.N other bump:2.04417 Ang E10.CG and D16.N other bump:1.83947 Ang E10.CD and D16.N other bump:2.53024 Ang E10.CG and K15.C other bump:2.76366 Ang E10.CD and K15.C neighbor-bump: 2.11869 Ang E9.O and E10.CB neighbor-bump: 2.534 Ang E9.C and E10.CB Number of specific fragments= 1 total=1024 Number of alignments=196 # Reading fragments from alignment file # T0191 read from T0191-1pjbA-simpleSW-adpstyle5.pw.a2m.gz # 1pjbA read from T0191-1pjbA-simpleSW-adpstyle5.pw.a2m.gz # found chain 1pjbA in template set T0191 8 :IGARMALEEEIGRVKDKNIVIYGAGGAA 1pjbA 152 :QGGRGVLLGGVPGVKPGKVVILGGGVVG Fragment has 32 clashes (null) has 32 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 30 residues other bump:1.92836 Ang G24.O and A29.CB other bump:2.95158 Ang G24.C and A29.CB other bump:1.87475 Ang E9.CG and K18.NZ other bump:2.57217 Ang E9.CD and K18.NZ other bump:2.77202 Ang E9.CG and K18.CE other bump:3.08341 Ang E9.N and K18.CG other bump:2.56817 Ang E9.CA and K18.CG other bump:3.07367 Ang E9.CA and K18.CB other bump:2.36681 Ang E11.OE1 and D17.OD2 other bump:2.16492 Ang E11.OE2 and D17.OD1 other bump:2.11643 Ang E11.CB and D17.OD1 other bump:1.95152 Ang E10.O and D17.OD1 other bump:2.69038 Ang E10.C and D17.OD1 other bump:1.73761 Ang E11.CD and D17.OD1 other bump:1.87989 Ang E11.CG and D17.OD1 other bump:2.44751 Ang E11.OE2 and D17.CG other bump:1.78756 Ang E11.CD and D17.CG other bump:1.72944 Ang E11.OE1 and D17.CG other bump:2.47637 Ang E11.CG and D17.CG other bump:2.21762 Ang E11.CD and D17.CB other bump:1.52107 Ang E11.OE1 and D17.CB other bump:2.58769 Ang E11.CG and D17.CB other bump:2.19718 Ang E11.CD and D17.CA other bump:1.95957 Ang E11.OE1 and D17.CA other bump:1.85675 Ang E11.CG and D17.CA other bump:1.83947 Ang E11.CD and D17.N other bump:1.71558 Ang E11.OE1 and D17.N other bump:2.04417 Ang E11.CG and D17.N other bump:2.76366 Ang E11.CD and K16.C other bump:2.53024 Ang E11.CG and K16.C neighbor-bump: 2.11869 Ang E10.O and E11.CB neighbor-bump: 2.534 Ang E10.C and E11.CB T0191 36 :RAVAFELAKDNNIIIANRTVEKAEAL 1pjbA 181 :EAAKMAVGLGAQVQIFDINVERLSYL Fragment has 21 clashes (null) has 21 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:1.69946 Ang V21.CG1 and E25.OE2 other bump:1.09857 Ang V21.O and E25.OE1 other bump:1.78251 Ang V21.C and E25.OE1 other bump:2.24801 Ang E22.N and E25.OE1 other bump:2.29401 Ang E22.CA and E25.OE1 other bump:2.77824 Ang E22.C and E25.OE1 other bump:1.88968 Ang V21.O and E25.CD other bump:2.64365 Ang V21.C and E25.CD other bump:2.76124 Ang V21.CG1 and E25.CD other bump:2.74816 Ang V4.CG2 and I16.CD1 other bump:3.11216 Ang V4.CG2 and I16.CG1 other bump:2.6746 Ang V4.CG1 and I14.CD1 other bump:2.98556 Ang N12.CG and I14.CG2 other bump:1.94842 Ang N12.ND2 and I14.CG2 other bump:1.32621 Ang E7.O and N12.OD1 other bump:1.93207 Ang E7.C and N12.OD1 other bump:2.66693 Ang E7.CA and N12.OD1 other bump:2.54212 Ang E7.CB and N12.ND2 other bump:2.55195 Ang E7.O and N12.CG other bump:2.97389 Ang E7.C and N12.CG other bump:3.01425 Ang E7.CB and N12.CG Number of specific fragments= 2 total=1026 Number of alignments=197 # Reading fragments from alignment file # T0191 read from T0191-1pjbA-vit-adpstyle1.pw.a2m.gz # 1pjbA read from T0191-1pjbA-vit-adpstyle1.pw.a2m.gz # found chain 1pjbA in template set T0191 9 :GARMALEEEIGRVKDKNIVIYGAGGAARAVAFELAK 1pjbA 153 :GGRGVLLGGVPGVKPGKVVILGGGVVGTEAAKMAVG Fragment has 40 clashes (null) has 40 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 38 residues other bump:3.13575 Ang E9.CD and G38.CA other bump:2.82771 Ang E9.OE2 and G38.CA other bump:3.17299 Ang E9.CG and G38.CA other bump:2.87104 Ang I19.CD1 and L35.CD2 other bump:1.07324 Ang I19.CD1 and L35.CD1 other bump:2.48007 Ang I19.CG1 and L35.CD1 other bump:2.03151 Ang I19.CD1 and L35.CG other bump:2.39615 Ang I19.CD1 and L35.CB other bump:1.92836 Ang G23.O and A28.CB other bump:2.95158 Ang G23.C and A28.CB other bump:1.87475 Ang E8.CG and K17.NZ other bump:2.57217 Ang E8.CD and K17.NZ other bump:2.77202 Ang E8.CG and K17.CE other bump:3.08341 Ang E8.N and K17.CG other bump:2.56817 Ang E8.CA and K17.CG other bump:3.07367 Ang E8.CA and K17.CB other bump:2.36681 Ang E10.OE1 and D16.OD2 other bump:1.95152 Ang E9.O and D16.OD1 other bump:2.69038 Ang E9.C and D16.OD1 other bump:2.16492 Ang E10.OE2 and D16.OD1 other bump:2.11643 Ang E10.CB and D16.OD1 other bump:1.87989 Ang E10.CG and D16.OD1 other bump:1.73761 Ang E10.CD and D16.OD1 other bump:1.72944 Ang E10.OE1 and D16.CG other bump:2.44751 Ang E10.OE2 and D16.CG other bump:2.47637 Ang E10.CG and D16.CG other bump:1.78756 Ang E10.CD and D16.CG other bump:1.52107 Ang E10.OE1 and D16.CB other bump:2.58769 Ang E10.CG and D16.CB other bump:2.21762 Ang E10.CD and D16.CB other bump:1.95957 Ang E10.OE1 and D16.CA other bump:1.85675 Ang E10.CG and D16.CA other bump:2.19718 Ang E10.CD and D16.CA other bump:1.71558 Ang E10.OE1 and D16.N other bump:2.04417 Ang E10.CG and D16.N other bump:1.83947 Ang E10.CD and D16.N other bump:2.53024 Ang E10.CG and K15.C other bump:2.76366 Ang E10.CD and K15.C neighbor-bump: 2.11869 Ang E9.O and E10.CB neighbor-bump: 2.534 Ang E9.C and E10.CB T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLN 1pjbA 190 :GAQVQIFDINVERLSYLETLFGSRVE Fragment has 19 clashes (null) has 19 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:2.94969 Ang I22.CD1 and L26.CD2 other bump:2.86667 Ang I5.CD1 and L26.CD2 other bump:2.7084 Ang I5.CG1 and L26.CD1 other bump:2.69185 Ang I5.CD1 and L26.CD1 other bump:2.68568 Ang I5.CG1 and L26.CG other bump:2.55449 Ang I5.CD1 and L26.CG self-bump: 2.20268 Ang A23.CB and A23.C self-bump: 1.22982 Ang A23.CA and A23.CB other bump:1.69946 Ang V12.CG1 and E16.OE2 other bump:1.09857 Ang V12.O and E16.OE1 other bump:1.78251 Ang V12.C and E16.OE1 other bump:2.24801 Ang E13.N and E16.OE1 other bump:2.29401 Ang E13.CA and E16.OE1 other bump:2.77824 Ang E13.C and E16.OE1 other bump:1.88968 Ang V12.O and E16.CD other bump:2.64365 Ang V12.C and E16.CD other bump:2.76124 Ang V12.CG1 and E16.CD other bump:2.98556 Ang N3.CG and I5.CG2 other bump:1.94842 Ang N3.ND2 and I5.CG2 T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLREDMVVMDLIY 1pjbA 216 :LLYSNSAEIETAVAEADLLIGAVLVPGRRAPILVPASLVEQMRTGSVIVDVAV Fragment has 41 clashes (null) has 41 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 55 residues other bump:2.62164 Ang T24.N and I53.CD1 other bump:2.72237 Ang T24.CA and I53.CD1 other bump:1.83179 Ang T24.C and I53.CD1 other bump:2.54505 Ang P25.N and I53.CD1 other bump:2.42416 Ang P25.CG and I53.CD1 other bump:2.88348 Ang P25.CD and I53.CD1 other bump:2.9826 Ang P25.CA and I53.CD1 other bump:3.02195 Ang P25.CB and I53.CD1 other bump:3.01 Ang T24.OG1 and I53.CD1 other bump:1.39498 Ang T24.O and I53.CD1 other bump:2.27341 Ang P25.CG and I53.CG1 other bump:2.56688 Ang P25.CB and I53.CG1 other bump:2.30318 Ang N22.CG and D51.OD2 other bump:1.41777 Ang N22.OD1 and D51.OD2 other bump:2.6915 Ang N22.CB and D51.OD1 other bump:2.41436 Ang N22.CG and D51.OD1 other bump:2.49701 Ang N22.CB and D51.CG other bump:2.42431 Ang N22.CG and D51.CG other bump:2.1063 Ang N22.OD1 and D51.CG other bump:3.11224 Ang N22.CB and D51.CB other bump:3.23977 Ang N22.CB and D51.CA other bump:3.03327 Ang I20.CG1 and V49.CG1 other bump:3.04491 Ang I20.CD1 and V49.CG1 other bump:1.36164 Ang V17.O and M47.CE other bump:2.3306 Ang V17.C and M47.CE other bump:2.41025 Ang V17.O and M47.SD other bump:3.08109 Ang D18.CA and M47.SD other bump:2.74048 Ang D18.O and M47.SD other bump:2.69265 Ang D18.C and M47.SD other bump:2.13005 Ang D15.OD1 and K42.O other bump:2.55501 Ang L14.CB and K39.NZ other bump:2.85577 Ang L14.CB and K39.CE other bump:2.63275 Ang D33.OD1 and E35.C other bump:3.03091 Ang L14.CD1 and E35.OE2 other bump:2.89138 Ang I20.CD1 and E35.OE1 self-bump: 1.34334 Ang M28.CA and M28.CB other bump:2.72802 Ang A23.C and P25.CD other bump:2.55923 Ang V17.CG1 and I20.CG2 other bump:2.87573 Ang V17.CG1 and I19.C other bump:2.67136 Ang V17.CG1 and I19.O other bump:2.76978 Ang V5.CG1 and L10.CD1 Number of specific fragments= 3 total=1029 Number of alignments=198 # Reading fragments from alignment file # T0191 read from T0191-1pjbA-vit-adpstyle5.pw.a2m.gz # 1pjbA read from T0191-1pjbA-vit-adpstyle5.pw.a2m.gz # found chain 1pjbA in template set T0191 8 :IGARMALEEEIGRVKDKNIVIYGAGGAARAVAFELAK 1pjbA 152 :QGGRGVLLGGVPGVKPGKVVILGGGVVGTEAAKMAVG Fragment has 40 clashes (null) has 40 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 39 residues other bump:3.13575 Ang E10.CD and G39.CA other bump:2.82771 Ang E10.OE2 and G39.CA other bump:3.17299 Ang E10.CG and G39.CA other bump:2.87104 Ang I20.CD1 and L36.CD2 other bump:1.07324 Ang I20.CD1 and L36.CD1 other bump:2.48007 Ang I20.CG1 and L36.CD1 other bump:2.03151 Ang I20.CD1 and L36.CG other bump:2.39615 Ang I20.CD1 and L36.CB other bump:1.92836 Ang G24.O and A29.CB other bump:2.95158 Ang G24.C and A29.CB other bump:1.87475 Ang E9.CG and K18.NZ other bump:2.57217 Ang E9.CD and K18.NZ other bump:2.77202 Ang E9.CG and K18.CE other bump:3.08341 Ang E9.N and K18.CG other bump:2.56817 Ang E9.CA and K18.CG other bump:3.07367 Ang E9.CA and K18.CB other bump:2.36681 Ang E11.OE1 and D17.OD2 other bump:1.95152 Ang E10.O and D17.OD1 other bump:2.69038 Ang E10.C and D17.OD1 other bump:1.73761 Ang E11.CD and D17.OD1 other bump:2.16492 Ang E11.OE2 and D17.OD1 other bump:2.11643 Ang E11.CB and D17.OD1 other bump:1.87989 Ang E11.CG and D17.OD1 other bump:1.78756 Ang E11.CD and D17.CG other bump:1.72944 Ang E11.OE1 and D17.CG other bump:2.44751 Ang E11.OE2 and D17.CG other bump:2.47637 Ang E11.CG and D17.CG other bump:2.21762 Ang E11.CD and D17.CB other bump:1.52107 Ang E11.OE1 and D17.CB other bump:2.58769 Ang E11.CG and D17.CB other bump:2.19718 Ang E11.CD and D17.CA other bump:1.95957 Ang E11.OE1 and D17.CA other bump:1.85675 Ang E11.CG and D17.CA other bump:1.83947 Ang E11.CD and D17.N other bump:1.71558 Ang E11.OE1 and D17.N other bump:2.04417 Ang E11.CG and D17.N other bump:2.76366 Ang E11.CD and K16.C other bump:2.53024 Ang E11.CG and K16.C neighbor-bump: 2.11869 Ang E10.O and E11.CB neighbor-bump: 2.534 Ang E10.C and E11.CB T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLN 1pjbA 190 :GAQVQIFDINVERLSYLETLFGSRVE Fragment has 19 clashes (null) has 19 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:2.94969 Ang I22.CD1 and L26.CD2 other bump:2.86667 Ang I5.CD1 and L26.CD2 other bump:2.7084 Ang I5.CG1 and L26.CD1 other bump:2.69185 Ang I5.CD1 and L26.CD1 other bump:2.68568 Ang I5.CG1 and L26.CG other bump:2.55449 Ang I5.CD1 and L26.CG self-bump: 2.20268 Ang A23.CB and A23.C self-bump: 1.22982 Ang A23.CA and A23.CB other bump:1.69946 Ang V12.CG1 and E16.OE2 other bump:1.09857 Ang V12.O and E16.OE1 other bump:1.78251 Ang V12.C and E16.OE1 other bump:2.24801 Ang E13.N and E16.OE1 other bump:2.29401 Ang E13.CA and E16.OE1 other bump:2.77824 Ang E13.C and E16.OE1 other bump:1.88968 Ang V12.O and E16.CD other bump:2.64365 Ang V12.C and E16.CD other bump:2.76124 Ang V12.CG1 and E16.CD other bump:2.98556 Ang N3.CG and I5.CG2 other bump:1.94842 Ang N3.ND2 and I5.CG2 T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLREDMVVMDLIY 1pjbA 216 :LLYSNSAEIETAVAEADLLIGAVLVPGRRAPILVPASLVEQMRTGSVIVDVAV Fragment has 41 clashes (null) has 41 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 55 residues other bump:2.62164 Ang T24.N and I53.CD1 other bump:2.72237 Ang T24.CA and I53.CD1 other bump:1.83179 Ang T24.C and I53.CD1 other bump:2.54505 Ang P25.N and I53.CD1 other bump:2.42416 Ang P25.CG and I53.CD1 other bump:2.88348 Ang P25.CD and I53.CD1 other bump:2.9826 Ang P25.CA and I53.CD1 other bump:3.02195 Ang P25.CB and I53.CD1 other bump:3.01 Ang T24.OG1 and I53.CD1 other bump:1.39498 Ang T24.O and I53.CD1 other bump:2.27341 Ang P25.CG and I53.CG1 other bump:2.56688 Ang P25.CB and I53.CG1 other bump:2.30318 Ang N22.CG and D51.OD2 other bump:1.41777 Ang N22.OD1 and D51.OD2 other bump:2.6915 Ang N22.CB and D51.OD1 other bump:2.41436 Ang N22.CG and D51.OD1 other bump:2.49701 Ang N22.CB and D51.CG other bump:2.42431 Ang N22.CG and D51.CG other bump:2.1063 Ang N22.OD1 and D51.CG other bump:3.11224 Ang N22.CB and D51.CB other bump:3.23977 Ang N22.CB and D51.CA other bump:3.03327 Ang I20.CG1 and V49.CG1 other bump:3.04491 Ang I20.CD1 and V49.CG1 other bump:1.36164 Ang V17.O and M47.CE other bump:2.3306 Ang V17.C and M47.CE other bump:2.41025 Ang V17.O and M47.SD other bump:3.08109 Ang D18.CA and M47.SD other bump:2.74048 Ang D18.O and M47.SD other bump:2.69265 Ang D18.C and M47.SD other bump:2.13005 Ang D15.OD1 and K42.O other bump:2.55501 Ang L14.CB and K39.NZ other bump:2.85577 Ang L14.CB and K39.CE other bump:2.63275 Ang D33.OD1 and E35.C other bump:3.03091 Ang L14.CD1 and E35.OE2 other bump:2.89138 Ang I20.CD1 and E35.OE1 self-bump: 1.34334 Ang M28.CA and M28.CB other bump:2.72802 Ang A23.C and P25.CD other bump:2.55923 Ang V17.CG1 and I20.CG2 other bump:2.87573 Ang V17.CG1 and I19.C other bump:2.67136 Ang V17.CG1 and I19.O other bump:2.76978 Ang V5.CG1 and L10.CD1 Number of specific fragments= 3 total=1032 Number of alignments=199 # command:# Prefix for input files set to 1fmcA/ # command:# reading script from file read-alignments.under # Reading fragments from alignment file # T0191 read from 1fmcA-T0191-local-adpstyle1.pw.a2m.gz # 1fmcA read from 1fmcA-T0191-local-adpstyle1.pw.a2m.gz # found chain 1fmcA in template set T0191 18 :IGRVKDKNIVIYGA 1fmcA 6 :NLRLDGKCAIITGA Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 16 residues other bump:2.64343 Ang R4.NE and K6.CE T0191 32 :GGAARAVAFELAKDN 1fmcA 21 :AGIGKEIAITFATAG Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 17 residues other bump:2.71298 Ang L12.CA and D15.OD2 other bump:1.4938 Ang L12.O and D15.OD2 other bump:2.28259 Ang L12.C and D15.OD2 other bump:3.071 Ang L12.CA and D15.CG other bump:3.13406 Ang L12.C and D15.CG other bump:3.07616 Ang R6.CG and F10.CZ other bump:2.16023 Ang R6.NH1 and F10.CE1 T0191 47 :NIIIANRTVEKAEALAKEIAE 1fmcA 37 :SVVVSDINADAANHVVDEIQQ Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 23 residues other bump:2.72753 Ang I3.CD1 and I20.CD1 other bump:3.08411 Ang I5.CD1 and L16.CB other bump:2.37256 Ang N7.CG and T9.OG1 other bump:1.43799 Ang N7.OD1 and T9.OG1 other bump:2.57783 Ang N7.OD1 and T9.CB other bump:2.93639 Ang I3.CD1 and I5.CG2 T0191 73 :FGEEVKFSGLDVD 1fmcA 58 :LGGQAFACRCDIT Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues other bump:2.13766 Ang D12.OD1 and D14.OD2 other bump:2.33374 Ang D12.CG and D14.OD2 other bump:2.65359 Ang D12.OD1 and D14.CG T0191 87 :DGVDIIINATPIGMYPNIDVEP 1fmcA 87 :GKVDILVNNAGGGGPKPFDMPM Fragment has 16 clashes (null) has 16 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 24 residues other bump:2.34456 Ang N18.O and V21.CG2 neighbor-bump: 2.55885 Ang G14.O and M15.CG neighbor-bump: 2.03735 Ang G14.O and M15.CB neighbor-bump: 2.51066 Ang G14.C and M15.CB neighbor-bump: 2.44956 Ang P12.C and I13.CG2 neighbor-bump: 1.51342 Ang P12.O and I13.CG2 neighbor-bump: 2.20267 Ang T11.O and P12.CD neighbor-bump: 2.49281 Ang T11.N and P12.CD other bump:1.94137 Ang A10.O and P12.CD other bump:2.4874 Ang A10.C and P12.CD neighbor-bump: 1.87871 Ang T11.CA and P12.CD neighbor-bump: 1.3343 Ang T11.C and P12.CD other bump:2.07084 Ang A10.O and P12.CG other bump:2.9735 Ang A10.C and P12.CG neighbor-bump: 2.35092 Ang T11.C and P12.CG self-bump: 1.36654 Ang D2.CA and D2.CB Number of specific fragments= 5 total=1037 Number of alignments=200 # Reading fragments from alignment file # T0191 read from 1fmcA-T0191-local-adpstyle5.pw.a2m.gz # 1fmcA read from 1fmcA-T0191-local-adpstyle5.pw.a2m.gz # found chain 1fmcA in template set T0191 17 :EIGRVKDKNIVIYGAG 1fmcA 5 :DNLRLDGKCAIITGAG Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 18 residues other bump:2.64343 Ang R5.NE and K7.CE T0191 33 :GAARAVAFELAKDN 1fmcA 22 :GIGKEIAITFATAG Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 16 residues other bump:2.71298 Ang L11.CA and D14.OD2 other bump:1.4938 Ang L11.O and D14.OD2 other bump:2.28259 Ang L11.C and D14.OD2 other bump:3.071 Ang L11.CA and D14.CG other bump:3.13406 Ang L11.C and D14.CG other bump:3.07616 Ang R5.CG and F9.CZ other bump:2.16023 Ang R5.NH1 and F9.CE1 T0191 47 :NIIIANRTVEKAEALAKEIAE 1fmcA 37 :SVVVSDINADAANHVVDEIQQ Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 23 residues other bump:2.72753 Ang I3.CD1 and I20.CD1 other bump:3.08411 Ang I5.CD1 and L16.CB other bump:2.37256 Ang N7.CG and T9.OG1 other bump:1.43799 Ang N7.OD1 and T9.OG1 other bump:2.57783 Ang N7.OD1 and T9.CB other bump:2.93639 Ang I3.CD1 and I5.CG2 T0191 73 :FGEEVKFSGLDVD 1fmcA 58 :LGGQAFACRCDIT Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues other bump:2.13766 Ang D12.OD1 and D14.OD2 other bump:2.33374 Ang D12.CG and D14.OD2 other bump:2.65359 Ang D12.OD1 and D14.CG T0191 87 :DGVDIIINATPIGMYPNI 1fmcA 87 :GKVDILVNNAGGGGPKPF Fragment has 15 clashes (null) has 15 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 20 residues neighbor-bump: 2.55885 Ang G14.O and M15.CG neighbor-bump: 2.03735 Ang G14.O and M15.CB neighbor-bump: 2.51066 Ang G14.C and M15.CB neighbor-bump: 1.51342 Ang P12.O and I13.CG2 neighbor-bump: 2.44956 Ang P12.C and I13.CG2 neighbor-bump: 2.20267 Ang T11.O and P12.CD neighbor-bump: 2.49281 Ang T11.N and P12.CD neighbor-bump: 1.3343 Ang T11.C and P12.CD other bump:1.94137 Ang A10.O and P12.CD other bump:2.4874 Ang A10.C and P12.CD neighbor-bump: 1.87871 Ang T11.CA and P12.CD neighbor-bump: 2.35092 Ang T11.C and P12.CG other bump:2.07084 Ang A10.O and P12.CG other bump:2.9735 Ang A10.C and P12.CG self-bump: 1.36654 Ang D2.CA and D2.CB Number of specific fragments= 5 total=1042 Number of alignments=201 # Reading fragments from alignment file # T0191 read from 1fmcA-T0191-vit-adpstyle1.pw.a2m.gz # 1fmcA read from 1fmcA-T0191-vit-adpstyle1.pw.a2m.gz # found chain 1fmcA in template set T0191 18 :IGRVKDKNIVIYGA 1fmcA 6 :NLRLDGKCAIITGA Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 16 residues other bump:2.64343 Ang R4.NE and K6.CE T0191 32 :GGAARAVAFELAKDN 1fmcA 21 :AGIGKEIAITFATAG Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 17 residues other bump:2.71298 Ang L12.CA and D15.OD2 other bump:1.4938 Ang L12.O and D15.OD2 other bump:2.28259 Ang L12.C and D15.OD2 other bump:3.071 Ang L12.CA and D15.CG other bump:3.13406 Ang L12.C and D15.CG other bump:3.07616 Ang R6.CG and F10.CZ other bump:2.16023 Ang R6.NH1 and F10.CE1 T0191 47 :NIIIANRTVEKAEALAKEIAE 1fmcA 37 :SVVVSDINADAANHVVDEIQQ Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 23 residues other bump:2.72753 Ang I3.CD1 and I20.CD1 other bump:3.08411 Ang I5.CD1 and L16.CB other bump:2.37256 Ang N7.CG and T9.OG1 other bump:1.43799 Ang N7.OD1 and T9.OG1 other bump:2.57783 Ang N7.OD1 and T9.CB other bump:2.93639 Ang I3.CD1 and I5.CG2 T0191 73 :FGEEVKFSGLDVD 1fmcA 58 :LGGQAFACRCDIT Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues other bump:2.13766 Ang D12.OD1 and D14.OD2 other bump:2.33374 Ang D12.CG and D14.OD2 other bump:2.65359 Ang D12.OD1 and D14.CG T0191 87 :DGVDIIINATPIGMYPNIDVEP 1fmcA 87 :GKVDILVNNAGGGGPKPFDMPM Fragment has 16 clashes (null) has 16 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 24 residues other bump:2.34456 Ang N18.O and V21.CG2 neighbor-bump: 2.55885 Ang G14.O and M15.CG neighbor-bump: 2.03735 Ang G14.O and M15.CB neighbor-bump: 2.51066 Ang G14.C and M15.CB neighbor-bump: 2.44956 Ang P12.C and I13.CG2 neighbor-bump: 1.51342 Ang P12.O and I13.CG2 neighbor-bump: 2.20267 Ang T11.O and P12.CD neighbor-bump: 2.49281 Ang T11.N and P12.CD other bump:1.94137 Ang A10.O and P12.CD other bump:2.4874 Ang A10.C and P12.CD neighbor-bump: 1.87871 Ang T11.CA and P12.CD neighbor-bump: 1.3343 Ang T11.C and P12.CD other bump:2.07084 Ang A10.O and P12.CG other bump:2.9735 Ang A10.C and P12.CG neighbor-bump: 2.35092 Ang T11.C and P12.CG self-bump: 1.36654 Ang D2.CA and D2.CB Number of specific fragments= 5 total=1047 Number of alignments=202 # Reading fragments from alignment file # T0191 read from 1fmcA-T0191-vit-adpstyle5.pw.a2m.gz # 1fmcA read from 1fmcA-T0191-vit-adpstyle5.pw.a2m.gz # found chain 1fmcA in template set T0191 17 :EIGRVKDKNIVIYGAG 1fmcA 5 :DNLRLDGKCAIITGAG Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 18 residues other bump:2.64343 Ang R5.NE and K7.CE T0191 33 :GAARAVAFELAKDN 1fmcA 22 :GIGKEIAITFATAG Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 16 residues other bump:2.71298 Ang L11.CA and D14.OD2 other bump:1.4938 Ang L11.O and D14.OD2 other bump:2.28259 Ang L11.C and D14.OD2 other bump:3.071 Ang L11.CA and D14.CG other bump:3.13406 Ang L11.C and D14.CG other bump:3.07616 Ang R5.CG and F9.CZ other bump:2.16023 Ang R5.NH1 and F9.CE1 T0191 47 :NIIIANRTVEKAEALAKEIAE 1fmcA 37 :SVVVSDINADAANHVVDEIQQ Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 23 residues other bump:2.72753 Ang I3.CD1 and I20.CD1 other bump:3.08411 Ang I5.CD1 and L16.CB other bump:2.37256 Ang N7.CG and T9.OG1 other bump:1.43799 Ang N7.OD1 and T9.OG1 other bump:2.57783 Ang N7.OD1 and T9.CB other bump:2.93639 Ang I3.CD1 and I5.CG2 T0191 73 :FGEEVKFSGLDVD 1fmcA 58 :LGGQAFACRCDIT Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues other bump:2.13766 Ang D12.OD1 and D14.OD2 other bump:2.33374 Ang D12.CG and D14.OD2 other bump:2.65359 Ang D12.OD1 and D14.CG T0191 87 :DGVDIIINATPIGMYPNI 1fmcA 87 :GKVDILVNNAGGGGPKPF Fragment has 15 clashes (null) has 15 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 20 residues neighbor-bump: 2.55885 Ang G14.O and M15.CG neighbor-bump: 2.03735 Ang G14.O and M15.CB neighbor-bump: 2.51066 Ang G14.C and M15.CB neighbor-bump: 1.51342 Ang P12.O and I13.CG2 neighbor-bump: 2.44956 Ang P12.C and I13.CG2 neighbor-bump: 2.20267 Ang T11.O and P12.CD neighbor-bump: 2.49281 Ang T11.N and P12.CD neighbor-bump: 1.3343 Ang T11.C and P12.CD other bump:1.94137 Ang A10.O and P12.CD other bump:2.4874 Ang A10.C and P12.CD neighbor-bump: 1.87871 Ang T11.CA and P12.CD neighbor-bump: 2.35092 Ang T11.C and P12.CG other bump:2.07084 Ang A10.O and P12.CG other bump:2.9735 Ang A10.C and P12.CG self-bump: 1.36654 Ang D2.CA and D2.CB Number of specific fragments= 5 total=1052 Number of alignments=203 # Reading fragments from alignment file # T0191 read from T0191-1fmcA-2track-protein-EBGHSTL-global-adpstyle1.pw.a2m.gz # 1fmcA read from T0191-1fmcA-2track-protein-EBGHSTL-global-adpstyle1.pw.a2m.gz # found chain 1fmcA in template set T0191 18 :IGR 1fmcA 2 :FNS Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 5 residues T0191 21 :VKDKNIVIYGAG 1fmcA 9 :LDGKCAIITGAG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues T0191 33 :GAARAVAFELAK 1fmcA 22 :GIGKEIAITFAT Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:3.07616 Ang R5.CG and F9.CZ other bump:2.16023 Ang R5.NH1 and F9.CE1 T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGLDVD 1fmcA 35 :GASVVVSDINADAANHVVDEIQQLGGQAFACRCDITSEQEL Fragment has 43 clashes (null) has 43 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 43 residues other bump:2.97946 Ang V34.CG1 and V41.CG1 other bump:2.88234 Ang K35.N and V41.CG1 other bump:2.33425 Ang R10.NH2 and K35.NZ other bump:2.75278 Ang R10.NE and K35.NZ other bump:2.46903 Ang R10.CZ and K35.NZ other bump:3.08942 Ang R10.CZ and K35.CD other bump:2.95333 Ang R10.CG and K35.CG other bump:2.89546 Ang E32.CG and V34.CG2 other bump:2.95631 Ang E32.CD and V34.CG2 other bump:2.52883 Ang E32.OE1 and V34.CG2 other bump:2.86069 Ang V12.CG1 and E33.OE2 other bump:2.61053 Ang V12.CA and E33.OE1 other bump:2.12323 Ang V12.CB and E33.OE1 other bump:1.46015 Ang V12.CG1 and E33.OE1 other bump:2.53367 Ang V12.CG2 and E33.OE1 other bump:1.97801 Ang V12.CG1 and E33.CD other bump:2.64474 Ang V12.CG1 and E33.CG other bump:2.71105 Ang V12.CG1 and E33.CB other bump:1.97712 Ang A19.CA and K29.NZ other bump:2.04116 Ang A19.C and K29.NZ other bump:1.21907 Ang L18.O and K29.NZ other bump:1.90229 Ang L18.C and K29.NZ other bump:2.2055 Ang A19.N and K29.NZ other bump:2.78468 Ang I22.CB and K29.CE other bump:1.88544 Ang A19.CA and K29.CE other bump:1.93764 Ang A19.O and K29.CE other bump:2.1214 Ang A19.C and K29.CE other bump:2.39855 Ang A19.CA and K29.CD other bump:3.07583 Ang A19.CB and K29.CD other bump:3.22948 Ang A19.CA and K29.CG other bump:2.40177 Ang N4.CG and K28.CD other bump:2.4606 Ang N4.ND2 and K28.CD other bump:2.51844 Ang N4.OD1 and K28.CD other bump:2.58373 Ang N4.OD1 and K28.CB other bump:2.74316 Ang K25.CB and N27.ND2 other bump:3.03038 Ang I22.CG2 and N27.CG other bump:2.24775 Ang I22.CG2 and N27.CB other bump:2.72754 Ang I5.CD1 and I22.CD1 other bump:3.0841 Ang I7.CD1 and L18.CB other bump:2.37256 Ang N9.CG and T11.OG1 other bump:1.43799 Ang N9.OD1 and T11.OG1 other bump:2.57783 Ang N9.OD1 and T11.CB other bump:2.93639 Ang I5.CD1 and I7.CG2 T0191 86 :LDGVDIIINATPIGMYPNIDVE 1fmcA 86 :LGKVDILVNNAGGGGPKPFDMP Fragment has 16 clashes (null) has 16 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 24 residues other bump:2.34456 Ang N19.O and V22.CG2 neighbor-bump: 2.55885 Ang G15.O and M16.CG neighbor-bump: 2.03735 Ang G15.O and M16.CB neighbor-bump: 2.51066 Ang G15.C and M16.CB neighbor-bump: 2.44956 Ang P13.C and I14.CG2 neighbor-bump: 1.51342 Ang P13.O and I14.CG2 neighbor-bump: 2.20267 Ang T12.O and P13.CD neighbor-bump: 2.49281 Ang T12.N and P13.CD other bump:1.94137 Ang A11.O and P13.CD other bump:2.4874 Ang A11.C and P13.CD neighbor-bump: 1.87871 Ang T12.CA and P13.CD neighbor-bump: 1.3343 Ang T12.C and P13.CD other bump:2.07084 Ang A11.O and P13.CG other bump:2.9735 Ang A11.C and P13.CG neighbor-bump: 2.35092 Ang T12.C and P13.CG self-bump: 1.36654 Ang D3.CA and D3.CB T0191 108 :PIVKAEKLREDMVVMDLIYN 1fmcA 128 :LVAPEMEKNGGGVILTITSM Fragment has 15 clashes (null) has 15 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 22 residues neighbor-bump: 2.0331 Ang I19.O and Y20.CD1 neighbor-bump: 2.69062 Ang I19.C and Y20.CD1 neighbor-bump: 2.32221 Ang I19.CB and Y20.N neighbor-bump: 2.45307 Ang I19.CG1 and Y20.N other bump:2.74572 Ang E7.CG and M13.CE other bump:2.51494 Ang E7.CB and M13.SD other bump:2.40261 Ang E7.CG and M13.SD other bump:2.8974 Ang E7.CB and M13.CG other bump:2.9614 Ang E7.CG and M13.CG other bump:2.77059 Ang E7.CB and M13.CB other bump:2.53415 Ang E7.CG and M13.CB other bump:2.83654 Ang E7.CD and M13.CB other bump:2.553 Ang E7.OE1 and M13.CB other bump:2.41927 Ang E7.CD and R10.NH2 other bump:2.02177 Ang E7.OE2 and R10.NH2 T0191 139 :KVNAKTINGLGMLIYQGAVAF 1fmcA 148 :AAENKNINMTSYASSKAAASH Fragment has 14 clashes (null) has 14 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 23 residues other bump:3.28262 Ang V3.CG1 and G18.CA other bump:2.6718 Ang V3.CG2 and Q17.C other bump:2.5619 Ang V3.CG2 and Q17.CB other bump:3.16389 Ang V3.CG2 and Q17.CA other bump:2.12506 Ang K2.C and L14.CD1 other bump:1.03142 Ang K2.O and L14.CD1 other bump:2.55656 Ang K2.O and L14.CG other bump:1.44407 Ang K2.CD and M13.CE other bump:2.80087 Ang K2.CG and M13.CE other bump:1.71054 Ang K2.NZ and M13.CE other bump:1.61265 Ang K2.CE and M13.CE other bump:2.55012 Ang K2.CD and M13.SD other bump:1.6109 Ang K2.NZ and M13.SD other bump:2.52892 Ang K2.CE and M13.SD Number of specific fragments= 7 total=1059 Number of alignments=204 # Reading fragments from alignment file # T0191 read from T0191-1fmcA-2track-protein-EBGHSTL-global-adpstyle5.pw.a2m.gz # 1fmcA read from T0191-1fmcA-2track-protein-EBGHSTL-global-adpstyle5.pw.a2m.gz # found chain 1fmcA in template set T0191 3 :YNT 1fmcA 2 :FNS Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 5 residues other bump:2.87391 Ang Y2.CE2 and T4.CG2 T0191 17 :EIGRVKDKNIVIYGAG 1fmcA 5 :DNLRLDGKCAIITGAG Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 18 residues other bump:2.64343 Ang R5.NE and K7.CE T0191 33 :GAARAVAFELAK 1fmcA 22 :GIGKEIAITFAT Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:3.07616 Ang R5.CG and F9.CZ other bump:2.16023 Ang R5.NH1 and F9.CE1 T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGLDVD 1fmcA 35 :GASVVVSDINADAANHVVDEIQQLGGQAFACRCDITSEQEL Fragment has 43 clashes (null) has 43 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 43 residues other bump:2.97946 Ang V34.CG1 and V41.CG1 other bump:2.88234 Ang K35.N and V41.CG1 other bump:2.33425 Ang R10.NH2 and K35.NZ other bump:2.75278 Ang R10.NE and K35.NZ other bump:2.46903 Ang R10.CZ and K35.NZ other bump:3.08942 Ang R10.CZ and K35.CD other bump:2.95333 Ang R10.CG and K35.CG other bump:2.89546 Ang E32.CG and V34.CG2 other bump:2.95631 Ang E32.CD and V34.CG2 other bump:2.52883 Ang E32.OE1 and V34.CG2 other bump:2.86069 Ang V12.CG1 and E33.OE2 other bump:2.61053 Ang V12.CA and E33.OE1 other bump:2.12323 Ang V12.CB and E33.OE1 other bump:1.46015 Ang V12.CG1 and E33.OE1 other bump:2.53367 Ang V12.CG2 and E33.OE1 other bump:1.97801 Ang V12.CG1 and E33.CD other bump:2.64474 Ang V12.CG1 and E33.CG other bump:2.71105 Ang V12.CG1 and E33.CB other bump:1.97712 Ang A19.CA and K29.NZ other bump:2.04116 Ang A19.C and K29.NZ other bump:1.21907 Ang L18.O and K29.NZ other bump:1.90229 Ang L18.C and K29.NZ other bump:2.2055 Ang A19.N and K29.NZ other bump:2.78468 Ang I22.CB and K29.CE other bump:1.88544 Ang A19.CA and K29.CE other bump:1.93764 Ang A19.O and K29.CE other bump:2.1214 Ang A19.C and K29.CE other bump:2.39855 Ang A19.CA and K29.CD other bump:3.07583 Ang A19.CB and K29.CD other bump:3.22948 Ang A19.CA and K29.CG other bump:2.40177 Ang N4.CG and K28.CD other bump:2.4606 Ang N4.ND2 and K28.CD other bump:2.51844 Ang N4.OD1 and K28.CD other bump:2.58373 Ang N4.OD1 and K28.CB other bump:2.74316 Ang K25.CB and N27.ND2 other bump:3.03038 Ang I22.CG2 and N27.CG other bump:2.24775 Ang I22.CG2 and N27.CB other bump:2.72754 Ang I5.CD1 and I22.CD1 other bump:3.0841 Ang I7.CD1 and L18.CB other bump:2.37256 Ang N9.CG and T11.OG1 other bump:1.43799 Ang N9.OD1 and T11.OG1 other bump:2.57783 Ang N9.OD1 and T11.CB other bump:2.93639 Ang I5.CD1 and I7.CG2 T0191 86 :LDGVDIIINATPIGMYPNIDVE 1fmcA 86 :LGKVDILVNNAGGGGPKPFDMP Fragment has 16 clashes (null) has 16 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 24 residues other bump:2.34456 Ang N19.O and V22.CG2 neighbor-bump: 2.55885 Ang G15.O and M16.CG neighbor-bump: 2.03735 Ang G15.O and M16.CB neighbor-bump: 2.51066 Ang G15.C and M16.CB neighbor-bump: 2.44956 Ang P13.C and I14.CG2 neighbor-bump: 1.51342 Ang P13.O and I14.CG2 neighbor-bump: 2.20267 Ang T12.O and P13.CD neighbor-bump: 2.49281 Ang T12.N and P13.CD other bump:1.94137 Ang A11.O and P13.CD other bump:2.4874 Ang A11.C and P13.CD neighbor-bump: 1.87871 Ang T12.CA and P13.CD neighbor-bump: 1.3343 Ang T12.C and P13.CD other bump:2.07084 Ang A11.O and P13.CG other bump:2.9735 Ang A11.C and P13.CG neighbor-bump: 2.35092 Ang T12.C and P13.CG self-bump: 1.36654 Ang D3.CA and D3.CB T0191 108 :PIVKAEKLREDMVVMDLIYN 1fmcA 128 :LVAPEMEKNGGGVILTITSM Fragment has 15 clashes (null) has 15 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 22 residues neighbor-bump: 2.0331 Ang I19.O and Y20.CD1 neighbor-bump: 2.69062 Ang I19.C and Y20.CD1 neighbor-bump: 2.32221 Ang I19.CB and Y20.N neighbor-bump: 2.45307 Ang I19.CG1 and Y20.N other bump:2.74572 Ang E7.CG and M13.CE other bump:2.51494 Ang E7.CB and M13.SD other bump:2.40261 Ang E7.CG and M13.SD other bump:2.8974 Ang E7.CB and M13.CG other bump:2.9614 Ang E7.CG and M13.CG other bump:2.77059 Ang E7.CB and M13.CB other bump:2.53415 Ang E7.CG and M13.CB other bump:2.83654 Ang E7.CD and M13.CB other bump:2.553 Ang E7.OE1 and M13.CB other bump:2.41927 Ang E7.CD and R10.NH2 other bump:2.02177 Ang E7.OE2 and R10.NH2 T0191 139 :KVNAKTINGLGMLIYQGAVAF 1fmcA 148 :AAENKNINMTSYASSKAAASH Fragment has 14 clashes (null) has 14 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 23 residues other bump:3.28262 Ang V3.CG1 and G18.CA other bump:2.6718 Ang V3.CG2 and Q17.C other bump:2.5619 Ang V3.CG2 and Q17.CB other bump:3.16389 Ang V3.CG2 and Q17.CA other bump:2.12506 Ang K2.C and L14.CD1 other bump:1.03142 Ang K2.O and L14.CD1 other bump:2.55656 Ang K2.O and L14.CG other bump:1.44407 Ang K2.CD and M13.CE other bump:2.80087 Ang K2.CG and M13.CE other bump:1.71054 Ang K2.NZ and M13.CE other bump:1.61265 Ang K2.CE and M13.CE other bump:2.55012 Ang K2.CD and M13.SD other bump:1.6109 Ang K2.NZ and M13.SD other bump:2.52892 Ang K2.CE and M13.SD Number of specific fragments= 7 total=1066 Number of alignments=205 # Reading fragments from alignment file # T0191 read from T0191-1fmcA-2track-protein-EBGHSTL-local-adpstyle1.pw.a2m.gz # 1fmcA read from T0191-1fmcA-2track-protein-EBGHSTL-local-adpstyle1.pw.a2m.gz # found chain 1fmcA in template set T0191 18 :IGRVKDKNIVIYGAG 1fmcA 6 :NLRLDGKCAIITGAG Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 17 residues other bump:2.64343 Ang R4.NE and K6.CE T0191 33 :GAARAVAFELAK 1fmcA 22 :GIGKEIAITFAT Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:3.07616 Ang R5.CG and F9.CZ other bump:2.16023 Ang R5.NH1 and F9.CE1 T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGLDVD 1fmcA 35 :GASVVVSDINADAANHVVDEIQQLGGQAFACRCDITSEQEL Fragment has 43 clashes (null) has 43 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 43 residues other bump:2.97946 Ang V34.CG1 and V41.CG1 other bump:2.88234 Ang K35.N and V41.CG1 other bump:2.33425 Ang R10.NH2 and K35.NZ other bump:2.75278 Ang R10.NE and K35.NZ other bump:2.46903 Ang R10.CZ and K35.NZ other bump:3.08942 Ang R10.CZ and K35.CD other bump:2.95333 Ang R10.CG and K35.CG other bump:2.89546 Ang E32.CG and V34.CG2 other bump:2.95631 Ang E32.CD and V34.CG2 other bump:2.52883 Ang E32.OE1 and V34.CG2 other bump:2.86069 Ang V12.CG1 and E33.OE2 other bump:2.61053 Ang V12.CA and E33.OE1 other bump:2.12323 Ang V12.CB and E33.OE1 other bump:1.46015 Ang V12.CG1 and E33.OE1 other bump:2.53367 Ang V12.CG2 and E33.OE1 other bump:1.97801 Ang V12.CG1 and E33.CD other bump:2.64474 Ang V12.CG1 and E33.CG other bump:2.71105 Ang V12.CG1 and E33.CB other bump:1.97712 Ang A19.CA and K29.NZ other bump:2.04116 Ang A19.C and K29.NZ other bump:1.21907 Ang L18.O and K29.NZ other bump:1.90229 Ang L18.C and K29.NZ other bump:2.2055 Ang A19.N and K29.NZ other bump:2.78468 Ang I22.CB and K29.CE other bump:1.88544 Ang A19.CA and K29.CE other bump:1.93764 Ang A19.O and K29.CE other bump:2.1214 Ang A19.C and K29.CE other bump:2.39855 Ang A19.CA and K29.CD other bump:3.07583 Ang A19.CB and K29.CD other bump:3.22948 Ang A19.CA and K29.CG other bump:2.40177 Ang N4.CG and K28.CD other bump:2.4606 Ang N4.ND2 and K28.CD other bump:2.51844 Ang N4.OD1 and K28.CD other bump:2.58373 Ang N4.OD1 and K28.CB other bump:2.74316 Ang K25.CB and N27.ND2 other bump:3.03038 Ang I22.CG2 and N27.CG other bump:2.24775 Ang I22.CG2 and N27.CB other bump:2.72754 Ang I5.CD1 and I22.CD1 other bump:3.0841 Ang I7.CD1 and L18.CB other bump:2.37256 Ang N9.CG and T11.OG1 other bump:1.43799 Ang N9.OD1 and T11.OG1 other bump:2.57783 Ang N9.OD1 and T11.CB other bump:2.93639 Ang I5.CD1 and I7.CG2 T0191 86 :LDGVDIIINATPIGMYPNIDVEP 1fmcA 86 :LGKVDILVNNAGGGGPKPFDMPM Fragment has 16 clashes (null) has 16 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 25 residues other bump:2.34456 Ang N19.O and V22.CG2 neighbor-bump: 2.55885 Ang G15.O and M16.CG neighbor-bump: 2.03735 Ang G15.O and M16.CB neighbor-bump: 2.51066 Ang G15.C and M16.CB neighbor-bump: 2.44956 Ang P13.C and I14.CG2 neighbor-bump: 1.51342 Ang P13.O and I14.CG2 neighbor-bump: 2.20267 Ang T12.O and P13.CD neighbor-bump: 2.49281 Ang T12.N and P13.CD other bump:1.94137 Ang A11.O and P13.CD other bump:2.4874 Ang A11.C and P13.CD neighbor-bump: 1.87871 Ang T12.CA and P13.CD neighbor-bump: 1.3343 Ang T12.C and P13.CD other bump:2.07084 Ang A11.O and P13.CG other bump:2.9735 Ang A11.C and P13.CG neighbor-bump: 2.35092 Ang T12.C and P13.CG self-bump: 1.36654 Ang D3.CA and D3.CB Number of specific fragments= 4 total=1070 Number of alignments=206 # Reading fragments from alignment file # T0191 read from T0191-1fmcA-2track-protein-EBGHSTL-local-adpstyle5.pw.a2m.gz # 1fmcA read from T0191-1fmcA-2track-protein-EBGHSTL-local-adpstyle5.pw.a2m.gz # found chain 1fmcA in template set T0191 18 :IGRVKDKNIVIYGAG 1fmcA 6 :NLRLDGKCAIITGAG Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 17 residues other bump:2.64343 Ang R4.NE and K6.CE T0191 33 :GAARAVAFELAK 1fmcA 22 :GIGKEIAITFAT Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:3.07616 Ang R5.CG and F9.CZ other bump:2.16023 Ang R5.NH1 and F9.CE1 T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGLDVD 1fmcA 35 :GASVVVSDINADAANHVVDEIQQLGGQAFACRCDITSEQEL Fragment has 43 clashes (null) has 43 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 43 residues other bump:2.97946 Ang V34.CG1 and V41.CG1 other bump:2.88234 Ang K35.N and V41.CG1 other bump:2.33425 Ang R10.NH2 and K35.NZ other bump:2.75278 Ang R10.NE and K35.NZ other bump:2.46903 Ang R10.CZ and K35.NZ other bump:3.08942 Ang R10.CZ and K35.CD other bump:2.95333 Ang R10.CG and K35.CG other bump:2.89546 Ang E32.CG and V34.CG2 other bump:2.95631 Ang E32.CD and V34.CG2 other bump:2.52883 Ang E32.OE1 and V34.CG2 other bump:2.86069 Ang V12.CG1 and E33.OE2 other bump:2.61053 Ang V12.CA and E33.OE1 other bump:2.12323 Ang V12.CB and E33.OE1 other bump:1.46015 Ang V12.CG1 and E33.OE1 other bump:2.53367 Ang V12.CG2 and E33.OE1 other bump:1.97801 Ang V12.CG1 and E33.CD other bump:2.64474 Ang V12.CG1 and E33.CG other bump:2.71105 Ang V12.CG1 and E33.CB other bump:1.97712 Ang A19.CA and K29.NZ other bump:2.04116 Ang A19.C and K29.NZ other bump:1.21907 Ang L18.O and K29.NZ other bump:1.90229 Ang L18.C and K29.NZ other bump:2.2055 Ang A19.N and K29.NZ other bump:2.78468 Ang I22.CB and K29.CE other bump:1.88544 Ang A19.CA and K29.CE other bump:1.93764 Ang A19.O and K29.CE other bump:2.1214 Ang A19.C and K29.CE other bump:2.39855 Ang A19.CA and K29.CD other bump:3.07583 Ang A19.CB and K29.CD other bump:3.22948 Ang A19.CA and K29.CG other bump:2.40177 Ang N4.CG and K28.CD other bump:2.4606 Ang N4.ND2 and K28.CD other bump:2.51844 Ang N4.OD1 and K28.CD other bump:2.58373 Ang N4.OD1 and K28.CB other bump:2.74316 Ang K25.CB and N27.ND2 other bump:3.03038 Ang I22.CG2 and N27.CG other bump:2.24775 Ang I22.CG2 and N27.CB other bump:2.72754 Ang I5.CD1 and I22.CD1 other bump:3.0841 Ang I7.CD1 and L18.CB other bump:2.37256 Ang N9.CG and T11.OG1 other bump:1.43799 Ang N9.OD1 and T11.OG1 other bump:2.57783 Ang N9.OD1 and T11.CB other bump:2.93639 Ang I5.CD1 and I7.CG2 T0191 86 :LDGVDIIINATPIGMYPNIDVEP 1fmcA 86 :LGKVDILVNNAGGGGPKPFDMPM Fragment has 16 clashes (null) has 16 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 25 residues other bump:2.34456 Ang N19.O and V22.CG2 neighbor-bump: 2.55885 Ang G15.O and M16.CG neighbor-bump: 2.03735 Ang G15.O and M16.CB neighbor-bump: 2.51066 Ang G15.C and M16.CB neighbor-bump: 2.44956 Ang P13.C and I14.CG2 neighbor-bump: 1.51342 Ang P13.O and I14.CG2 neighbor-bump: 2.20267 Ang T12.O and P13.CD neighbor-bump: 2.49281 Ang T12.N and P13.CD other bump:1.94137 Ang A11.O and P13.CD other bump:2.4874 Ang A11.C and P13.CD neighbor-bump: 1.87871 Ang T12.CA and P13.CD neighbor-bump: 1.3343 Ang T12.C and P13.CD other bump:2.07084 Ang A11.O and P13.CG other bump:2.9735 Ang A11.C and P13.CG neighbor-bump: 2.35092 Ang T12.C and P13.CG self-bump: 1.36654 Ang D3.CA and D3.CB Number of specific fragments= 4 total=1074 Number of alignments=207 # Reading fragments from alignment file # T0191 read from T0191-1fmcA-2track-protein-EBGHTL-global-adpstyle1.pw.a2m.gz # 1fmcA read from T0191-1fmcA-2track-protein-EBGHTL-global-adpstyle1.pw.a2m.gz # found chain 1fmcA in template set T0191 18 :IGR 1fmcA 2 :FNS Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 5 residues T0191 21 :VKDKNIVIYGAG 1fmcA 9 :LDGKCAIITGAG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues T0191 33 :GAARAVAFELAK 1fmcA 22 :GIGKEIAITFAT Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:3.07616 Ang R5.CG and F9.CZ other bump:2.16023 Ang R5.NH1 and F9.CE1 T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGLDVD 1fmcA 35 :GASVVVSDINADAANHVVDEIQQLGGQAFACRCDITSEQEL Fragment has 43 clashes (null) has 43 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 43 residues other bump:2.97946 Ang V34.CG1 and V41.CG1 other bump:2.88234 Ang K35.N and V41.CG1 other bump:2.33425 Ang R10.NH2 and K35.NZ other bump:2.75278 Ang R10.NE and K35.NZ other bump:2.46903 Ang R10.CZ and K35.NZ other bump:3.08942 Ang R10.CZ and K35.CD other bump:2.95333 Ang R10.CG and K35.CG other bump:2.89546 Ang E32.CG and V34.CG2 other bump:2.95631 Ang E32.CD and V34.CG2 other bump:2.52883 Ang E32.OE1 and V34.CG2 other bump:2.86069 Ang V12.CG1 and E33.OE2 other bump:2.61053 Ang V12.CA and E33.OE1 other bump:2.12323 Ang V12.CB and E33.OE1 other bump:1.46015 Ang V12.CG1 and E33.OE1 other bump:2.53367 Ang V12.CG2 and E33.OE1 other bump:1.97801 Ang V12.CG1 and E33.CD other bump:2.64474 Ang V12.CG1 and E33.CG other bump:2.71105 Ang V12.CG1 and E33.CB other bump:1.97712 Ang A19.CA and K29.NZ other bump:2.04116 Ang A19.C and K29.NZ other bump:1.21907 Ang L18.O and K29.NZ other bump:1.90229 Ang L18.C and K29.NZ other bump:2.2055 Ang A19.N and K29.NZ other bump:2.78468 Ang I22.CB and K29.CE other bump:1.88544 Ang A19.CA and K29.CE other bump:1.93764 Ang A19.O and K29.CE other bump:2.1214 Ang A19.C and K29.CE other bump:2.39855 Ang A19.CA and K29.CD other bump:3.07583 Ang A19.CB and K29.CD other bump:3.22948 Ang A19.CA and K29.CG other bump:2.40177 Ang N4.CG and K28.CD other bump:2.4606 Ang N4.ND2 and K28.CD other bump:2.51844 Ang N4.OD1 and K28.CD other bump:2.58373 Ang N4.OD1 and K28.CB other bump:2.74316 Ang K25.CB and N27.ND2 other bump:3.03038 Ang I22.CG2 and N27.CG other bump:2.24775 Ang I22.CG2 and N27.CB other bump:2.72754 Ang I5.CD1 and I22.CD1 other bump:3.0841 Ang I7.CD1 and L18.CB other bump:2.37256 Ang N9.CG and T11.OG1 other bump:1.43799 Ang N9.OD1 and T11.OG1 other bump:2.57783 Ang N9.OD1 and T11.CB other bump:2.93639 Ang I5.CD1 and I7.CG2 T0191 86 :LDGVDIIINATPIGMYPNIDVE 1fmcA 86 :LGKVDILVNNAGGGGPKPFDMP Fragment has 16 clashes (null) has 16 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 24 residues other bump:2.34456 Ang N19.O and V22.CG2 neighbor-bump: 2.55885 Ang G15.O and M16.CG neighbor-bump: 2.03735 Ang G15.O and M16.CB neighbor-bump: 2.51066 Ang G15.C and M16.CB neighbor-bump: 2.44956 Ang P13.C and I14.CG2 neighbor-bump: 1.51342 Ang P13.O and I14.CG2 neighbor-bump: 2.20267 Ang T12.O and P13.CD neighbor-bump: 2.49281 Ang T12.N and P13.CD other bump:1.94137 Ang A11.O and P13.CD other bump:2.4874 Ang A11.C and P13.CD neighbor-bump: 1.87871 Ang T12.CA and P13.CD neighbor-bump: 1.3343 Ang T12.C and P13.CD other bump:2.07084 Ang A11.O and P13.CG other bump:2.9735 Ang A11.C and P13.CG neighbor-bump: 2.35092 Ang T12.C and P13.CG self-bump: 1.36654 Ang D3.CA and D3.CB T0191 108 :PIVKAEKLREDMVVMDLIYN 1fmcA 128 :LVAPEMEKNGGGVILTITSM Fragment has 15 clashes (null) has 15 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 22 residues neighbor-bump: 2.0331 Ang I19.O and Y20.CD1 neighbor-bump: 2.69062 Ang I19.C and Y20.CD1 neighbor-bump: 2.32221 Ang I19.CB and Y20.N neighbor-bump: 2.45307 Ang I19.CG1 and Y20.N other bump:2.74572 Ang E7.CG and M13.CE other bump:2.51494 Ang E7.CB and M13.SD other bump:2.40261 Ang E7.CG and M13.SD other bump:2.8974 Ang E7.CB and M13.CG other bump:2.9614 Ang E7.CG and M13.CG other bump:2.77059 Ang E7.CB and M13.CB other bump:2.53415 Ang E7.CG and M13.CB other bump:2.83654 Ang E7.CD and M13.CB other bump:2.553 Ang E7.OE1 and M13.CB other bump:2.41927 Ang E7.CD and R10.NH2 other bump:2.02177 Ang E7.OE2 and R10.NH2 T0191 139 :KVNAKTINGLGMLIYQGAVAF 1fmcA 148 :AAENKNINMTSYASSKAAASH Fragment has 14 clashes (null) has 14 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 23 residues other bump:3.28262 Ang V3.CG1 and G18.CA other bump:2.6718 Ang V3.CG2 and Q17.C other bump:2.5619 Ang V3.CG2 and Q17.CB other bump:3.16389 Ang V3.CG2 and Q17.CA other bump:2.12506 Ang K2.C and L14.CD1 other bump:1.03142 Ang K2.O and L14.CD1 other bump:2.55656 Ang K2.O and L14.CG other bump:1.44407 Ang K2.CD and M13.CE other bump:2.80087 Ang K2.CG and M13.CE other bump:1.71054 Ang K2.NZ and M13.CE other bump:1.61265 Ang K2.CE and M13.CE other bump:2.55012 Ang K2.CD and M13.SD other bump:1.6109 Ang K2.NZ and M13.SD other bump:2.52892 Ang K2.CE and M13.SD Number of specific fragments= 7 total=1081 Number of alignments=208 # Reading fragments from alignment file # T0191 read from T0191-1fmcA-2track-protein-EBGHTL-global-adpstyle5.pw.a2m.gz # 1fmcA read from T0191-1fmcA-2track-protein-EBGHTL-global-adpstyle5.pw.a2m.gz # found chain 1fmcA in template set T0191 18 :IGR 1fmcA 2 :FNS Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 5 residues T0191 21 :VKDKNIVIYGAG 1fmcA 9 :LDGKCAIITGAG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues T0191 33 :GAARAVAFELAK 1fmcA 22 :GIGKEIAITFAT Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:3.07616 Ang R5.CG and F9.CZ other bump:2.16023 Ang R5.NH1 and F9.CE1 T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGLDVD 1fmcA 35 :GASVVVSDINADAANHVVDEIQQLGGQAFACRCDITSEQEL Fragment has 43 clashes (null) has 43 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 43 residues other bump:2.97946 Ang V34.CG1 and V41.CG1 other bump:2.88234 Ang K35.N and V41.CG1 other bump:2.33425 Ang R10.NH2 and K35.NZ other bump:2.75278 Ang R10.NE and K35.NZ other bump:2.46903 Ang R10.CZ and K35.NZ other bump:3.08942 Ang R10.CZ and K35.CD other bump:2.95333 Ang R10.CG and K35.CG other bump:2.89546 Ang E32.CG and V34.CG2 other bump:2.95631 Ang E32.CD and V34.CG2 other bump:2.52883 Ang E32.OE1 and V34.CG2 other bump:2.86069 Ang V12.CG1 and E33.OE2 other bump:2.61053 Ang V12.CA and E33.OE1 other bump:2.12323 Ang V12.CB and E33.OE1 other bump:1.46015 Ang V12.CG1 and E33.OE1 other bump:2.53367 Ang V12.CG2 and E33.OE1 other bump:1.97801 Ang V12.CG1 and E33.CD other bump:2.64474 Ang V12.CG1 and E33.CG other bump:2.71105 Ang V12.CG1 and E33.CB other bump:1.97712 Ang A19.CA and K29.NZ other bump:2.04116 Ang A19.C and K29.NZ other bump:1.21907 Ang L18.O and K29.NZ other bump:1.90229 Ang L18.C and K29.NZ other bump:2.2055 Ang A19.N and K29.NZ other bump:2.78468 Ang I22.CB and K29.CE other bump:1.88544 Ang A19.CA and K29.CE other bump:1.93764 Ang A19.O and K29.CE other bump:2.1214 Ang A19.C and K29.CE other bump:2.39855 Ang A19.CA and K29.CD other bump:3.07583 Ang A19.CB and K29.CD other bump:3.22948 Ang A19.CA and K29.CG other bump:2.40177 Ang N4.CG and K28.CD other bump:2.4606 Ang N4.ND2 and K28.CD other bump:2.51844 Ang N4.OD1 and K28.CD other bump:2.58373 Ang N4.OD1 and K28.CB other bump:2.74316 Ang K25.CB and N27.ND2 other bump:3.03038 Ang I22.CG2 and N27.CG other bump:2.24775 Ang I22.CG2 and N27.CB other bump:2.72754 Ang I5.CD1 and I22.CD1 other bump:3.0841 Ang I7.CD1 and L18.CB other bump:2.37256 Ang N9.CG and T11.OG1 other bump:1.43799 Ang N9.OD1 and T11.OG1 other bump:2.57783 Ang N9.OD1 and T11.CB other bump:2.93639 Ang I5.CD1 and I7.CG2 T0191 86 :LDGVDIIINATPIGMYPNIDVE 1fmcA 86 :LGKVDILVNNAGGGGPKPFDMP Fragment has 16 clashes (null) has 16 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 24 residues other bump:2.34456 Ang N19.O and V22.CG2 neighbor-bump: 2.55885 Ang G15.O and M16.CG neighbor-bump: 2.03735 Ang G15.O and M16.CB neighbor-bump: 2.51066 Ang G15.C and M16.CB neighbor-bump: 2.44956 Ang P13.C and I14.CG2 neighbor-bump: 1.51342 Ang P13.O and I14.CG2 neighbor-bump: 2.20267 Ang T12.O and P13.CD neighbor-bump: 2.49281 Ang T12.N and P13.CD other bump:1.94137 Ang A11.O and P13.CD other bump:2.4874 Ang A11.C and P13.CD neighbor-bump: 1.87871 Ang T12.CA and P13.CD neighbor-bump: 1.3343 Ang T12.C and P13.CD other bump:2.07084 Ang A11.O and P13.CG other bump:2.9735 Ang A11.C and P13.CG neighbor-bump: 2.35092 Ang T12.C and P13.CG self-bump: 1.36654 Ang D3.CA and D3.CB T0191 108 :PIVKAEKLREDMVVMDLIYN 1fmcA 128 :LVAPEMEKNGGGVILTITSM Fragment has 15 clashes (null) has 15 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 22 residues neighbor-bump: 2.0331 Ang I19.O and Y20.CD1 neighbor-bump: 2.69062 Ang I19.C and Y20.CD1 neighbor-bump: 2.32221 Ang I19.CB and Y20.N neighbor-bump: 2.45307 Ang I19.CG1 and Y20.N other bump:2.74572 Ang E7.CG and M13.CE other bump:2.51494 Ang E7.CB and M13.SD other bump:2.40261 Ang E7.CG and M13.SD other bump:2.8974 Ang E7.CB and M13.CG other bump:2.9614 Ang E7.CG and M13.CG other bump:2.77059 Ang E7.CB and M13.CB other bump:2.53415 Ang E7.CG and M13.CB other bump:2.83654 Ang E7.CD and M13.CB other bump:2.553 Ang E7.OE1 and M13.CB other bump:2.41927 Ang E7.CD and R10.NH2 other bump:2.02177 Ang E7.OE2 and R10.NH2 T0191 139 :KVNAKTINGLGMLIYQGAVAF 1fmcA 148 :AAENKNINMTSYASSKAAASH Fragment has 14 clashes (null) has 14 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 23 residues other bump:3.28262 Ang V3.CG1 and G18.CA other bump:2.6718 Ang V3.CG2 and Q17.C other bump:2.5619 Ang V3.CG2 and Q17.CB other bump:3.16389 Ang V3.CG2 and Q17.CA other bump:2.12506 Ang K2.C and L14.CD1 other bump:1.03142 Ang K2.O and L14.CD1 other bump:2.55656 Ang K2.O and L14.CG other bump:1.44407 Ang K2.CD and M13.CE other bump:2.80087 Ang K2.CG and M13.CE other bump:1.71054 Ang K2.NZ and M13.CE other bump:1.61265 Ang K2.CE and M13.CE other bump:2.55012 Ang K2.CD and M13.SD other bump:1.6109 Ang K2.NZ and M13.SD other bump:2.52892 Ang K2.CE and M13.SD Number of specific fragments= 7 total=1088 Number of alignments=209 # Reading fragments from alignment file # T0191 read from T0191-1fmcA-2track-protein-EBGHTL-local-adpstyle1.pw.a2m.gz # 1fmcA read from T0191-1fmcA-2track-protein-EBGHTL-local-adpstyle1.pw.a2m.gz # found chain 1fmcA in template set T0191 18 :IGRVKDKNIVIYGAG 1fmcA 6 :NLRLDGKCAIITGAG Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 17 residues other bump:2.64343 Ang R4.NE and K6.CE T0191 33 :GAARAVAFELAK 1fmcA 22 :GIGKEIAITFAT Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:3.07616 Ang R5.CG and F9.CZ other bump:2.16023 Ang R5.NH1 and F9.CE1 T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGLDVD 1fmcA 35 :GASVVVSDINADAANHVVDEIQQLGGQAFACRCDITSEQEL Fragment has 43 clashes (null) has 43 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 43 residues other bump:2.97946 Ang V34.CG1 and V41.CG1 other bump:2.88234 Ang K35.N and V41.CG1 other bump:2.33425 Ang R10.NH2 and K35.NZ other bump:2.75278 Ang R10.NE and K35.NZ other bump:2.46903 Ang R10.CZ and K35.NZ other bump:3.08942 Ang R10.CZ and K35.CD other bump:2.95333 Ang R10.CG and K35.CG other bump:2.89546 Ang E32.CG and V34.CG2 other bump:2.95631 Ang E32.CD and V34.CG2 other bump:2.52883 Ang E32.OE1 and V34.CG2 other bump:2.86069 Ang V12.CG1 and E33.OE2 other bump:2.61053 Ang V12.CA and E33.OE1 other bump:2.12323 Ang V12.CB and E33.OE1 other bump:1.46015 Ang V12.CG1 and E33.OE1 other bump:2.53367 Ang V12.CG2 and E33.OE1 other bump:1.97801 Ang V12.CG1 and E33.CD other bump:2.64474 Ang V12.CG1 and E33.CG other bump:2.71105 Ang V12.CG1 and E33.CB other bump:1.97712 Ang A19.CA and K29.NZ other bump:2.04116 Ang A19.C and K29.NZ other bump:1.21907 Ang L18.O and K29.NZ other bump:1.90229 Ang L18.C and K29.NZ other bump:2.2055 Ang A19.N and K29.NZ other bump:2.78468 Ang I22.CB and K29.CE other bump:1.88544 Ang A19.CA and K29.CE other bump:1.93764 Ang A19.O and K29.CE other bump:2.1214 Ang A19.C and K29.CE other bump:2.39855 Ang A19.CA and K29.CD other bump:3.07583 Ang A19.CB and K29.CD other bump:3.22948 Ang A19.CA and K29.CG other bump:2.40177 Ang N4.CG and K28.CD other bump:2.4606 Ang N4.ND2 and K28.CD other bump:2.51844 Ang N4.OD1 and K28.CD other bump:2.58373 Ang N4.OD1 and K28.CB other bump:2.74316 Ang K25.CB and N27.ND2 other bump:3.03038 Ang I22.CG2 and N27.CG other bump:2.24775 Ang I22.CG2 and N27.CB other bump:2.72754 Ang I5.CD1 and I22.CD1 other bump:3.0841 Ang I7.CD1 and L18.CB other bump:2.37256 Ang N9.CG and T11.OG1 other bump:1.43799 Ang N9.OD1 and T11.OG1 other bump:2.57783 Ang N9.OD1 and T11.CB other bump:2.93639 Ang I5.CD1 and I7.CG2 T0191 86 :LDGVDIIINATPIGMYPNIDVEP 1fmcA 86 :LGKVDILVNNAGGGGPKPFDMPM Fragment has 16 clashes (null) has 16 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 25 residues other bump:2.34456 Ang N19.O and V22.CG2 neighbor-bump: 2.55885 Ang G15.O and M16.CG neighbor-bump: 2.03735 Ang G15.O and M16.CB neighbor-bump: 2.51066 Ang G15.C and M16.CB neighbor-bump: 2.44956 Ang P13.C and I14.CG2 neighbor-bump: 1.51342 Ang P13.O and I14.CG2 neighbor-bump: 2.20267 Ang T12.O and P13.CD neighbor-bump: 2.49281 Ang T12.N and P13.CD other bump:1.94137 Ang A11.O and P13.CD other bump:2.4874 Ang A11.C and P13.CD neighbor-bump: 1.87871 Ang T12.CA and P13.CD neighbor-bump: 1.3343 Ang T12.C and P13.CD other bump:2.07084 Ang A11.O and P13.CG other bump:2.9735 Ang A11.C and P13.CG neighbor-bump: 2.35092 Ang T12.C and P13.CG self-bump: 1.36654 Ang D3.CA and D3.CB Number of specific fragments= 4 total=1092 Number of alignments=210 # Reading fragments from alignment file # T0191 read from T0191-1fmcA-2track-protein-EBGHTL-local-adpstyle5.pw.a2m.gz # 1fmcA read from T0191-1fmcA-2track-protein-EBGHTL-local-adpstyle5.pw.a2m.gz # found chain 1fmcA in template set T0191 18 :IGRVKDKNIVIYGAG 1fmcA 6 :NLRLDGKCAIITGAG Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 17 residues other bump:2.64343 Ang R4.NE and K6.CE T0191 33 :GAARAVAFELAK 1fmcA 22 :GIGKEIAITFAT Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:3.07616 Ang R5.CG and F9.CZ other bump:2.16023 Ang R5.NH1 and F9.CE1 T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGLDVD 1fmcA 35 :GASVVVSDINADAANHVVDEIQQLGGQAFACRCDITSEQEL Fragment has 43 clashes (null) has 43 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 43 residues other bump:2.97946 Ang V34.CG1 and V41.CG1 other bump:2.88234 Ang K35.N and V41.CG1 other bump:2.33425 Ang R10.NH2 and K35.NZ other bump:2.75278 Ang R10.NE and K35.NZ other bump:2.46903 Ang R10.CZ and K35.NZ other bump:3.08942 Ang R10.CZ and K35.CD other bump:2.95333 Ang R10.CG and K35.CG other bump:2.89546 Ang E32.CG and V34.CG2 other bump:2.95631 Ang E32.CD and V34.CG2 other bump:2.52883 Ang E32.OE1 and V34.CG2 other bump:2.86069 Ang V12.CG1 and E33.OE2 other bump:2.61053 Ang V12.CA and E33.OE1 other bump:2.12323 Ang V12.CB and E33.OE1 other bump:1.46015 Ang V12.CG1 and E33.OE1 other bump:2.53367 Ang V12.CG2 and E33.OE1 other bump:1.97801 Ang V12.CG1 and E33.CD other bump:2.64474 Ang V12.CG1 and E33.CG other bump:2.71105 Ang V12.CG1 and E33.CB other bump:1.97712 Ang A19.CA and K29.NZ other bump:2.04116 Ang A19.C and K29.NZ other bump:1.21907 Ang L18.O and K29.NZ other bump:1.90229 Ang L18.C and K29.NZ other bump:2.2055 Ang A19.N and K29.NZ other bump:2.78468 Ang I22.CB and K29.CE other bump:1.88544 Ang A19.CA and K29.CE other bump:1.93764 Ang A19.O and K29.CE other bump:2.1214 Ang A19.C and K29.CE other bump:2.39855 Ang A19.CA and K29.CD other bump:3.07583 Ang A19.CB and K29.CD other bump:3.22948 Ang A19.CA and K29.CG other bump:2.40177 Ang N4.CG and K28.CD other bump:2.4606 Ang N4.ND2 and K28.CD other bump:2.51844 Ang N4.OD1 and K28.CD other bump:2.58373 Ang N4.OD1 and K28.CB other bump:2.74316 Ang K25.CB and N27.ND2 other bump:3.03038 Ang I22.CG2 and N27.CG other bump:2.24775 Ang I22.CG2 and N27.CB other bump:2.72754 Ang I5.CD1 and I22.CD1 other bump:3.0841 Ang I7.CD1 and L18.CB other bump:2.37256 Ang N9.CG and T11.OG1 other bump:1.43799 Ang N9.OD1 and T11.OG1 other bump:2.57783 Ang N9.OD1 and T11.CB other bump:2.93639 Ang I5.CD1 and I7.CG2 T0191 86 :LDGVDIIINATPIGMYPNIDVEPI 1fmcA 86 :LGKVDILVNNAGGGGPKPFDMPMA Fragment has 17 clashes (null) has 17 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 26 residues self-bump: 1.3868 Ang P24.N and P24.CD other bump:2.34456 Ang N19.O and V22.CG2 neighbor-bump: 2.55885 Ang G15.O and M16.CG neighbor-bump: 2.03735 Ang G15.O and M16.CB neighbor-bump: 2.51066 Ang G15.C and M16.CB neighbor-bump: 2.44956 Ang P13.C and I14.CG2 neighbor-bump: 1.51342 Ang P13.O and I14.CG2 neighbor-bump: 2.20267 Ang T12.O and P13.CD neighbor-bump: 2.49281 Ang T12.N and P13.CD other bump:1.94137 Ang A11.O and P13.CD other bump:2.4874 Ang A11.C and P13.CD neighbor-bump: 1.87871 Ang T12.CA and P13.CD neighbor-bump: 1.3343 Ang T12.C and P13.CD other bump:2.07084 Ang A11.O and P13.CG other bump:2.9735 Ang A11.C and P13.CG neighbor-bump: 2.35092 Ang T12.C and P13.CG self-bump: 1.36654 Ang D3.CA and D3.CB Number of specific fragments= 4 total=1096 Number of alignments=211 # Reading fragments from alignment file # T0191 read from T0191-1fmcA-2track-protein-STR-global-adpstyle1.pw.a2m.gz # 1fmcA read from T0191-1fmcA-2track-protein-STR-global-adpstyle1.pw.a2m.gz # found chain 1fmcA in template set T0191 18 :IGR 1fmcA 2 :FNS Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 5 residues T0191 21 :VKDKNIVIYGAG 1fmcA 9 :LDGKCAIITGAG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues T0191 33 :GAARAVAFELAK 1fmcA 22 :GIGKEIAITFAT Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:3.07616 Ang R5.CG and F9.CZ other bump:2.16023 Ang R5.NH1 and F9.CE1 T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGLDVD 1fmcA 35 :GASVVVSDINADAANHVVDEIQQLGGQAFACRCDITSEQEL Fragment has 43 clashes (null) has 43 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 43 residues other bump:2.97946 Ang V34.CG1 and V41.CG1 other bump:2.88234 Ang K35.N and V41.CG1 other bump:2.33425 Ang R10.NH2 and K35.NZ other bump:2.75278 Ang R10.NE and K35.NZ other bump:2.46903 Ang R10.CZ and K35.NZ other bump:3.08942 Ang R10.CZ and K35.CD other bump:2.95333 Ang R10.CG and K35.CG other bump:2.89546 Ang E32.CG and V34.CG2 other bump:2.95631 Ang E32.CD and V34.CG2 other bump:2.52883 Ang E32.OE1 and V34.CG2 other bump:2.86069 Ang V12.CG1 and E33.OE2 other bump:2.61053 Ang V12.CA and E33.OE1 other bump:2.12323 Ang V12.CB and E33.OE1 other bump:1.46015 Ang V12.CG1 and E33.OE1 other bump:2.53367 Ang V12.CG2 and E33.OE1 other bump:1.97801 Ang V12.CG1 and E33.CD other bump:2.64474 Ang V12.CG1 and E33.CG other bump:2.71105 Ang V12.CG1 and E33.CB other bump:1.97712 Ang A19.CA and K29.NZ other bump:2.04116 Ang A19.C and K29.NZ other bump:1.21907 Ang L18.O and K29.NZ other bump:1.90229 Ang L18.C and K29.NZ other bump:2.2055 Ang A19.N and K29.NZ other bump:2.78468 Ang I22.CB and K29.CE other bump:1.88544 Ang A19.CA and K29.CE other bump:1.93764 Ang A19.O and K29.CE other bump:2.1214 Ang A19.C and K29.CE other bump:2.39855 Ang A19.CA and K29.CD other bump:3.07583 Ang A19.CB and K29.CD other bump:3.22948 Ang A19.CA and K29.CG other bump:2.40177 Ang N4.CG and K28.CD other bump:2.4606 Ang N4.ND2 and K28.CD other bump:2.51844 Ang N4.OD1 and K28.CD other bump:2.58373 Ang N4.OD1 and K28.CB other bump:2.74316 Ang K25.CB and N27.ND2 other bump:3.03038 Ang I22.CG2 and N27.CG other bump:2.24775 Ang I22.CG2 and N27.CB other bump:2.72754 Ang I5.CD1 and I22.CD1 other bump:3.0841 Ang I7.CD1 and L18.CB other bump:2.37256 Ang N9.CG and T11.OG1 other bump:1.43799 Ang N9.OD1 and T11.OG1 other bump:2.57783 Ang N9.OD1 and T11.CB other bump:2.93639 Ang I5.CD1 and I7.CG2 T0191 86 :LDGVDIIINATPIGMYPNIDVE 1fmcA 86 :LGKVDILVNNAGGGGPKPFDMP Fragment has 16 clashes (null) has 16 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 24 residues other bump:2.34456 Ang N19.O and V22.CG2 neighbor-bump: 2.55885 Ang G15.O and M16.CG neighbor-bump: 2.03735 Ang G15.O and M16.CB neighbor-bump: 2.51066 Ang G15.C and M16.CB neighbor-bump: 2.44956 Ang P13.C and I14.CG2 neighbor-bump: 1.51342 Ang P13.O and I14.CG2 neighbor-bump: 2.20267 Ang T12.O and P13.CD neighbor-bump: 2.49281 Ang T12.N and P13.CD other bump:1.94137 Ang A11.O and P13.CD other bump:2.4874 Ang A11.C and P13.CD neighbor-bump: 1.87871 Ang T12.CA and P13.CD neighbor-bump: 1.3343 Ang T12.C and P13.CD other bump:2.07084 Ang A11.O and P13.CG other bump:2.9735 Ang A11.C and P13.CG neighbor-bump: 2.35092 Ang T12.C and P13.CG self-bump: 1.36654 Ang D3.CA and D3.CB T0191 108 :PIVKAEKLREDMVVMDLIYN 1fmcA 128 :LVAPEMEKNGGGVILTITSM Fragment has 15 clashes (null) has 15 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 22 residues neighbor-bump: 2.0331 Ang I19.O and Y20.CD1 neighbor-bump: 2.69062 Ang I19.C and Y20.CD1 neighbor-bump: 2.32221 Ang I19.CB and Y20.N neighbor-bump: 2.45307 Ang I19.CG1 and Y20.N other bump:2.74572 Ang E7.CG and M13.CE other bump:2.51494 Ang E7.CB and M13.SD other bump:2.40261 Ang E7.CG and M13.SD other bump:2.8974 Ang E7.CB and M13.CG other bump:2.9614 Ang E7.CG and M13.CG other bump:2.77059 Ang E7.CB and M13.CB other bump:2.53415 Ang E7.CG and M13.CB other bump:2.83654 Ang E7.CD and M13.CB other bump:2.553 Ang E7.OE1 and M13.CB other bump:2.41927 Ang E7.CD and R10.NH2 other bump:2.02177 Ang E7.OE2 and R10.NH2 T0191 139 :KVNAKTINGLGMLIYQGAVAF 1fmcA 148 :AAENKNINMTSYASSKAAASH Fragment has 14 clashes (null) has 14 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 23 residues other bump:3.28262 Ang V3.CG1 and G18.CA other bump:2.6718 Ang V3.CG2 and Q17.C other bump:2.5619 Ang V3.CG2 and Q17.CB other bump:3.16389 Ang V3.CG2 and Q17.CA other bump:2.12506 Ang K2.C and L14.CD1 other bump:1.03142 Ang K2.O and L14.CD1 other bump:2.55656 Ang K2.O and L14.CG other bump:1.44407 Ang K2.CD and M13.CE other bump:2.80087 Ang K2.CG and M13.CE other bump:1.71054 Ang K2.NZ and M13.CE other bump:1.61265 Ang K2.CE and M13.CE other bump:2.55012 Ang K2.CD and M13.SD other bump:1.6109 Ang K2.NZ and M13.SD other bump:2.52892 Ang K2.CE and M13.SD Number of specific fragments= 7 total=1103 Number of alignments=212 # Reading fragments from alignment file # T0191 read from T0191-1fmcA-2track-protein-STR-global-adpstyle5.pw.a2m.gz # 1fmcA read from T0191-1fmcA-2track-protein-STR-global-adpstyle5.pw.a2m.gz # found chain 1fmcA in template set T0191 3 :YNT 1fmcA 2 :FNS Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 5 residues other bump:2.87391 Ang Y2.CE2 and T4.CG2 T0191 17 :EIGRVKDKNIVIYGAG 1fmcA 5 :DNLRLDGKCAIITGAG Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 18 residues other bump:2.64343 Ang R5.NE and K7.CE T0191 33 :GAARAVAFELAK 1fmcA 22 :GIGKEIAITFAT Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:3.07616 Ang R5.CG and F9.CZ other bump:2.16023 Ang R5.NH1 and F9.CE1 T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGLDVD 1fmcA 35 :GASVVVSDINADAANHVVDEIQQLGGQAFACRCDITSEQEL Fragment has 43 clashes (null) has 43 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 43 residues other bump:2.97946 Ang V34.CG1 and V41.CG1 other bump:2.88234 Ang K35.N and V41.CG1 other bump:2.33425 Ang R10.NH2 and K35.NZ other bump:2.75278 Ang R10.NE and K35.NZ other bump:2.46903 Ang R10.CZ and K35.NZ other bump:3.08942 Ang R10.CZ and K35.CD other bump:2.95333 Ang R10.CG and K35.CG other bump:2.89546 Ang E32.CG and V34.CG2 other bump:2.95631 Ang E32.CD and V34.CG2 other bump:2.52883 Ang E32.OE1 and V34.CG2 other bump:2.86069 Ang V12.CG1 and E33.OE2 other bump:2.61053 Ang V12.CA and E33.OE1 other bump:2.12323 Ang V12.CB and E33.OE1 other bump:1.46015 Ang V12.CG1 and E33.OE1 other bump:2.53367 Ang V12.CG2 and E33.OE1 other bump:1.97801 Ang V12.CG1 and E33.CD other bump:2.64474 Ang V12.CG1 and E33.CG other bump:2.71105 Ang V12.CG1 and E33.CB other bump:1.97712 Ang A19.CA and K29.NZ other bump:2.04116 Ang A19.C and K29.NZ other bump:1.21907 Ang L18.O and K29.NZ other bump:1.90229 Ang L18.C and K29.NZ other bump:2.2055 Ang A19.N and K29.NZ other bump:2.78468 Ang I22.CB and K29.CE other bump:1.88544 Ang A19.CA and K29.CE other bump:1.93764 Ang A19.O and K29.CE other bump:2.1214 Ang A19.C and K29.CE other bump:2.39855 Ang A19.CA and K29.CD other bump:3.07583 Ang A19.CB and K29.CD other bump:3.22948 Ang A19.CA and K29.CG other bump:2.40177 Ang N4.CG and K28.CD other bump:2.4606 Ang N4.ND2 and K28.CD other bump:2.51844 Ang N4.OD1 and K28.CD other bump:2.58373 Ang N4.OD1 and K28.CB other bump:2.74316 Ang K25.CB and N27.ND2 other bump:3.03038 Ang I22.CG2 and N27.CG other bump:2.24775 Ang I22.CG2 and N27.CB other bump:2.72754 Ang I5.CD1 and I22.CD1 other bump:3.0841 Ang I7.CD1 and L18.CB other bump:2.37256 Ang N9.CG and T11.OG1 other bump:1.43799 Ang N9.OD1 and T11.OG1 other bump:2.57783 Ang N9.OD1 and T11.CB other bump:2.93639 Ang I5.CD1 and I7.CG2 T0191 86 :LDGVDIIINATPIGMYPNIDVE 1fmcA 86 :LGKVDILVNNAGGGGPKPFDMP Fragment has 16 clashes (null) has 16 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 24 residues other bump:2.34456 Ang N19.O and V22.CG2 neighbor-bump: 2.55885 Ang G15.O and M16.CG neighbor-bump: 2.03735 Ang G15.O and M16.CB neighbor-bump: 2.51066 Ang G15.C and M16.CB neighbor-bump: 2.44956 Ang P13.C and I14.CG2 neighbor-bump: 1.51342 Ang P13.O and I14.CG2 neighbor-bump: 2.20267 Ang T12.O and P13.CD neighbor-bump: 2.49281 Ang T12.N and P13.CD other bump:1.94137 Ang A11.O and P13.CD other bump:2.4874 Ang A11.C and P13.CD neighbor-bump: 1.87871 Ang T12.CA and P13.CD neighbor-bump: 1.3343 Ang T12.C and P13.CD other bump:2.07084 Ang A11.O and P13.CG other bump:2.9735 Ang A11.C and P13.CG neighbor-bump: 2.35092 Ang T12.C and P13.CG self-bump: 1.36654 Ang D3.CA and D3.CB T0191 108 :PIVKAEKLREDMVVMDLIYN 1fmcA 128 :LVAPEMEKNGGGVILTITSM Fragment has 15 clashes (null) has 15 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 22 residues neighbor-bump: 2.0331 Ang I19.O and Y20.CD1 neighbor-bump: 2.69062 Ang I19.C and Y20.CD1 neighbor-bump: 2.32221 Ang I19.CB and Y20.N neighbor-bump: 2.45307 Ang I19.CG1 and Y20.N other bump:2.74572 Ang E7.CG and M13.CE other bump:2.51494 Ang E7.CB and M13.SD other bump:2.40261 Ang E7.CG and M13.SD other bump:2.8974 Ang E7.CB and M13.CG other bump:2.9614 Ang E7.CG and M13.CG other bump:2.77059 Ang E7.CB and M13.CB other bump:2.53415 Ang E7.CG and M13.CB other bump:2.83654 Ang E7.CD and M13.CB other bump:2.553 Ang E7.OE1 and M13.CB other bump:2.41927 Ang E7.CD and R10.NH2 other bump:2.02177 Ang E7.OE2 and R10.NH2 T0191 139 :KVNAKTINGLGMLIYQGAVAF 1fmcA 148 :AAENKNINMTSYASSKAAASH Fragment has 14 clashes (null) has 14 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 23 residues other bump:3.28262 Ang V3.CG1 and G18.CA other bump:2.6718 Ang V3.CG2 and Q17.C other bump:2.5619 Ang V3.CG2 and Q17.CB other bump:3.16389 Ang V3.CG2 and Q17.CA other bump:2.12506 Ang K2.C and L14.CD1 other bump:1.03142 Ang K2.O and L14.CD1 other bump:2.55656 Ang K2.O and L14.CG other bump:1.44407 Ang K2.CD and M13.CE other bump:2.80087 Ang K2.CG and M13.CE other bump:1.71054 Ang K2.NZ and M13.CE other bump:1.61265 Ang K2.CE and M13.CE other bump:2.55012 Ang K2.CD and M13.SD other bump:1.6109 Ang K2.NZ and M13.SD other bump:2.52892 Ang K2.CE and M13.SD Number of specific fragments= 7 total=1110 Number of alignments=213 # Reading fragments from alignment file # T0191 read from T0191-1fmcA-2track-protein-STR-local-adpstyle1.pw.a2m.gz # 1fmcA read from T0191-1fmcA-2track-protein-STR-local-adpstyle1.pw.a2m.gz # found chain 1fmcA in template set T0191 18 :IGRVKDKNIVIYGAG 1fmcA 6 :NLRLDGKCAIITGAG Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 17 residues other bump:2.64343 Ang R4.NE and K6.CE T0191 33 :GAARAVAFELAK 1fmcA 22 :GIGKEIAITFAT Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:3.07616 Ang R5.CG and F9.CZ other bump:2.16023 Ang R5.NH1 and F9.CE1 T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGLDVD 1fmcA 35 :GASVVVSDINADAANHVVDEIQQLGGQAFACRCDITSEQEL Fragment has 43 clashes (null) has 43 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 43 residues other bump:2.97946 Ang V34.CG1 and V41.CG1 other bump:2.88234 Ang K35.N and V41.CG1 other bump:2.33425 Ang R10.NH2 and K35.NZ other bump:2.75278 Ang R10.NE and K35.NZ other bump:2.46903 Ang R10.CZ and K35.NZ other bump:3.08942 Ang R10.CZ and K35.CD other bump:2.95333 Ang R10.CG and K35.CG other bump:2.89546 Ang E32.CG and V34.CG2 other bump:2.95631 Ang E32.CD and V34.CG2 other bump:2.52883 Ang E32.OE1 and V34.CG2 other bump:2.86069 Ang V12.CG1 and E33.OE2 other bump:2.61053 Ang V12.CA and E33.OE1 other bump:2.12323 Ang V12.CB and E33.OE1 other bump:1.46015 Ang V12.CG1 and E33.OE1 other bump:2.53367 Ang V12.CG2 and E33.OE1 other bump:1.97801 Ang V12.CG1 and E33.CD other bump:2.64474 Ang V12.CG1 and E33.CG other bump:2.71105 Ang V12.CG1 and E33.CB other bump:1.97712 Ang A19.CA and K29.NZ other bump:2.04116 Ang A19.C and K29.NZ other bump:1.21907 Ang L18.O and K29.NZ other bump:1.90229 Ang L18.C and K29.NZ other bump:2.2055 Ang A19.N and K29.NZ other bump:2.78468 Ang I22.CB and K29.CE other bump:1.88544 Ang A19.CA and K29.CE other bump:1.93764 Ang A19.O and K29.CE other bump:2.1214 Ang A19.C and K29.CE other bump:2.39855 Ang A19.CA and K29.CD other bump:3.07583 Ang A19.CB and K29.CD other bump:3.22948 Ang A19.CA and K29.CG other bump:2.40177 Ang N4.CG and K28.CD other bump:2.4606 Ang N4.ND2 and K28.CD other bump:2.51844 Ang N4.OD1 and K28.CD other bump:2.58373 Ang N4.OD1 and K28.CB other bump:2.74316 Ang K25.CB and N27.ND2 other bump:3.03038 Ang I22.CG2 and N27.CG other bump:2.24775 Ang I22.CG2 and N27.CB other bump:2.72754 Ang I5.CD1 and I22.CD1 other bump:3.0841 Ang I7.CD1 and L18.CB other bump:2.37256 Ang N9.CG and T11.OG1 other bump:1.43799 Ang N9.OD1 and T11.OG1 other bump:2.57783 Ang N9.OD1 and T11.CB other bump:2.93639 Ang I5.CD1 and I7.CG2 T0191 86 :LDGVDIIINATPIGMYPNIDVEP 1fmcA 86 :LGKVDILVNNAGGGGPKPFDMPM Fragment has 16 clashes (null) has 16 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 25 residues other bump:2.34456 Ang N19.O and V22.CG2 neighbor-bump: 2.55885 Ang G15.O and M16.CG neighbor-bump: 2.03735 Ang G15.O and M16.CB neighbor-bump: 2.51066 Ang G15.C and M16.CB neighbor-bump: 2.44956 Ang P13.C and I14.CG2 neighbor-bump: 1.51342 Ang P13.O and I14.CG2 neighbor-bump: 2.20267 Ang T12.O and P13.CD neighbor-bump: 2.49281 Ang T12.N and P13.CD other bump:1.94137 Ang A11.O and P13.CD other bump:2.4874 Ang A11.C and P13.CD neighbor-bump: 1.87871 Ang T12.CA and P13.CD neighbor-bump: 1.3343 Ang T12.C and P13.CD other bump:2.07084 Ang A11.O and P13.CG other bump:2.9735 Ang A11.C and P13.CG neighbor-bump: 2.35092 Ang T12.C and P13.CG self-bump: 1.36654 Ang D3.CA and D3.CB Number of specific fragments= 4 total=1114 Number of alignments=214 # Reading fragments from alignment file # T0191 read from T0191-1fmcA-2track-protein-STR-local-adpstyle5.pw.a2m.gz # 1fmcA read from T0191-1fmcA-2track-protein-STR-local-adpstyle5.pw.a2m.gz # found chain 1fmcA in template set T0191 18 :IGRVKDKNIVIYGAG 1fmcA 6 :NLRLDGKCAIITGAG Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 17 residues other bump:2.64343 Ang R4.NE and K6.CE T0191 33 :GAARAVAFELAK 1fmcA 22 :GIGKEIAITFAT Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:3.07616 Ang R5.CG and F9.CZ other bump:2.16023 Ang R5.NH1 and F9.CE1 T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGLDVD 1fmcA 35 :GASVVVSDINADAANHVVDEIQQLGGQAFACRCDITSEQEL Fragment has 43 clashes (null) has 43 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 43 residues other bump:2.97946 Ang V34.CG1 and V41.CG1 other bump:2.88234 Ang K35.N and V41.CG1 other bump:2.33425 Ang R10.NH2 and K35.NZ other bump:2.75278 Ang R10.NE and K35.NZ other bump:2.46903 Ang R10.CZ and K35.NZ other bump:3.08942 Ang R10.CZ and K35.CD other bump:2.95333 Ang R10.CG and K35.CG other bump:2.89546 Ang E32.CG and V34.CG2 other bump:2.95631 Ang E32.CD and V34.CG2 other bump:2.52883 Ang E32.OE1 and V34.CG2 other bump:2.86069 Ang V12.CG1 and E33.OE2 other bump:2.61053 Ang V12.CA and E33.OE1 other bump:2.12323 Ang V12.CB and E33.OE1 other bump:1.46015 Ang V12.CG1 and E33.OE1 other bump:2.53367 Ang V12.CG2 and E33.OE1 other bump:1.97801 Ang V12.CG1 and E33.CD other bump:2.64474 Ang V12.CG1 and E33.CG other bump:2.71105 Ang V12.CG1 and E33.CB other bump:1.97712 Ang A19.CA and K29.NZ other bump:2.04116 Ang A19.C and K29.NZ other bump:1.21907 Ang L18.O and K29.NZ other bump:1.90229 Ang L18.C and K29.NZ other bump:2.2055 Ang A19.N and K29.NZ other bump:2.78468 Ang I22.CB and K29.CE other bump:1.88544 Ang A19.CA and K29.CE other bump:1.93764 Ang A19.O and K29.CE other bump:2.1214 Ang A19.C and K29.CE other bump:2.39855 Ang A19.CA and K29.CD other bump:3.07583 Ang A19.CB and K29.CD other bump:3.22948 Ang A19.CA and K29.CG other bump:2.40177 Ang N4.CG and K28.CD other bump:2.4606 Ang N4.ND2 and K28.CD other bump:2.51844 Ang N4.OD1 and K28.CD other bump:2.58373 Ang N4.OD1 and K28.CB other bump:2.74316 Ang K25.CB and N27.ND2 other bump:3.03038 Ang I22.CG2 and N27.CG other bump:2.24775 Ang I22.CG2 and N27.CB other bump:2.72754 Ang I5.CD1 and I22.CD1 other bump:3.0841 Ang I7.CD1 and L18.CB other bump:2.37256 Ang N9.CG and T11.OG1 other bump:1.43799 Ang N9.OD1 and T11.OG1 other bump:2.57783 Ang N9.OD1 and T11.CB other bump:2.93639 Ang I5.CD1 and I7.CG2 T0191 86 :LDGVDIIINATPIGMYPNIDVEP 1fmcA 86 :LGKVDILVNNAGGGGPKPFDMPM Fragment has 16 clashes (null) has 16 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 25 residues other bump:2.34456 Ang N19.O and V22.CG2 neighbor-bump: 2.55885 Ang G15.O and M16.CG neighbor-bump: 2.03735 Ang G15.O and M16.CB neighbor-bump: 2.51066 Ang G15.C and M16.CB neighbor-bump: 2.44956 Ang P13.C and I14.CG2 neighbor-bump: 1.51342 Ang P13.O and I14.CG2 neighbor-bump: 2.20267 Ang T12.O and P13.CD neighbor-bump: 2.49281 Ang T12.N and P13.CD other bump:1.94137 Ang A11.O and P13.CD other bump:2.4874 Ang A11.C and P13.CD neighbor-bump: 1.87871 Ang T12.CA and P13.CD neighbor-bump: 1.3343 Ang T12.C and P13.CD other bump:2.07084 Ang A11.O and P13.CG other bump:2.9735 Ang A11.C and P13.CG neighbor-bump: 2.35092 Ang T12.C and P13.CG self-bump: 1.36654 Ang D3.CA and D3.CB Number of specific fragments= 4 total=1118 Number of alignments=215 # Reading fragments from alignment file # T0191 read from T0191-1fmcA-local-adpstyle1.pw.a2m.gz # 1fmcA read from T0191-1fmcA-local-adpstyle1.pw.a2m.gz # found chain 1fmcA in template set T0191 18 :IGRVKDKNIVIYGAG 1fmcA 6 :NLRLDGKCAIITGAG Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 17 residues other bump:2.64343 Ang R4.NE and K6.CE T0191 33 :GAARAVAFELAK 1fmcA 22 :GIGKEIAITFAT Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:3.07616 Ang R5.CG and F9.CZ other bump:2.16023 Ang R5.NH1 and F9.CE1 T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGLDVD 1fmcA 35 :GASVVVSDINADAANHVVDEIQQLGGQAFACRCDITSEQEL Fragment has 43 clashes (null) has 43 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 43 residues other bump:2.97946 Ang V34.CG1 and V41.CG1 other bump:2.88234 Ang K35.N and V41.CG1 other bump:2.33425 Ang R10.NH2 and K35.NZ other bump:2.75278 Ang R10.NE and K35.NZ other bump:2.46903 Ang R10.CZ and K35.NZ other bump:3.08942 Ang R10.CZ and K35.CD other bump:2.95333 Ang R10.CG and K35.CG other bump:2.89546 Ang E32.CG and V34.CG2 other bump:2.95631 Ang E32.CD and V34.CG2 other bump:2.52883 Ang E32.OE1 and V34.CG2 other bump:2.86069 Ang V12.CG1 and E33.OE2 other bump:2.61053 Ang V12.CA and E33.OE1 other bump:2.12323 Ang V12.CB and E33.OE1 other bump:1.46015 Ang V12.CG1 and E33.OE1 other bump:2.53367 Ang V12.CG2 and E33.OE1 other bump:1.97801 Ang V12.CG1 and E33.CD other bump:2.64474 Ang V12.CG1 and E33.CG other bump:2.71105 Ang V12.CG1 and E33.CB other bump:1.97712 Ang A19.CA and K29.NZ other bump:2.04116 Ang A19.C and K29.NZ other bump:1.21907 Ang L18.O and K29.NZ other bump:1.90229 Ang L18.C and K29.NZ other bump:2.2055 Ang A19.N and K29.NZ other bump:2.78468 Ang I22.CB and K29.CE other bump:1.88544 Ang A19.CA and K29.CE other bump:1.93764 Ang A19.O and K29.CE other bump:2.1214 Ang A19.C and K29.CE other bump:2.39855 Ang A19.CA and K29.CD other bump:3.07583 Ang A19.CB and K29.CD other bump:3.22948 Ang A19.CA and K29.CG other bump:2.40177 Ang N4.CG and K28.CD other bump:2.4606 Ang N4.ND2 and K28.CD other bump:2.51844 Ang N4.OD1 and K28.CD other bump:2.58373 Ang N4.OD1 and K28.CB other bump:2.74316 Ang K25.CB and N27.ND2 other bump:3.03038 Ang I22.CG2 and N27.CG other bump:2.24775 Ang I22.CG2 and N27.CB other bump:2.72754 Ang I5.CD1 and I22.CD1 other bump:3.0841 Ang I7.CD1 and L18.CB other bump:2.37256 Ang N9.CG and T11.OG1 other bump:1.43799 Ang N9.OD1 and T11.OG1 other bump:2.57783 Ang N9.OD1 and T11.CB other bump:2.93639 Ang I5.CD1 and I7.CG2 T0191 86 :LDGVDIIINATPIGMYPNIDVEP 1fmcA 86 :LGKVDILVNNAGGGGPKPFDMPM Fragment has 16 clashes (null) has 16 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 25 residues other bump:2.34456 Ang N19.O and V22.CG2 neighbor-bump: 2.55885 Ang G15.O and M16.CG neighbor-bump: 2.03735 Ang G15.O and M16.CB neighbor-bump: 2.51066 Ang G15.C and M16.CB neighbor-bump: 2.44956 Ang P13.C and I14.CG2 neighbor-bump: 1.51342 Ang P13.O and I14.CG2 neighbor-bump: 2.20267 Ang T12.O and P13.CD neighbor-bump: 2.49281 Ang T12.N and P13.CD other bump:1.94137 Ang A11.O and P13.CD other bump:2.4874 Ang A11.C and P13.CD neighbor-bump: 1.87871 Ang T12.CA and P13.CD neighbor-bump: 1.3343 Ang T12.C and P13.CD other bump:2.07084 Ang A11.O and P13.CG other bump:2.9735 Ang A11.C and P13.CG neighbor-bump: 2.35092 Ang T12.C and P13.CG self-bump: 1.36654 Ang D3.CA and D3.CB Number of specific fragments= 4 total=1122 Number of alignments=216 # Reading fragments from alignment file # T0191 read from T0191-1fmcA-local-adpstyle5.pw.a2m.gz # 1fmcA read from T0191-1fmcA-local-adpstyle5.pw.a2m.gz # found chain 1fmcA in template set T0191 18 :IGRVKDKNIVIYGAG 1fmcA 6 :NLRLDGKCAIITGAG Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 17 residues other bump:2.64343 Ang R4.NE and K6.CE T0191 33 :GAARAVAFELAK 1fmcA 22 :GIGKEIAITFAT Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:3.07616 Ang R5.CG and F9.CZ other bump:2.16023 Ang R5.NH1 and F9.CE1 T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGLDVD 1fmcA 35 :GASVVVSDINADAANHVVDEIQQLGGQAFACRCDITSEQEL Fragment has 43 clashes (null) has 43 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 43 residues other bump:2.97946 Ang V34.CG1 and V41.CG1 other bump:2.88234 Ang K35.N and V41.CG1 other bump:2.33425 Ang R10.NH2 and K35.NZ other bump:2.75278 Ang R10.NE and K35.NZ other bump:2.46903 Ang R10.CZ and K35.NZ other bump:3.08942 Ang R10.CZ and K35.CD other bump:2.95333 Ang R10.CG and K35.CG other bump:2.89546 Ang E32.CG and V34.CG2 other bump:2.95631 Ang E32.CD and V34.CG2 other bump:2.52883 Ang E32.OE1 and V34.CG2 other bump:2.86069 Ang V12.CG1 and E33.OE2 other bump:2.61053 Ang V12.CA and E33.OE1 other bump:2.12323 Ang V12.CB and E33.OE1 other bump:1.46015 Ang V12.CG1 and E33.OE1 other bump:2.53367 Ang V12.CG2 and E33.OE1 other bump:1.97801 Ang V12.CG1 and E33.CD other bump:2.64474 Ang V12.CG1 and E33.CG other bump:2.71105 Ang V12.CG1 and E33.CB other bump:1.97712 Ang A19.CA and K29.NZ other bump:2.04116 Ang A19.C and K29.NZ other bump:1.21907 Ang L18.O and K29.NZ other bump:1.90229 Ang L18.C and K29.NZ other bump:2.2055 Ang A19.N and K29.NZ other bump:2.78468 Ang I22.CB and K29.CE other bump:1.88544 Ang A19.CA and K29.CE other bump:1.93764 Ang A19.O and K29.CE other bump:2.1214 Ang A19.C and K29.CE other bump:2.39855 Ang A19.CA and K29.CD other bump:3.07583 Ang A19.CB and K29.CD other bump:3.22948 Ang A19.CA and K29.CG other bump:2.40177 Ang N4.CG and K28.CD other bump:2.4606 Ang N4.ND2 and K28.CD other bump:2.51844 Ang N4.OD1 and K28.CD other bump:2.58373 Ang N4.OD1 and K28.CB other bump:2.74316 Ang K25.CB and N27.ND2 other bump:3.03038 Ang I22.CG2 and N27.CG other bump:2.24775 Ang I22.CG2 and N27.CB other bump:2.72754 Ang I5.CD1 and I22.CD1 other bump:3.0841 Ang I7.CD1 and L18.CB other bump:2.37256 Ang N9.CG and T11.OG1 other bump:1.43799 Ang N9.OD1 and T11.OG1 other bump:2.57783 Ang N9.OD1 and T11.CB other bump:2.93639 Ang I5.CD1 and I7.CG2 T0191 86 :LDGVDIIINATPIGMYPNIDVEPI 1fmcA 86 :LGKVDILVNNAGGGGPKPFDMPMA Fragment has 17 clashes (null) has 17 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 26 residues self-bump: 1.3868 Ang P24.N and P24.CD other bump:2.34456 Ang N19.O and V22.CG2 neighbor-bump: 2.55885 Ang G15.O and M16.CG neighbor-bump: 2.03735 Ang G15.O and M16.CB neighbor-bump: 2.51066 Ang G15.C and M16.CB neighbor-bump: 2.44956 Ang P13.C and I14.CG2 neighbor-bump: 1.51342 Ang P13.O and I14.CG2 neighbor-bump: 2.20267 Ang T12.O and P13.CD neighbor-bump: 2.49281 Ang T12.N and P13.CD other bump:1.94137 Ang A11.O and P13.CD other bump:2.4874 Ang A11.C and P13.CD neighbor-bump: 1.87871 Ang T12.CA and P13.CD neighbor-bump: 1.3343 Ang T12.C and P13.CD other bump:2.07084 Ang A11.O and P13.CG other bump:2.9735 Ang A11.C and P13.CG neighbor-bump: 2.35092 Ang T12.C and P13.CG self-bump: 1.36654 Ang D3.CA and D3.CB T0191 112 :AE 1fmcA 110 :DF Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues Number of specific fragments= 5 total=1127 Number of alignments=217 # Reading fragments from alignment file # T0191 read from T0191-1fmcA-simpleSW-adpstyle1.pw.a2m.gz # 1fmcA read from T0191-1fmcA-simpleSW-adpstyle1.pw.a2m.gz # found chain 1fmcA in template set T0191 20 :RVKDKNIVIYGAG 1fmcA 8 :RLDGKCAIITGAG Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues other bump:2.64343 Ang R2.NE and K4.CE Number of specific fragments= 1 total=1128 # Reading fragments from alignment file # T0191 read from T0191-1fmcA-simpleSW-adpstyle5.pw.a2m.gz # 1fmcA read from T0191-1fmcA-simpleSW-adpstyle5.pw.a2m.gz # found chain 1fmcA in template set T0191 23 :DKNIVIYGAG 1fmcA 11 :GKCAIITGAG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 12 residues T0191 33 :GAARAVAFELAKDN 1fmcA 22 :GIGKEIAITFATAG Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 16 residues other bump:2.71298 Ang L11.CA and D14.OD2 other bump:1.4938 Ang L11.O and D14.OD2 other bump:2.28259 Ang L11.C and D14.OD2 other bump:3.071 Ang L11.CA and D14.CG other bump:3.13406 Ang L11.C and D14.CG other bump:3.07616 Ang R5.CG and F9.CZ other bump:2.16023 Ang R5.NH1 and F9.CE1 T0191 47 :NIIIANRTVEKAEALAKEIA 1fmcA 37 :SVVVSDINADAANHVVDEIQ Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 22 residues other bump:2.72753 Ang I3.CD1 and I20.CD1 other bump:3.08411 Ang I5.CD1 and L16.CB other bump:2.37256 Ang N7.CG and T9.OG1 other bump:1.43799 Ang N7.OD1 and T9.OG1 other bump:2.57783 Ang N7.OD1 and T9.CB other bump:2.93639 Ang I3.CD1 and I5.CG2 Number of specific fragments= 3 total=1131 Number of alignments=218 # Reading fragments from alignment file # T0191 read from T0191-1fmcA-vit-adpstyle1.pw.a2m.gz # 1fmcA read from T0191-1fmcA-vit-adpstyle1.pw.a2m.gz # found chain 1fmcA in template set T0191 18 :IGRVKDKNIVIYGAG 1fmcA 6 :NLRLDGKCAIITGAG Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 17 residues other bump:2.64343 Ang R4.NE and K6.CE T0191 33 :GAARAVAFELAK 1fmcA 22 :GIGKEIAITFAT Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:3.07616 Ang R5.CG and F9.CZ other bump:2.16023 Ang R5.NH1 and F9.CE1 T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGLDVD 1fmcA 35 :GASVVVSDINADAANHVVDEIQQLGGQAFACRCDITSEQEL Fragment has 43 clashes (null) has 43 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 43 residues other bump:2.97946 Ang V34.CG1 and V41.CG1 other bump:2.88234 Ang K35.N and V41.CG1 other bump:2.33425 Ang R10.NH2 and K35.NZ other bump:2.75278 Ang R10.NE and K35.NZ other bump:2.46903 Ang R10.CZ and K35.NZ other bump:3.08942 Ang R10.CZ and K35.CD other bump:2.95333 Ang R10.CG and K35.CG other bump:2.89546 Ang E32.CG and V34.CG2 other bump:2.95631 Ang E32.CD and V34.CG2 other bump:2.52883 Ang E32.OE1 and V34.CG2 other bump:2.86069 Ang V12.CG1 and E33.OE2 other bump:2.61053 Ang V12.CA and E33.OE1 other bump:2.12323 Ang V12.CB and E33.OE1 other bump:1.46015 Ang V12.CG1 and E33.OE1 other bump:2.53367 Ang V12.CG2 and E33.OE1 other bump:1.97801 Ang V12.CG1 and E33.CD other bump:2.64474 Ang V12.CG1 and E33.CG other bump:2.71105 Ang V12.CG1 and E33.CB other bump:1.97712 Ang A19.CA and K29.NZ other bump:2.04116 Ang A19.C and K29.NZ other bump:1.21907 Ang L18.O and K29.NZ other bump:1.90229 Ang L18.C and K29.NZ other bump:2.2055 Ang A19.N and K29.NZ other bump:2.78468 Ang I22.CB and K29.CE other bump:1.88544 Ang A19.CA and K29.CE other bump:1.93764 Ang A19.O and K29.CE other bump:2.1214 Ang A19.C and K29.CE other bump:2.39855 Ang A19.CA and K29.CD other bump:3.07583 Ang A19.CB and K29.CD other bump:3.22948 Ang A19.CA and K29.CG other bump:2.40177 Ang N4.CG and K28.CD other bump:2.4606 Ang N4.ND2 and K28.CD other bump:2.51844 Ang N4.OD1 and K28.CD other bump:2.58373 Ang N4.OD1 and K28.CB other bump:2.74316 Ang K25.CB and N27.ND2 other bump:3.03038 Ang I22.CG2 and N27.CG other bump:2.24775 Ang I22.CG2 and N27.CB other bump:2.72754 Ang I5.CD1 and I22.CD1 other bump:3.0841 Ang I7.CD1 and L18.CB other bump:2.37256 Ang N9.CG and T11.OG1 other bump:1.43799 Ang N9.OD1 and T11.OG1 other bump:2.57783 Ang N9.OD1 and T11.CB other bump:2.93639 Ang I5.CD1 and I7.CG2 T0191 86 :LDGVDIIINATPIGMYPNIDVEP 1fmcA 86 :LGKVDILVNNAGGGGPKPFDMPM Fragment has 16 clashes (null) has 16 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 25 residues other bump:2.34456 Ang N19.O and V22.CG2 neighbor-bump: 2.55885 Ang G15.O and M16.CG neighbor-bump: 2.03735 Ang G15.O and M16.CB neighbor-bump: 2.51066 Ang G15.C and M16.CB neighbor-bump: 2.44956 Ang P13.C and I14.CG2 neighbor-bump: 1.51342 Ang P13.O and I14.CG2 neighbor-bump: 2.20267 Ang T12.O and P13.CD neighbor-bump: 2.49281 Ang T12.N and P13.CD other bump:1.94137 Ang A11.O and P13.CD other bump:2.4874 Ang A11.C and P13.CD neighbor-bump: 1.87871 Ang T12.CA and P13.CD neighbor-bump: 1.3343 Ang T12.C and P13.CD other bump:2.07084 Ang A11.O and P13.CG other bump:2.9735 Ang A11.C and P13.CG neighbor-bump: 2.35092 Ang T12.C and P13.CG self-bump: 1.36654 Ang D3.CA and D3.CB Number of specific fragments= 4 total=1135 Number of alignments=219 # Reading fragments from alignment file # T0191 read from T0191-1fmcA-vit-adpstyle5.pw.a2m.gz # 1fmcA read from T0191-1fmcA-vit-adpstyle5.pw.a2m.gz # found chain 1fmcA in template set T0191 18 :IGRVKDKNIVIYGAG 1fmcA 6 :NLRLDGKCAIITGAG Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 17 residues other bump:2.64343 Ang R4.NE and K6.CE T0191 33 :GAARAVAFELAK 1fmcA 22 :GIGKEIAITFAT Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:3.07616 Ang R5.CG and F9.CZ other bump:2.16023 Ang R5.NH1 and F9.CE1 T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGLDVD 1fmcA 35 :GASVVVSDINADAANHVVDEIQQLGGQAFACRCDITSEQEL Fragment has 43 clashes (null) has 43 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 43 residues other bump:2.97946 Ang V34.CG1 and V41.CG1 other bump:2.88234 Ang K35.N and V41.CG1 other bump:2.33425 Ang R10.NH2 and K35.NZ other bump:2.75278 Ang R10.NE and K35.NZ other bump:2.46903 Ang R10.CZ and K35.NZ other bump:3.08942 Ang R10.CZ and K35.CD other bump:2.95333 Ang R10.CG and K35.CG other bump:2.89546 Ang E32.CG and V34.CG2 other bump:2.95631 Ang E32.CD and V34.CG2 other bump:2.52883 Ang E32.OE1 and V34.CG2 other bump:2.86069 Ang V12.CG1 and E33.OE2 other bump:2.61053 Ang V12.CA and E33.OE1 other bump:2.12323 Ang V12.CB and E33.OE1 other bump:1.46015 Ang V12.CG1 and E33.OE1 other bump:2.53367 Ang V12.CG2 and E33.OE1 other bump:1.97801 Ang V12.CG1 and E33.CD other bump:2.64474 Ang V12.CG1 and E33.CG other bump:2.71105 Ang V12.CG1 and E33.CB other bump:1.97712 Ang A19.CA and K29.NZ other bump:2.04116 Ang A19.C and K29.NZ other bump:1.21907 Ang L18.O and K29.NZ other bump:1.90229 Ang L18.C and K29.NZ other bump:2.2055 Ang A19.N and K29.NZ other bump:2.78468 Ang I22.CB and K29.CE other bump:1.88544 Ang A19.CA and K29.CE other bump:1.93764 Ang A19.O and K29.CE other bump:2.1214 Ang A19.C and K29.CE other bump:2.39855 Ang A19.CA and K29.CD other bump:3.07583 Ang A19.CB and K29.CD other bump:3.22948 Ang A19.CA and K29.CG other bump:2.40177 Ang N4.CG and K28.CD other bump:2.4606 Ang N4.ND2 and K28.CD other bump:2.51844 Ang N4.OD1 and K28.CD other bump:2.58373 Ang N4.OD1 and K28.CB other bump:2.74316 Ang K25.CB and N27.ND2 other bump:3.03038 Ang I22.CG2 and N27.CG other bump:2.24775 Ang I22.CG2 and N27.CB other bump:2.72754 Ang I5.CD1 and I22.CD1 other bump:3.0841 Ang I7.CD1 and L18.CB other bump:2.37256 Ang N9.CG and T11.OG1 other bump:1.43799 Ang N9.OD1 and T11.OG1 other bump:2.57783 Ang N9.OD1 and T11.CB other bump:2.93639 Ang I5.CD1 and I7.CG2 T0191 86 :LDGVDIIINATPIGMYPNIDVEPI 1fmcA 86 :LGKVDILVNNAGGGGPKPFDMPMA Fragment has 17 clashes (null) has 17 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 26 residues self-bump: 1.3868 Ang P24.N and P24.CD other bump:2.34456 Ang N19.O and V22.CG2 neighbor-bump: 2.55885 Ang G15.O and M16.CG neighbor-bump: 2.03735 Ang G15.O and M16.CB neighbor-bump: 2.51066 Ang G15.C and M16.CB neighbor-bump: 2.44956 Ang P13.C and I14.CG2 neighbor-bump: 1.51342 Ang P13.O and I14.CG2 neighbor-bump: 2.20267 Ang T12.O and P13.CD neighbor-bump: 2.49281 Ang T12.N and P13.CD other bump:1.94137 Ang A11.O and P13.CD other bump:2.4874 Ang A11.C and P13.CD neighbor-bump: 1.87871 Ang T12.CA and P13.CD neighbor-bump: 1.3343 Ang T12.C and P13.CD other bump:2.07084 Ang A11.O and P13.CG other bump:2.9735 Ang A11.C and P13.CG neighbor-bump: 2.35092 Ang T12.C and P13.CG self-bump: 1.36654 Ang D3.CA and D3.CB T0191 112 :AE 1fmcA 110 :DF Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues Number of specific fragments= 5 total=1140 Number of alignments=220 # command:# Prefix for input files set to 1gegA/ # command:# reading script from file read-alignments.under # Reading fragments from alignment file # T0191 read from 1gegA-T0191-local-adpstyle1.pw.a2m.gz # 1gegA read from 1gegA-T0191-local-adpstyle1.pw.a2m.gz # found chain 1gegA in template set T0191 24 :KNIVIYGA 1gegA 3 :KVALVTGA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 10 residues T0191 32 :GGAARAVAFELAKDN 1gegA 12 :QGIGKAIALRLVKDG Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 17 residues other bump:2.11329 Ang G1.O and R6.NH2 other bump:3.02762 Ang G1.C and R6.NH2 other bump:2.70773 Ang G2.CA and R6.NH2 other bump:2.80089 Ang G2.CA and R6.CZ T0191 47 :NIIIANRTVEKAEALAKEIAE 1gegA 28 :AVAIADYNDATAKAVASEINQ Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 23 residues other bump:1.26249 Ang N7.OD1 and T9.OG1 other bump:2.12886 Ang N7.CG and T9.OG1 other bump:2.40651 Ang N7.OD1 and T9.CB T0191 73 :FGEEVKFSGLDVD 1gegA 49 :AGGHAVAVKVDVS Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues T0191 87 :DGVDIIINATPIGMYPNID 1gegA 78 :GGFDVIVNNAGVAPSTPIE Fragment has 11 clashes (null) has 11 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 21 residues neighbor-bump: 1.99253 Ang Y16.C and P17.CD neighbor-bump: 2.49673 Ang Y16.C and P17.CG other bump:2.01595 Ang A10.O and P12.CD other bump:2.66032 Ang A10.C and P12.CD neighbor-bump: 2.00296 Ang T11.CA and P12.CD neighbor-bump: 1.32553 Ang T11.C and P12.CD neighbor-bump: 2.15168 Ang T11.O and P12.CD other bump:2.23158 Ang A10.O and P12.CG other bump:3.13336 Ang A10.C and P12.CG neighbor-bump: 2.20272 Ang T11.C and P12.CG neighbor-bump: 2.2263 Ang T11.O and P12.CG Number of specific fragments= 5 total=1145 Number of alignments=221 # Reading fragments from alignment file # T0191 read from 1gegA-T0191-local-adpstyle5.pw.a2m.gz # 1gegA read from 1gegA-T0191-local-adpstyle5.pw.a2m.gz # found chain 1gegA in template set T0191 24 :KNIVIYGA 1gegA 3 :KVALVTGA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 10 residues T0191 32 :GGAARAVAFELAKDN 1gegA 12 :QGIGKAIALRLVKDG Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 17 residues other bump:2.11329 Ang G1.O and R6.NH2 other bump:3.02762 Ang G1.C and R6.NH2 other bump:2.70773 Ang G2.CA and R6.NH2 other bump:2.80089 Ang G2.CA and R6.CZ T0191 47 :NIIIANRTVEKAEALAKEIAE 1gegA 28 :AVAIADYNDATAKAVASEINQ Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 23 residues other bump:1.26249 Ang N7.OD1 and T9.OG1 other bump:2.12886 Ang N7.CG and T9.OG1 other bump:2.40651 Ang N7.OD1 and T9.CB T0191 73 :FGEEVKFSGLDVD 1gegA 49 :AGGHAVAVKVDVS Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues T0191 87 :DGVDIIINATPIGMY 1gegA 78 :GGFDVIVNNAGVAPS Fragment has 9 clashes (null) has 9 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 17 residues other bump:2.01595 Ang A10.O and P12.CD other bump:2.66032 Ang A10.C and P12.CD neighbor-bump: 2.00296 Ang T11.CA and P12.CD neighbor-bump: 1.32553 Ang T11.C and P12.CD neighbor-bump: 2.15168 Ang T11.O and P12.CD other bump:2.23158 Ang A10.O and P12.CG other bump:3.13336 Ang A10.C and P12.CG neighbor-bump: 2.20272 Ang T11.C and P12.CG neighbor-bump: 2.2263 Ang T11.O and P12.CG Number of specific fragments= 5 total=1150 Number of alignments=222 # Reading fragments from alignment file # T0191 read from 1gegA-T0191-vit-adpstyle1.pw.a2m.gz # 1gegA read from 1gegA-T0191-vit-adpstyle1.pw.a2m.gz # found chain 1gegA in template set T0191 24 :KNIVIYGA 1gegA 3 :KVALVTGA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 10 residues T0191 32 :GGAARAVAFELAKDN 1gegA 12 :QGIGKAIALRLVKDG Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 17 residues other bump:2.11329 Ang G1.O and R6.NH2 other bump:3.02762 Ang G1.C and R6.NH2 other bump:2.70773 Ang G2.CA and R6.NH2 other bump:2.80089 Ang G2.CA and R6.CZ T0191 47 :NIIIANRTVEKAEALAKEIAE 1gegA 28 :AVAIADYNDATAKAVASEINQ Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 23 residues other bump:1.26249 Ang N7.OD1 and T9.OG1 other bump:2.12886 Ang N7.CG and T9.OG1 other bump:2.40651 Ang N7.OD1 and T9.CB T0191 73 :FGEEVKFSGLDVD 1gegA 49 :AGGHAVAVKVDVS Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues T0191 87 :DGVDIIINATPIGMYPNID 1gegA 78 :GGFDVIVNNAGVAPSTPIE Fragment has 11 clashes (null) has 11 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 21 residues neighbor-bump: 1.99253 Ang Y16.C and P17.CD neighbor-bump: 2.49673 Ang Y16.C and P17.CG other bump:2.01595 Ang A10.O and P12.CD other bump:2.66032 Ang A10.C and P12.CD neighbor-bump: 2.00296 Ang T11.CA and P12.CD neighbor-bump: 1.32553 Ang T11.C and P12.CD neighbor-bump: 2.15168 Ang T11.O and P12.CD other bump:2.23158 Ang A10.O and P12.CG other bump:3.13336 Ang A10.C and P12.CG neighbor-bump: 2.20272 Ang T11.C and P12.CG neighbor-bump: 2.2263 Ang T11.O and P12.CG Number of specific fragments= 5 total=1155 Number of alignments=223 # Reading fragments from alignment file # T0191 read from 1gegA-T0191-vit-adpstyle5.pw.a2m.gz # 1gegA read from 1gegA-T0191-vit-adpstyle5.pw.a2m.gz # found chain 1gegA in template set T0191 24 :KNIVIYGA 1gegA 3 :KVALVTGA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 10 residues T0191 32 :GGAARAVAFELAKDN 1gegA 12 :QGIGKAIALRLVKDG Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 17 residues other bump:2.11329 Ang G1.O and R6.NH2 other bump:3.02762 Ang G1.C and R6.NH2 other bump:2.70773 Ang G2.CA and R6.NH2 other bump:2.80089 Ang G2.CA and R6.CZ T0191 47 :NIIIANRTVEKAEALAKEIAE 1gegA 28 :AVAIADYNDATAKAVASEINQ Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 23 residues other bump:1.26249 Ang N7.OD1 and T9.OG1 other bump:2.12886 Ang N7.CG and T9.OG1 other bump:2.40651 Ang N7.OD1 and T9.CB T0191 73 :FGEEVKFSGLDVD 1gegA 49 :AGGHAVAVKVDVS Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues T0191 87 :DGVDIIINATPIGMY 1gegA 78 :GGFDVIVNNAGVAPS Fragment has 9 clashes (null) has 9 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 17 residues other bump:2.01595 Ang A10.O and P12.CD other bump:2.66032 Ang A10.C and P12.CD neighbor-bump: 2.00296 Ang T11.CA and P12.CD neighbor-bump: 1.32553 Ang T11.C and P12.CD neighbor-bump: 2.15168 Ang T11.O and P12.CD other bump:2.23158 Ang A10.O and P12.CG other bump:3.13336 Ang A10.C and P12.CG neighbor-bump: 2.20272 Ang T11.C and P12.CG neighbor-bump: 2.2263 Ang T11.O and P12.CG Number of specific fragments= 5 total=1160 Number of alignments=224 # Reading fragments from alignment file # T0191 read from T0191-1gegA-2track-protein-EBGHSTL-global-adpstyle1.pw.a2m.gz # 1gegA read from T0191-1gegA-2track-protein-EBGHSTL-global-adpstyle1.pw.a2m.gz # found chain 1gegA in template set T0191 24 :KNIVIYGAG 1gegA 3 :KVALVTGAG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues T0191 33 :GAARAVAFELAK 1gegA 13 :GIGKAIALRLVK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGLDVD 1gegA 26 :GFAVAIADYNDATAKAVASEINQAGGHAVAVKVDVSDRDQV Fragment has 32 clashes (null) has 32 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 43 residues other bump:2.61574 Ang V34.CG2 and V41.CG1 other bump:2.09426 Ang V12.CG1 and E33.OE2 other bump:2.9359 Ang V12.CG1 and E33.CD other bump:1.10458 Ang L18.O and K29.NZ other bump:2.92713 Ang I22.CG1 and K29.NZ other bump:2.43746 Ang A19.N and K29.NZ other bump:2.30579 Ang A19.CA and K29.NZ other bump:2.13947 Ang A19.C and K29.NZ other bump:1.97321 Ang L18.C and K29.NZ other bump:2.51833 Ang I22.CB and K29.CE other bump:2.97804 Ang I22.CG1 and K29.CE other bump:2.01908 Ang A19.CA and K29.CE other bump:1.64907 Ang A19.O and K29.CE other bump:1.91244 Ang A19.C and K29.CE other bump:3.07408 Ang L18.C and K29.CE other bump:3.23272 Ang I22.CG1 and K29.CD other bump:2.81068 Ang I22.CD1 and K29.CD other bump:2.93745 Ang A19.N and K29.CD other bump:2.03154 Ang A19.CA and K29.CD other bump:2.84717 Ang A19.C and K29.CD other bump:2.89385 Ang A19.CB and K29.CD other bump:2.80244 Ang A19.CA and K29.CG other bump:2.92437 Ang A19.CB and K29.CG other bump:2.87953 Ang N4.CG and K28.CD other bump:2.56843 Ang N4.ND2 and K28.CD other bump:2.69794 Ang N4.OD1 and K28.CB other bump:2.78354 Ang I22.CG2 and N27.ND2 other bump:2.83123 Ang I22.CG2 and N27.CG other bump:2.55965 Ang I22.CG2 and N27.CB other bump:2.12886 Ang N9.CG and T11.OG1 other bump:1.26249 Ang N9.OD1 and T11.OG1 other bump:2.40651 Ang N9.OD1 and T11.CB T0191 86 :LDGVDIIINATPIGMYPNIDVEPI 1gegA 77 :LGGFDVIVNNAGVAPSTPIESITP Fragment has 11 clashes (null) has 11 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 26 residues neighbor-bump: 1.99253 Ang Y17.C and P18.CD neighbor-bump: 2.49673 Ang Y17.C and P18.CG other bump:2.01595 Ang A11.O and P13.CD other bump:2.66032 Ang A11.C and P13.CD neighbor-bump: 2.00296 Ang T12.CA and P13.CD neighbor-bump: 1.32553 Ang T12.C and P13.CD neighbor-bump: 2.15168 Ang T12.O and P13.CD other bump:2.23158 Ang A11.O and P13.CG other bump:3.13336 Ang A11.C and P13.CG neighbor-bump: 2.20272 Ang T12.C and P13.CG neighbor-bump: 2.2263 Ang T12.O and P13.CG T0191 135 :KEAKKVNAKTINGLGMLIYQGAVAFK 1gegA 101 :EIVDKVYNINVKGVIWGIQAAVEAFK Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 27 residues other bump:2.94875 Ang N8.OD1 and I12.CD1 Number of specific fragments= 5 total=1165 Number of alignments=225 # Reading fragments from alignment file # T0191 read from T0191-1gegA-2track-protein-EBGHSTL-global-adpstyle5.pw.a2m.gz # 1gegA read from T0191-1gegA-2track-protein-EBGHSTL-global-adpstyle5.pw.a2m.gz # found chain 1gegA in template set T0191 24 :KNIVIYGAG 1gegA 3 :KVALVTGAG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues T0191 33 :GAARAVAFELAK 1gegA 13 :GIGKAIALRLVK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGLDVD 1gegA 26 :GFAVAIADYNDATAKAVASEINQAGGHAVAVKVDVSDRDQV Fragment has 32 clashes (null) has 32 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 43 residues other bump:2.61574 Ang V34.CG2 and V41.CG1 other bump:2.09426 Ang V12.CG1 and E33.OE2 other bump:2.9359 Ang V12.CG1 and E33.CD other bump:1.10458 Ang L18.O and K29.NZ other bump:2.92713 Ang I22.CG1 and K29.NZ other bump:2.43746 Ang A19.N and K29.NZ other bump:2.30579 Ang A19.CA and K29.NZ other bump:2.13947 Ang A19.C and K29.NZ other bump:1.97321 Ang L18.C and K29.NZ other bump:2.51833 Ang I22.CB and K29.CE other bump:2.97804 Ang I22.CG1 and K29.CE other bump:2.01908 Ang A19.CA and K29.CE other bump:1.64907 Ang A19.O and K29.CE other bump:1.91244 Ang A19.C and K29.CE other bump:3.07408 Ang L18.C and K29.CE other bump:3.23272 Ang I22.CG1 and K29.CD other bump:2.81068 Ang I22.CD1 and K29.CD other bump:2.93745 Ang A19.N and K29.CD other bump:2.03154 Ang A19.CA and K29.CD other bump:2.84717 Ang A19.C and K29.CD other bump:2.89385 Ang A19.CB and K29.CD other bump:2.80244 Ang A19.CA and K29.CG other bump:2.92437 Ang A19.CB and K29.CG other bump:2.87953 Ang N4.CG and K28.CD other bump:2.56843 Ang N4.ND2 and K28.CD other bump:2.69794 Ang N4.OD1 and K28.CB other bump:2.78354 Ang I22.CG2 and N27.ND2 other bump:2.83123 Ang I22.CG2 and N27.CG other bump:2.55965 Ang I22.CG2 and N27.CB other bump:2.12886 Ang N9.CG and T11.OG1 other bump:1.26249 Ang N9.OD1 and T11.OG1 other bump:2.40651 Ang N9.OD1 and T11.CB T0191 86 :LDGVDIIINATPIGMYPNIDVE 1gegA 77 :LGGFDVIVNNAGVAPSTPIESI Fragment has 20 clashes (null) has 20 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 24 residues other bump:2.33994 Ang I20.N and E23.OE2 other bump:2.07083 Ang I20.CA and E23.OE2 other bump:2.55179 Ang N19.C and E23.OE2 other bump:2.43917 Ang I20.CA and E23.OE1 other bump:1.37608 Ang I20.O and E23.OE1 other bump:2.08893 Ang I20.C and E23.OE1 other bump:2.56081 Ang I20.CA and E23.CD other bump:2.50878 Ang I20.O and E23.CD other bump:2.82414 Ang I20.C and E23.CD neighbor-bump: 1.99253 Ang Y17.C and P18.CD neighbor-bump: 2.49673 Ang Y17.C and P18.CG other bump:2.01595 Ang A11.O and P13.CD other bump:2.66032 Ang A11.C and P13.CD neighbor-bump: 2.00296 Ang T12.CA and P13.CD neighbor-bump: 1.32553 Ang T12.C and P13.CD neighbor-bump: 2.15168 Ang T12.O and P13.CD other bump:2.23158 Ang A11.O and P13.CG other bump:3.13336 Ang A11.C and P13.CG neighbor-bump: 2.20272 Ang T12.C and P13.CG neighbor-bump: 2.2263 Ang T12.O and P13.CG T0191 108 :PIVKAEKLREDMVVMDLIYNPLETVLLKEAK 1gegA 164 :QTAARDLAPLGITVNGYCPGIVKTPMWAEID Fragment has 18 clashes (null) has 18 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 33 residues other bump:2.83155 Ang N21.CG and L23.CD2 other bump:2.07466 Ang N21.OD1 and L23.CD2 other bump:3.04523 Ang Y20.CB and L23.CD1 neighbor-bump: 2.95993 Ang N21.CG and P22.C neighbor-bump: 2.40578 Ang N21.OD1 and P22.C neighbor-bump: 2.53235 Ang N21.CB and P22.CD neighbor-bump: 2.31795 Ang N21.CG and P22.N neighbor-bump: 2.18857 Ang N21.CB and P22.N other bump:2.92259 Ang V4.CG1 and V15.CG2 other bump:2.55965 Ang K5.O and L9.CG other bump:2.51264 Ang V4.CA and K8.NZ other bump:1.7713 Ang V4.CB and K8.NZ other bump:0.830486 Ang V4.CG1 and K8.NZ other bump:2.39164 Ang V4.CG2 and K8.NZ other bump:1.56388 Ang V4.CG1 and K8.CE other bump:2.92315 Ang V4.CG1 and K8.CD other bump:1.70506 Ang I3.CG2 and E7.OE2 other bump:2.9126 Ang I3.CG2 and E7.CD T0191 139 :KVNAK 1gegA 200 :AAGKP Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 7 residues Number of specific fragments= 6 total=1171 Number of alignments=226 # Reading fragments from alignment file # T0191 read from T0191-1gegA-2track-protein-EBGHSTL-local-adpstyle1.pw.a2m.gz # 1gegA read from T0191-1gegA-2track-protein-EBGHSTL-local-adpstyle1.pw.a2m.gz # found chain 1gegA in template set T0191 24 :KNIVIYGAG 1gegA 3 :KVALVTGAG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues T0191 33 :GAARAVAFELAK 1gegA 13 :GIGKAIALRLVK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGLDVD 1gegA 26 :GFAVAIADYNDATAKAVASEINQAGGHAVAVKVDVSDRDQV Fragment has 32 clashes (null) has 32 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 43 residues other bump:2.61574 Ang V34.CG2 and V41.CG1 other bump:2.09426 Ang V12.CG1 and E33.OE2 other bump:2.9359 Ang V12.CG1 and E33.CD other bump:1.10458 Ang L18.O and K29.NZ other bump:2.92713 Ang I22.CG1 and K29.NZ other bump:2.43746 Ang A19.N and K29.NZ other bump:2.30579 Ang A19.CA and K29.NZ other bump:2.13947 Ang A19.C and K29.NZ other bump:1.97321 Ang L18.C and K29.NZ other bump:2.51833 Ang I22.CB and K29.CE other bump:2.97804 Ang I22.CG1 and K29.CE other bump:2.01908 Ang A19.CA and K29.CE other bump:1.64907 Ang A19.O and K29.CE other bump:1.91244 Ang A19.C and K29.CE other bump:3.07408 Ang L18.C and K29.CE other bump:3.23272 Ang I22.CG1 and K29.CD other bump:2.81068 Ang I22.CD1 and K29.CD other bump:2.93745 Ang A19.N and K29.CD other bump:2.03154 Ang A19.CA and K29.CD other bump:2.84717 Ang A19.C and K29.CD other bump:2.89385 Ang A19.CB and K29.CD other bump:2.80244 Ang A19.CA and K29.CG other bump:2.92437 Ang A19.CB and K29.CG other bump:2.87953 Ang N4.CG and K28.CD other bump:2.56843 Ang N4.ND2 and K28.CD other bump:2.69794 Ang N4.OD1 and K28.CB other bump:2.78354 Ang I22.CG2 and N27.ND2 other bump:2.83123 Ang I22.CG2 and N27.CG other bump:2.55965 Ang I22.CG2 and N27.CB other bump:2.12886 Ang N9.CG and T11.OG1 other bump:1.26249 Ang N9.OD1 and T11.OG1 other bump:2.40651 Ang N9.OD1 and T11.CB T0191 86 :LDGVDIIINATPIGMYPNIDVEPIVKAEKL 1gegA 77 :LGGFDVIVNNAGVAPSTPIESITPEIVDKV Fragment has 26 clashes (null) has 26 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 32 residues other bump:1.89471 Ang I25.CG1 and E29.OE2 other bump:2.18272 Ang I25.CD1 and E29.OE2 other bump:2.42293 Ang I25.O and E29.OE2 other bump:2.78434 Ang V26.CA and E29.OE1 other bump:0.976067 Ang I25.O and E29.OE1 other bump:1.92808 Ang I25.C and E29.OE1 other bump:2.95778 Ang I25.CG1 and E29.CD other bump:1.88106 Ang I25.O and E29.CD other bump:2.81622 Ang I25.C and E29.CD other bump:2.63461 Ang M16.SD and K27.NZ other bump:1.56368 Ang M16.CE and K27.NZ other bump:2.88386 Ang M16.CE and K27.CE other bump:2.92791 Ang P24.CG and K27.CD other bump:2.6561 Ang P24.CD and K27.CD other bump:2.95736 Ang P24.CG and K27.CG neighbor-bump: 1.99253 Ang Y17.C and P18.CD neighbor-bump: 2.49673 Ang Y17.C and P18.CG other bump:2.01595 Ang A11.O and P13.CD other bump:2.66032 Ang A11.C and P13.CD neighbor-bump: 2.15168 Ang T12.O and P13.CD neighbor-bump: 2.00296 Ang T12.CA and P13.CD neighbor-bump: 1.32553 Ang T12.C and P13.CD other bump:2.23158 Ang A11.O and P13.CG other bump:3.13336 Ang A11.C and P13.CG neighbor-bump: 2.2263 Ang T12.O and P13.CG neighbor-bump: 2.20272 Ang T12.C and P13.CG Number of specific fragments= 4 total=1175 Number of alignments=227 # Reading fragments from alignment file # T0191 read from T0191-1gegA-2track-protein-EBGHSTL-local-adpstyle5.pw.a2m.gz # 1gegA read from T0191-1gegA-2track-protein-EBGHSTL-local-adpstyle5.pw.a2m.gz # found chain 1gegA in template set T0191 24 :KNIVIYGAG 1gegA 3 :KVALVTGAG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues T0191 33 :GAARAVAFELAK 1gegA 13 :GIGKAIALRLVK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGLDVD 1gegA 26 :GFAVAIADYNDATAKAVASEINQAGGHAVAVKVDVSDRDQV Fragment has 32 clashes (null) has 32 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 43 residues other bump:2.61574 Ang V34.CG2 and V41.CG1 other bump:2.09426 Ang V12.CG1 and E33.OE2 other bump:2.9359 Ang V12.CG1 and E33.CD other bump:1.10458 Ang L18.O and K29.NZ other bump:2.92713 Ang I22.CG1 and K29.NZ other bump:2.43746 Ang A19.N and K29.NZ other bump:2.30579 Ang A19.CA and K29.NZ other bump:2.13947 Ang A19.C and K29.NZ other bump:1.97321 Ang L18.C and K29.NZ other bump:2.51833 Ang I22.CB and K29.CE other bump:2.97804 Ang I22.CG1 and K29.CE other bump:2.01908 Ang A19.CA and K29.CE other bump:1.64907 Ang A19.O and K29.CE other bump:1.91244 Ang A19.C and K29.CE other bump:3.07408 Ang L18.C and K29.CE other bump:3.23272 Ang I22.CG1 and K29.CD other bump:2.81068 Ang I22.CD1 and K29.CD other bump:2.93745 Ang A19.N and K29.CD other bump:2.03154 Ang A19.CA and K29.CD other bump:2.84717 Ang A19.C and K29.CD other bump:2.89385 Ang A19.CB and K29.CD other bump:2.80244 Ang A19.CA and K29.CG other bump:2.92437 Ang A19.CB and K29.CG other bump:2.87953 Ang N4.CG and K28.CD other bump:2.56843 Ang N4.ND2 and K28.CD other bump:2.69794 Ang N4.OD1 and K28.CB other bump:2.78354 Ang I22.CG2 and N27.ND2 other bump:2.83123 Ang I22.CG2 and N27.CG other bump:2.55965 Ang I22.CG2 and N27.CB other bump:2.12886 Ang N9.CG and T11.OG1 other bump:1.26249 Ang N9.OD1 and T11.OG1 other bump:2.40651 Ang N9.OD1 and T11.CB T0191 86 :LDGVDIIINATPIGMYPNIDVEPIVKAE 1gegA 77 :LGGFDVIVNNAGVAPSTPIESITPEIVD Fragment has 17 clashes (null) has 17 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 30 residues other bump:2.63461 Ang M16.SD and K27.NZ other bump:1.56368 Ang M16.CE and K27.NZ other bump:2.88386 Ang M16.CE and K27.CE other bump:2.92791 Ang P24.CG and K27.CD other bump:2.6561 Ang P24.CD and K27.CD other bump:2.95736 Ang P24.CG and K27.CG neighbor-bump: 1.99253 Ang Y17.C and P18.CD neighbor-bump: 2.49673 Ang Y17.C and P18.CG other bump:2.01595 Ang A11.O and P13.CD other bump:2.66032 Ang A11.C and P13.CD neighbor-bump: 2.15168 Ang T12.O and P13.CD neighbor-bump: 2.00296 Ang T12.CA and P13.CD neighbor-bump: 1.32553 Ang T12.C and P13.CD other bump:2.23158 Ang A11.O and P13.CG other bump:3.13336 Ang A11.C and P13.CG neighbor-bump: 2.2263 Ang T12.O and P13.CG neighbor-bump: 2.20272 Ang T12.C and P13.CG Number of specific fragments= 4 total=1179 Number of alignments=228 # Reading fragments from alignment file # T0191 read from T0191-1gegA-2track-protein-EBGHTL-global-adpstyle1.pw.a2m.gz # 1gegA read from T0191-1gegA-2track-protein-EBGHTL-global-adpstyle1.pw.a2m.gz # found chain 1gegA in template set T0191 24 :KNIVIYGAG 1gegA 3 :KVALVTGAG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues T0191 33 :GAARAVAFELAK 1gegA 13 :GIGKAIALRLVK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGLDVD 1gegA 26 :GFAVAIADYNDATAKAVASEINQAGGHAVAVKVDVSDRDQV Fragment has 32 clashes (null) has 32 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 43 residues other bump:2.61574 Ang V34.CG2 and V41.CG1 other bump:2.09426 Ang V12.CG1 and E33.OE2 other bump:2.9359 Ang V12.CG1 and E33.CD other bump:1.10458 Ang L18.O and K29.NZ other bump:2.92713 Ang I22.CG1 and K29.NZ other bump:2.43746 Ang A19.N and K29.NZ other bump:2.30579 Ang A19.CA and K29.NZ other bump:2.13947 Ang A19.C and K29.NZ other bump:1.97321 Ang L18.C and K29.NZ other bump:2.51833 Ang I22.CB and K29.CE other bump:2.97804 Ang I22.CG1 and K29.CE other bump:2.01908 Ang A19.CA and K29.CE other bump:1.64907 Ang A19.O and K29.CE other bump:1.91244 Ang A19.C and K29.CE other bump:3.07408 Ang L18.C and K29.CE other bump:3.23272 Ang I22.CG1 and K29.CD other bump:2.81068 Ang I22.CD1 and K29.CD other bump:2.93745 Ang A19.N and K29.CD other bump:2.03154 Ang A19.CA and K29.CD other bump:2.84717 Ang A19.C and K29.CD other bump:2.89385 Ang A19.CB and K29.CD other bump:2.80244 Ang A19.CA and K29.CG other bump:2.92437 Ang A19.CB and K29.CG other bump:2.87953 Ang N4.CG and K28.CD other bump:2.56843 Ang N4.ND2 and K28.CD other bump:2.69794 Ang N4.OD1 and K28.CB other bump:2.78354 Ang I22.CG2 and N27.ND2 other bump:2.83123 Ang I22.CG2 and N27.CG other bump:2.55965 Ang I22.CG2 and N27.CB other bump:2.12886 Ang N9.CG and T11.OG1 other bump:1.26249 Ang N9.OD1 and T11.OG1 other bump:2.40651 Ang N9.OD1 and T11.CB T0191 86 :LDGVDIIINATPIGMY 1gegA 77 :LGGFDVIVNNAGVAPS Fragment has 9 clashes (null) has 9 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 18 residues other bump:2.01595 Ang A11.O and P13.CD other bump:2.66032 Ang A11.C and P13.CD neighbor-bump: 2.00296 Ang T12.CA and P13.CD neighbor-bump: 1.32553 Ang T12.C and P13.CD neighbor-bump: 2.15168 Ang T12.O and P13.CD other bump:2.23158 Ang A11.O and P13.CG other bump:3.13336 Ang A11.C and P13.CG neighbor-bump: 2.20272 Ang T12.C and P13.CG neighbor-bump: 2.2263 Ang T12.O and P13.CG T0191 127 :NPLETVLLKEAKKVNAKTINGLGMLIYQGAVAFK 1gegA 93 :TPIESITPEIVDKVYNINVKGVIWGIQAAVEAFK Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 35 residues other bump:2.94875 Ang N16.OD1 and I20.CD1 other bump:2.13994 Ang N2.CG and E11.OE2 other bump:2.22571 Ang N2.ND2 and E11.OE2 other bump:1.67783 Ang N2.OD1 and E11.OE2 other bump:2.80499 Ang N2.CG and E11.CD other bump:1.78846 Ang N2.OD1 and E11.CD other bump:2.66004 Ang N2.OD1 and E11.CG Number of specific fragments= 5 total=1184 Number of alignments=229 # Reading fragments from alignment file # T0191 read from T0191-1gegA-2track-protein-EBGHTL-global-adpstyle5.pw.a2m.gz # 1gegA read from T0191-1gegA-2track-protein-EBGHTL-global-adpstyle5.pw.a2m.gz # found chain 1gegA in template set T0191 24 :KNIVIYGAG 1gegA 3 :KVALVTGAG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues T0191 33 :GAARAVAFELAK 1gegA 13 :GIGKAIALRLVK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGLDVD 1gegA 26 :GFAVAIADYNDATAKAVASEINQAGGHAVAVKVDVSDRDQV Fragment has 32 clashes (null) has 32 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 43 residues other bump:2.61574 Ang V34.CG2 and V41.CG1 other bump:2.09426 Ang V12.CG1 and E33.OE2 other bump:2.9359 Ang V12.CG1 and E33.CD other bump:1.10458 Ang L18.O and K29.NZ other bump:2.92713 Ang I22.CG1 and K29.NZ other bump:2.43746 Ang A19.N and K29.NZ other bump:2.30579 Ang A19.CA and K29.NZ other bump:2.13947 Ang A19.C and K29.NZ other bump:1.97321 Ang L18.C and K29.NZ other bump:2.51833 Ang I22.CB and K29.CE other bump:2.97804 Ang I22.CG1 and K29.CE other bump:2.01908 Ang A19.CA and K29.CE other bump:1.64907 Ang A19.O and K29.CE other bump:1.91244 Ang A19.C and K29.CE other bump:3.07408 Ang L18.C and K29.CE other bump:3.23272 Ang I22.CG1 and K29.CD other bump:2.81068 Ang I22.CD1 and K29.CD other bump:2.93745 Ang A19.N and K29.CD other bump:2.03154 Ang A19.CA and K29.CD other bump:2.84717 Ang A19.C and K29.CD other bump:2.89385 Ang A19.CB and K29.CD other bump:2.80244 Ang A19.CA and K29.CG other bump:2.92437 Ang A19.CB and K29.CG other bump:2.87953 Ang N4.CG and K28.CD other bump:2.56843 Ang N4.ND2 and K28.CD other bump:2.69794 Ang N4.OD1 and K28.CB other bump:2.78354 Ang I22.CG2 and N27.ND2 other bump:2.83123 Ang I22.CG2 and N27.CG other bump:2.55965 Ang I22.CG2 and N27.CB other bump:2.12886 Ang N9.CG and T11.OG1 other bump:1.26249 Ang N9.OD1 and T11.OG1 other bump:2.40651 Ang N9.OD1 and T11.CB T0191 86 :LDGVDIIINATPIGMYPNIDVE 1gegA 77 :LGGFDVIVNNAGVAPSTPIESI Fragment has 20 clashes (null) has 20 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 24 residues other bump:2.33994 Ang I20.N and E23.OE2 other bump:2.07083 Ang I20.CA and E23.OE2 other bump:2.55179 Ang N19.C and E23.OE2 other bump:2.43917 Ang I20.CA and E23.OE1 other bump:1.37608 Ang I20.O and E23.OE1 other bump:2.08893 Ang I20.C and E23.OE1 other bump:2.56081 Ang I20.CA and E23.CD other bump:2.50878 Ang I20.O and E23.CD other bump:2.82414 Ang I20.C and E23.CD neighbor-bump: 1.99253 Ang Y17.C and P18.CD neighbor-bump: 2.49673 Ang Y17.C and P18.CG other bump:2.01595 Ang A11.O and P13.CD other bump:2.66032 Ang A11.C and P13.CD neighbor-bump: 2.00296 Ang T12.CA and P13.CD neighbor-bump: 1.32553 Ang T12.C and P13.CD neighbor-bump: 2.15168 Ang T12.O and P13.CD other bump:2.23158 Ang A11.O and P13.CG other bump:3.13336 Ang A11.C and P13.CG neighbor-bump: 2.20272 Ang T12.C and P13.CG neighbor-bump: 2.2263 Ang T12.O and P13.CG Number of specific fragments= 4 total=1188 Number of alignments=230 # Reading fragments from alignment file # T0191 read from T0191-1gegA-2track-protein-EBGHTL-local-adpstyle1.pw.a2m.gz # 1gegA read from T0191-1gegA-2track-protein-EBGHTL-local-adpstyle1.pw.a2m.gz # found chain 1gegA in template set T0191 24 :KNIVIYGAG 1gegA 3 :KVALVTGAG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues T0191 33 :GAARAVAFELAK 1gegA 13 :GIGKAIALRLVK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGLDVD 1gegA 26 :GFAVAIADYNDATAKAVASEINQAGGHAVAVKVDVSDRDQV Fragment has 32 clashes (null) has 32 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 43 residues other bump:2.61574 Ang V34.CG2 and V41.CG1 other bump:2.09426 Ang V12.CG1 and E33.OE2 other bump:2.9359 Ang V12.CG1 and E33.CD other bump:1.10458 Ang L18.O and K29.NZ other bump:2.92713 Ang I22.CG1 and K29.NZ other bump:2.43746 Ang A19.N and K29.NZ other bump:2.30579 Ang A19.CA and K29.NZ other bump:2.13947 Ang A19.C and K29.NZ other bump:1.97321 Ang L18.C and K29.NZ other bump:2.51833 Ang I22.CB and K29.CE other bump:2.97804 Ang I22.CG1 and K29.CE other bump:2.01908 Ang A19.CA and K29.CE other bump:1.64907 Ang A19.O and K29.CE other bump:1.91244 Ang A19.C and K29.CE other bump:3.07408 Ang L18.C and K29.CE other bump:3.23272 Ang I22.CG1 and K29.CD other bump:2.81068 Ang I22.CD1 and K29.CD other bump:2.93745 Ang A19.N and K29.CD other bump:2.03154 Ang A19.CA and K29.CD other bump:2.84717 Ang A19.C and K29.CD other bump:2.89385 Ang A19.CB and K29.CD other bump:2.80244 Ang A19.CA and K29.CG other bump:2.92437 Ang A19.CB and K29.CG other bump:2.87953 Ang N4.CG and K28.CD other bump:2.56843 Ang N4.ND2 and K28.CD other bump:2.69794 Ang N4.OD1 and K28.CB other bump:2.78354 Ang I22.CG2 and N27.ND2 other bump:2.83123 Ang I22.CG2 and N27.CG other bump:2.55965 Ang I22.CG2 and N27.CB other bump:2.12886 Ang N9.CG and T11.OG1 other bump:1.26249 Ang N9.OD1 and T11.OG1 other bump:2.40651 Ang N9.OD1 and T11.CB T0191 86 :LDGVDIIINATPIGMYPNIDVEPIVKAEKL 1gegA 77 :LGGFDVIVNNAGVAPSTPIESITPEIVDKV Fragment has 26 clashes (null) has 26 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 32 residues other bump:1.89471 Ang I25.CG1 and E29.OE2 other bump:2.18272 Ang I25.CD1 and E29.OE2 other bump:2.42293 Ang I25.O and E29.OE2 other bump:2.78434 Ang V26.CA and E29.OE1 other bump:0.976067 Ang I25.O and E29.OE1 other bump:1.92808 Ang I25.C and E29.OE1 other bump:2.95778 Ang I25.CG1 and E29.CD other bump:1.88106 Ang I25.O and E29.CD other bump:2.81622 Ang I25.C and E29.CD other bump:2.63461 Ang M16.SD and K27.NZ other bump:1.56368 Ang M16.CE and K27.NZ other bump:2.88386 Ang M16.CE and K27.CE other bump:2.92791 Ang P24.CG and K27.CD other bump:2.6561 Ang P24.CD and K27.CD other bump:2.95736 Ang P24.CG and K27.CG neighbor-bump: 1.99253 Ang Y17.C and P18.CD neighbor-bump: 2.49673 Ang Y17.C and P18.CG other bump:2.01595 Ang A11.O and P13.CD other bump:2.66032 Ang A11.C and P13.CD neighbor-bump: 2.15168 Ang T12.O and P13.CD neighbor-bump: 2.00296 Ang T12.CA and P13.CD neighbor-bump: 1.32553 Ang T12.C and P13.CD other bump:2.23158 Ang A11.O and P13.CG other bump:3.13336 Ang A11.C and P13.CG neighbor-bump: 2.2263 Ang T12.O and P13.CG neighbor-bump: 2.20272 Ang T12.C and P13.CG Number of specific fragments= 4 total=1192 Number of alignments=231 # Reading fragments from alignment file # T0191 read from T0191-1gegA-2track-protein-EBGHTL-local-adpstyle5.pw.a2m.gz # 1gegA read from T0191-1gegA-2track-protein-EBGHTL-local-adpstyle5.pw.a2m.gz # found chain 1gegA in template set T0191 24 :KNIVIYGAG 1gegA 3 :KVALVTGAG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues T0191 33 :GAARAVAFELAK 1gegA 13 :GIGKAIALRLVK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGLDVD 1gegA 26 :GFAVAIADYNDATAKAVASEINQAGGHAVAVKVDVSDRDQV Fragment has 32 clashes (null) has 32 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 43 residues other bump:2.61574 Ang V34.CG2 and V41.CG1 other bump:2.09426 Ang V12.CG1 and E33.OE2 other bump:2.9359 Ang V12.CG1 and E33.CD other bump:1.10458 Ang L18.O and K29.NZ other bump:2.92713 Ang I22.CG1 and K29.NZ other bump:2.43746 Ang A19.N and K29.NZ other bump:2.30579 Ang A19.CA and K29.NZ other bump:2.13947 Ang A19.C and K29.NZ other bump:1.97321 Ang L18.C and K29.NZ other bump:2.51833 Ang I22.CB and K29.CE other bump:2.97804 Ang I22.CG1 and K29.CE other bump:2.01908 Ang A19.CA and K29.CE other bump:1.64907 Ang A19.O and K29.CE other bump:1.91244 Ang A19.C and K29.CE other bump:3.07408 Ang L18.C and K29.CE other bump:3.23272 Ang I22.CG1 and K29.CD other bump:2.81068 Ang I22.CD1 and K29.CD other bump:2.93745 Ang A19.N and K29.CD other bump:2.03154 Ang A19.CA and K29.CD other bump:2.84717 Ang A19.C and K29.CD other bump:2.89385 Ang A19.CB and K29.CD other bump:2.80244 Ang A19.CA and K29.CG other bump:2.92437 Ang A19.CB and K29.CG other bump:2.87953 Ang N4.CG and K28.CD other bump:2.56843 Ang N4.ND2 and K28.CD other bump:2.69794 Ang N4.OD1 and K28.CB other bump:2.78354 Ang I22.CG2 and N27.ND2 other bump:2.83123 Ang I22.CG2 and N27.CG other bump:2.55965 Ang I22.CG2 and N27.CB other bump:2.12886 Ang N9.CG and T11.OG1 other bump:1.26249 Ang N9.OD1 and T11.OG1 other bump:2.40651 Ang N9.OD1 and T11.CB T0191 86 :LDGVDIIINATPIGMYPNIDVEPIVKAEK 1gegA 77 :LGGFDVIVNNAGVAPSTPIESITPEIVDK Fragment has 26 clashes (null) has 26 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 31 residues other bump:1.89471 Ang I25.CG1 and E29.OE2 other bump:2.18272 Ang I25.CD1 and E29.OE2 other bump:2.42293 Ang I25.O and E29.OE2 other bump:2.78434 Ang V26.CA and E29.OE1 other bump:0.976067 Ang I25.O and E29.OE1 other bump:1.92808 Ang I25.C and E29.OE1 other bump:2.95778 Ang I25.CG1 and E29.CD other bump:1.88106 Ang I25.O and E29.CD other bump:2.81622 Ang I25.C and E29.CD other bump:2.63461 Ang M16.SD and K27.NZ other bump:1.56368 Ang M16.CE and K27.NZ other bump:2.88386 Ang M16.CE and K27.CE other bump:2.92791 Ang P24.CG and K27.CD other bump:2.6561 Ang P24.CD and K27.CD other bump:2.95736 Ang P24.CG and K27.CG neighbor-bump: 1.99253 Ang Y17.C and P18.CD neighbor-bump: 2.49673 Ang Y17.C and P18.CG other bump:2.01595 Ang A11.O and P13.CD other bump:2.66032 Ang A11.C and P13.CD neighbor-bump: 2.15168 Ang T12.O and P13.CD neighbor-bump: 2.00296 Ang T12.CA and P13.CD neighbor-bump: 1.32553 Ang T12.C and P13.CD other bump:2.23158 Ang A11.O and P13.CG other bump:3.13336 Ang A11.C and P13.CG neighbor-bump: 2.2263 Ang T12.O and P13.CG neighbor-bump: 2.20272 Ang T12.C and P13.CG Number of specific fragments= 4 total=1196 Number of alignments=232 # Reading fragments from alignment file # T0191 read from T0191-1gegA-2track-protein-STR-global-adpstyle1.pw.a2m.gz # 1gegA read from T0191-1gegA-2track-protein-STR-global-adpstyle1.pw.a2m.gz # found chain 1gegA in template set T0191 24 :KNIVIYGAG 1gegA 3 :KVALVTGAG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues T0191 33 :GAARAVAFELAK 1gegA 13 :GIGKAIALRLVK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGLDVD 1gegA 26 :GFAVAIADYNDATAKAVASEINQAGGHAVAVKVDVSDRDQV Fragment has 32 clashes (null) has 32 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 43 residues other bump:2.61574 Ang V34.CG2 and V41.CG1 other bump:2.09426 Ang V12.CG1 and E33.OE2 other bump:2.9359 Ang V12.CG1 and E33.CD other bump:1.10458 Ang L18.O and K29.NZ other bump:2.92713 Ang I22.CG1 and K29.NZ other bump:2.43746 Ang A19.N and K29.NZ other bump:2.30579 Ang A19.CA and K29.NZ other bump:2.13947 Ang A19.C and K29.NZ other bump:1.97321 Ang L18.C and K29.NZ other bump:2.51833 Ang I22.CB and K29.CE other bump:2.97804 Ang I22.CG1 and K29.CE other bump:2.01908 Ang A19.CA and K29.CE other bump:1.64907 Ang A19.O and K29.CE other bump:1.91244 Ang A19.C and K29.CE other bump:3.07408 Ang L18.C and K29.CE other bump:3.23272 Ang I22.CG1 and K29.CD other bump:2.81068 Ang I22.CD1 and K29.CD other bump:2.93745 Ang A19.N and K29.CD other bump:2.03154 Ang A19.CA and K29.CD other bump:2.84717 Ang A19.C and K29.CD other bump:2.89385 Ang A19.CB and K29.CD other bump:2.80244 Ang A19.CA and K29.CG other bump:2.92437 Ang A19.CB and K29.CG other bump:2.87953 Ang N4.CG and K28.CD other bump:2.56843 Ang N4.ND2 and K28.CD other bump:2.69794 Ang N4.OD1 and K28.CB other bump:2.78354 Ang I22.CG2 and N27.ND2 other bump:2.83123 Ang I22.CG2 and N27.CG other bump:2.55965 Ang I22.CG2 and N27.CB other bump:2.12886 Ang N9.CG and T11.OG1 other bump:1.26249 Ang N9.OD1 and T11.OG1 other bump:2.40651 Ang N9.OD1 and T11.CB T0191 86 :LDGVDIIINATPIGMYPNIDVEPI 1gegA 77 :LGGFDVIVNNAGVAPSTPIESITP Fragment has 11 clashes (null) has 11 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 26 residues neighbor-bump: 1.99253 Ang Y17.C and P18.CD neighbor-bump: 2.49673 Ang Y17.C and P18.CG other bump:2.01595 Ang A11.O and P13.CD other bump:2.66032 Ang A11.C and P13.CD neighbor-bump: 2.00296 Ang T12.CA and P13.CD neighbor-bump: 1.32553 Ang T12.C and P13.CD neighbor-bump: 2.15168 Ang T12.O and P13.CD other bump:2.23158 Ang A11.O and P13.CG other bump:3.13336 Ang A11.C and P13.CG neighbor-bump: 2.20272 Ang T12.C and P13.CG neighbor-bump: 2.2263 Ang T12.O and P13.CG T0191 135 :KEAKKVNAKTINGLGMLIYQGAVAFK 1gegA 101 :EIVDKVYNINVKGVIWGIQAAVEAFK Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 27 residues other bump:2.94875 Ang N8.OD1 and I12.CD1 Number of specific fragments= 5 total=1201 Number of alignments=233 # Reading fragments from alignment file # T0191 read from T0191-1gegA-2track-protein-STR-global-adpstyle5.pw.a2m.gz # 1gegA read from T0191-1gegA-2track-protein-STR-global-adpstyle5.pw.a2m.gz # found chain 1gegA in template set T0191 24 :KNIVIYGAG 1gegA 3 :KVALVTGAG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues T0191 33 :GAARAVAFELAK 1gegA 13 :GIGKAIALRLVK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGLDVD 1gegA 26 :GFAVAIADYNDATAKAVASEINQAGGHAVAVKVDVSDRDQV Fragment has 32 clashes (null) has 32 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 43 residues other bump:2.61574 Ang V34.CG2 and V41.CG1 other bump:2.09426 Ang V12.CG1 and E33.OE2 other bump:2.9359 Ang V12.CG1 and E33.CD other bump:1.10458 Ang L18.O and K29.NZ other bump:2.92713 Ang I22.CG1 and K29.NZ other bump:2.43746 Ang A19.N and K29.NZ other bump:2.30579 Ang A19.CA and K29.NZ other bump:2.13947 Ang A19.C and K29.NZ other bump:1.97321 Ang L18.C and K29.NZ other bump:2.51833 Ang I22.CB and K29.CE other bump:2.97804 Ang I22.CG1 and K29.CE other bump:2.01908 Ang A19.CA and K29.CE other bump:1.64907 Ang A19.O and K29.CE other bump:1.91244 Ang A19.C and K29.CE other bump:3.07408 Ang L18.C and K29.CE other bump:3.23272 Ang I22.CG1 and K29.CD other bump:2.81068 Ang I22.CD1 and K29.CD other bump:2.93745 Ang A19.N and K29.CD other bump:2.03154 Ang A19.CA and K29.CD other bump:2.84717 Ang A19.C and K29.CD other bump:2.89385 Ang A19.CB and K29.CD other bump:2.80244 Ang A19.CA and K29.CG other bump:2.92437 Ang A19.CB and K29.CG other bump:2.87953 Ang N4.CG and K28.CD other bump:2.56843 Ang N4.ND2 and K28.CD other bump:2.69794 Ang N4.OD1 and K28.CB other bump:2.78354 Ang I22.CG2 and N27.ND2 other bump:2.83123 Ang I22.CG2 and N27.CG other bump:2.55965 Ang I22.CG2 and N27.CB other bump:2.12886 Ang N9.CG and T11.OG1 other bump:1.26249 Ang N9.OD1 and T11.OG1 other bump:2.40651 Ang N9.OD1 and T11.CB T0191 86 :LDGVDIIINATPIGMYPNIDVE 1gegA 77 :LGGFDVIVNNAGVAPSTPIESI Fragment has 20 clashes (null) has 20 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 24 residues other bump:2.33994 Ang I20.N and E23.OE2 other bump:2.07083 Ang I20.CA and E23.OE2 other bump:2.55179 Ang N19.C and E23.OE2 other bump:2.43917 Ang I20.CA and E23.OE1 other bump:1.37608 Ang I20.O and E23.OE1 other bump:2.08893 Ang I20.C and E23.OE1 other bump:2.56081 Ang I20.CA and E23.CD other bump:2.50878 Ang I20.O and E23.CD other bump:2.82414 Ang I20.C and E23.CD neighbor-bump: 1.99253 Ang Y17.C and P18.CD neighbor-bump: 2.49673 Ang Y17.C and P18.CG other bump:2.01595 Ang A11.O and P13.CD other bump:2.66032 Ang A11.C and P13.CD neighbor-bump: 2.00296 Ang T12.CA and P13.CD neighbor-bump: 1.32553 Ang T12.C and P13.CD neighbor-bump: 2.15168 Ang T12.O and P13.CD other bump:2.23158 Ang A11.O and P13.CG other bump:3.13336 Ang A11.C and P13.CG neighbor-bump: 2.20272 Ang T12.C and P13.CG neighbor-bump: 2.2263 Ang T12.O and P13.CG Number of specific fragments= 4 total=1205 Number of alignments=234 # Reading fragments from alignment file # T0191 read from T0191-1gegA-2track-protein-STR-local-adpstyle1.pw.a2m.gz # 1gegA read from T0191-1gegA-2track-protein-STR-local-adpstyle1.pw.a2m.gz # found chain 1gegA in template set T0191 24 :KNIVIYGAG 1gegA 3 :KVALVTGAG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues T0191 33 :GAARAVAFELAK 1gegA 13 :GIGKAIALRLVK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGLDVD 1gegA 26 :GFAVAIADYNDATAKAVASEINQAGGHAVAVKVDVSDRDQV Fragment has 32 clashes (null) has 32 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 43 residues other bump:2.61574 Ang V34.CG2 and V41.CG1 other bump:2.09426 Ang V12.CG1 and E33.OE2 other bump:2.9359 Ang V12.CG1 and E33.CD other bump:1.10458 Ang L18.O and K29.NZ other bump:2.92713 Ang I22.CG1 and K29.NZ other bump:2.43746 Ang A19.N and K29.NZ other bump:2.30579 Ang A19.CA and K29.NZ other bump:2.13947 Ang A19.C and K29.NZ other bump:1.97321 Ang L18.C and K29.NZ other bump:2.51833 Ang I22.CB and K29.CE other bump:2.97804 Ang I22.CG1 and K29.CE other bump:2.01908 Ang A19.CA and K29.CE other bump:1.64907 Ang A19.O and K29.CE other bump:1.91244 Ang A19.C and K29.CE other bump:3.07408 Ang L18.C and K29.CE other bump:3.23272 Ang I22.CG1 and K29.CD other bump:2.81068 Ang I22.CD1 and K29.CD other bump:2.93745 Ang A19.N and K29.CD other bump:2.03154 Ang A19.CA and K29.CD other bump:2.84717 Ang A19.C and K29.CD other bump:2.89385 Ang A19.CB and K29.CD other bump:2.80244 Ang A19.CA and K29.CG other bump:2.92437 Ang A19.CB and K29.CG other bump:2.87953 Ang N4.CG and K28.CD other bump:2.56843 Ang N4.ND2 and K28.CD other bump:2.69794 Ang N4.OD1 and K28.CB other bump:2.78354 Ang I22.CG2 and N27.ND2 other bump:2.83123 Ang I22.CG2 and N27.CG other bump:2.55965 Ang I22.CG2 and N27.CB other bump:2.12886 Ang N9.CG and T11.OG1 other bump:1.26249 Ang N9.OD1 and T11.OG1 other bump:2.40651 Ang N9.OD1 and T11.CB T0191 86 :LDGVDIIINATPIGMYPNIDVEPIVKAEKL 1gegA 77 :LGGFDVIVNNAGVAPSTPIESITPEIVDKV Fragment has 26 clashes (null) has 26 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 32 residues other bump:1.89471 Ang I25.CG1 and E29.OE2 other bump:2.18272 Ang I25.CD1 and E29.OE2 other bump:2.42293 Ang I25.O and E29.OE2 other bump:2.78434 Ang V26.CA and E29.OE1 other bump:0.976067 Ang I25.O and E29.OE1 other bump:1.92808 Ang I25.C and E29.OE1 other bump:2.95778 Ang I25.CG1 and E29.CD other bump:1.88106 Ang I25.O and E29.CD other bump:2.81622 Ang I25.C and E29.CD other bump:2.63461 Ang M16.SD and K27.NZ other bump:1.56368 Ang M16.CE and K27.NZ other bump:2.88386 Ang M16.CE and K27.CE other bump:2.92791 Ang P24.CG and K27.CD other bump:2.6561 Ang P24.CD and K27.CD other bump:2.95736 Ang P24.CG and K27.CG neighbor-bump: 1.99253 Ang Y17.C and P18.CD neighbor-bump: 2.49673 Ang Y17.C and P18.CG other bump:2.01595 Ang A11.O and P13.CD other bump:2.66032 Ang A11.C and P13.CD neighbor-bump: 2.15168 Ang T12.O and P13.CD neighbor-bump: 2.00296 Ang T12.CA and P13.CD neighbor-bump: 1.32553 Ang T12.C and P13.CD other bump:2.23158 Ang A11.O and P13.CG other bump:3.13336 Ang A11.C and P13.CG neighbor-bump: 2.2263 Ang T12.O and P13.CG neighbor-bump: 2.20272 Ang T12.C and P13.CG Number of specific fragments= 4 total=1209 Number of alignments=235 # Reading fragments from alignment file # T0191 read from T0191-1gegA-2track-protein-STR-local-adpstyle5.pw.a2m.gz # 1gegA read from T0191-1gegA-2track-protein-STR-local-adpstyle5.pw.a2m.gz # found chain 1gegA in template set T0191 24 :KNIVIYGAG 1gegA 3 :KVALVTGAG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues T0191 33 :GAARAVAFELAK 1gegA 13 :GIGKAIALRLVK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGLDVD 1gegA 26 :GFAVAIADYNDATAKAVASEINQAGGHAVAVKVDVSDRDQV Fragment has 32 clashes (null) has 32 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 43 residues other bump:2.61574 Ang V34.CG2 and V41.CG1 other bump:2.09426 Ang V12.CG1 and E33.OE2 other bump:2.9359 Ang V12.CG1 and E33.CD other bump:1.10458 Ang L18.O and K29.NZ other bump:2.92713 Ang I22.CG1 and K29.NZ other bump:2.43746 Ang A19.N and K29.NZ other bump:2.30579 Ang A19.CA and K29.NZ other bump:2.13947 Ang A19.C and K29.NZ other bump:1.97321 Ang L18.C and K29.NZ other bump:2.51833 Ang I22.CB and K29.CE other bump:2.97804 Ang I22.CG1 and K29.CE other bump:2.01908 Ang A19.CA and K29.CE other bump:1.64907 Ang A19.O and K29.CE other bump:1.91244 Ang A19.C and K29.CE other bump:3.07408 Ang L18.C and K29.CE other bump:3.23272 Ang I22.CG1 and K29.CD other bump:2.81068 Ang I22.CD1 and K29.CD other bump:2.93745 Ang A19.N and K29.CD other bump:2.03154 Ang A19.CA and K29.CD other bump:2.84717 Ang A19.C and K29.CD other bump:2.89385 Ang A19.CB and K29.CD other bump:2.80244 Ang A19.CA and K29.CG other bump:2.92437 Ang A19.CB and K29.CG other bump:2.87953 Ang N4.CG and K28.CD other bump:2.56843 Ang N4.ND2 and K28.CD other bump:2.69794 Ang N4.OD1 and K28.CB other bump:2.78354 Ang I22.CG2 and N27.ND2 other bump:2.83123 Ang I22.CG2 and N27.CG other bump:2.55965 Ang I22.CG2 and N27.CB other bump:2.12886 Ang N9.CG and T11.OG1 other bump:1.26249 Ang N9.OD1 and T11.OG1 other bump:2.40651 Ang N9.OD1 and T11.CB T0191 86 :LDGVDIIINATPIGMYPNIDVEPIVKAEK 1gegA 77 :LGGFDVIVNNAGVAPSTPIESITPEIVDK Fragment has 26 clashes (null) has 26 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 31 residues other bump:1.89471 Ang I25.CG1 and E29.OE2 other bump:2.18272 Ang I25.CD1 and E29.OE2 other bump:2.42293 Ang I25.O and E29.OE2 other bump:2.78434 Ang V26.CA and E29.OE1 other bump:0.976067 Ang I25.O and E29.OE1 other bump:1.92808 Ang I25.C and E29.OE1 other bump:2.95778 Ang I25.CG1 and E29.CD other bump:1.88106 Ang I25.O and E29.CD other bump:2.81622 Ang I25.C and E29.CD other bump:2.63461 Ang M16.SD and K27.NZ other bump:1.56368 Ang M16.CE and K27.NZ other bump:2.88386 Ang M16.CE and K27.CE other bump:2.92791 Ang P24.CG and K27.CD other bump:2.6561 Ang P24.CD and K27.CD other bump:2.95736 Ang P24.CG and K27.CG neighbor-bump: 1.99253 Ang Y17.C and P18.CD neighbor-bump: 2.49673 Ang Y17.C and P18.CG other bump:2.01595 Ang A11.O and P13.CD other bump:2.66032 Ang A11.C and P13.CD neighbor-bump: 2.15168 Ang T12.O and P13.CD neighbor-bump: 2.00296 Ang T12.CA and P13.CD neighbor-bump: 1.32553 Ang T12.C and P13.CD other bump:2.23158 Ang A11.O and P13.CG other bump:3.13336 Ang A11.C and P13.CG neighbor-bump: 2.2263 Ang T12.O and P13.CG neighbor-bump: 2.20272 Ang T12.C and P13.CG Number of specific fragments= 4 total=1213 Number of alignments=236 # Reading fragments from alignment file # T0191 read from T0191-1gegA-local-adpstyle1.pw.a2m.gz # 1gegA read from T0191-1gegA-local-adpstyle1.pw.a2m.gz # found chain 1gegA in template set T0191 24 :KNIVIYGAG 1gegA 3 :KVALVTGAG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues T0191 33 :GAARAVAFELAK 1gegA 13 :GIGKAIALRLVK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGLDVD 1gegA 26 :GFAVAIADYNDATAKAVASEINQAGGHAVAVKVDVSDRDQV Fragment has 32 clashes (null) has 32 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 43 residues other bump:2.61574 Ang V34.CG2 and V41.CG1 other bump:2.09426 Ang V12.CG1 and E33.OE2 other bump:2.9359 Ang V12.CG1 and E33.CD other bump:1.10458 Ang L18.O and K29.NZ other bump:2.92713 Ang I22.CG1 and K29.NZ other bump:2.43746 Ang A19.N and K29.NZ other bump:2.30579 Ang A19.CA and K29.NZ other bump:2.13947 Ang A19.C and K29.NZ other bump:1.97321 Ang L18.C and K29.NZ other bump:2.51833 Ang I22.CB and K29.CE other bump:2.97804 Ang I22.CG1 and K29.CE other bump:2.01908 Ang A19.CA and K29.CE other bump:1.64907 Ang A19.O and K29.CE other bump:1.91244 Ang A19.C and K29.CE other bump:3.07408 Ang L18.C and K29.CE other bump:3.23272 Ang I22.CG1 and K29.CD other bump:2.81068 Ang I22.CD1 and K29.CD other bump:2.93745 Ang A19.N and K29.CD other bump:2.03154 Ang A19.CA and K29.CD other bump:2.84717 Ang A19.C and K29.CD other bump:2.89385 Ang A19.CB and K29.CD other bump:2.80244 Ang A19.CA and K29.CG other bump:2.92437 Ang A19.CB and K29.CG other bump:2.87953 Ang N4.CG and K28.CD other bump:2.56843 Ang N4.ND2 and K28.CD other bump:2.69794 Ang N4.OD1 and K28.CB other bump:2.78354 Ang I22.CG2 and N27.ND2 other bump:2.83123 Ang I22.CG2 and N27.CG other bump:2.55965 Ang I22.CG2 and N27.CB other bump:2.12886 Ang N9.CG and T11.OG1 other bump:1.26249 Ang N9.OD1 and T11.OG1 other bump:2.40651 Ang N9.OD1 and T11.CB T0191 86 :LDGVDIIINATPIGMYPNIDVEPIVKAEKL 1gegA 77 :LGGFDVIVNNAGVAPSTPIESITPEIVDKV Fragment has 26 clashes (null) has 26 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 32 residues other bump:1.89471 Ang I25.CG1 and E29.OE2 other bump:2.18272 Ang I25.CD1 and E29.OE2 other bump:2.42293 Ang I25.O and E29.OE2 other bump:2.78434 Ang V26.CA and E29.OE1 other bump:0.976067 Ang I25.O and E29.OE1 other bump:1.92808 Ang I25.C and E29.OE1 other bump:2.95778 Ang I25.CG1 and E29.CD other bump:1.88106 Ang I25.O and E29.CD other bump:2.81622 Ang I25.C and E29.CD other bump:2.63461 Ang M16.SD and K27.NZ other bump:1.56368 Ang M16.CE and K27.NZ other bump:2.88386 Ang M16.CE and K27.CE other bump:2.92791 Ang P24.CG and K27.CD other bump:2.6561 Ang P24.CD and K27.CD other bump:2.95736 Ang P24.CG and K27.CG neighbor-bump: 1.99253 Ang Y17.C and P18.CD neighbor-bump: 2.49673 Ang Y17.C and P18.CG other bump:2.01595 Ang A11.O and P13.CD other bump:2.66032 Ang A11.C and P13.CD neighbor-bump: 2.15168 Ang T12.O and P13.CD neighbor-bump: 2.00296 Ang T12.CA and P13.CD neighbor-bump: 1.32553 Ang T12.C and P13.CD other bump:2.23158 Ang A11.O and P13.CG other bump:3.13336 Ang A11.C and P13.CG neighbor-bump: 2.2263 Ang T12.O and P13.CG neighbor-bump: 2.20272 Ang T12.C and P13.CG Number of specific fragments= 4 total=1217 Number of alignments=237 # Reading fragments from alignment file # T0191 read from T0191-1gegA-local-adpstyle5.pw.a2m.gz # 1gegA read from T0191-1gegA-local-adpstyle5.pw.a2m.gz # found chain 1gegA in template set T0191 24 :KNIVIYGAG 1gegA 3 :KVALVTGAG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues T0191 33 :GAARAVAFELAK 1gegA 13 :GIGKAIALRLVK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGLDVD 1gegA 26 :GFAVAIADYNDATAKAVASEINQAGGHAVAVKVDVSDRDQV Fragment has 32 clashes (null) has 32 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 43 residues other bump:2.61574 Ang V34.CG2 and V41.CG1 other bump:2.09426 Ang V12.CG1 and E33.OE2 other bump:2.9359 Ang V12.CG1 and E33.CD other bump:1.10458 Ang L18.O and K29.NZ other bump:2.92713 Ang I22.CG1 and K29.NZ other bump:2.43746 Ang A19.N and K29.NZ other bump:2.30579 Ang A19.CA and K29.NZ other bump:2.13947 Ang A19.C and K29.NZ other bump:1.97321 Ang L18.C and K29.NZ other bump:2.51833 Ang I22.CB and K29.CE other bump:2.97804 Ang I22.CG1 and K29.CE other bump:2.01908 Ang A19.CA and K29.CE other bump:1.64907 Ang A19.O and K29.CE other bump:1.91244 Ang A19.C and K29.CE other bump:3.07408 Ang L18.C and K29.CE other bump:3.23272 Ang I22.CG1 and K29.CD other bump:2.81068 Ang I22.CD1 and K29.CD other bump:2.93745 Ang A19.N and K29.CD other bump:2.03154 Ang A19.CA and K29.CD other bump:2.84717 Ang A19.C and K29.CD other bump:2.89385 Ang A19.CB and K29.CD other bump:2.80244 Ang A19.CA and K29.CG other bump:2.92437 Ang A19.CB and K29.CG other bump:2.87953 Ang N4.CG and K28.CD other bump:2.56843 Ang N4.ND2 and K28.CD other bump:2.69794 Ang N4.OD1 and K28.CB other bump:2.78354 Ang I22.CG2 and N27.ND2 other bump:2.83123 Ang I22.CG2 and N27.CG other bump:2.55965 Ang I22.CG2 and N27.CB other bump:2.12886 Ang N9.CG and T11.OG1 other bump:1.26249 Ang N9.OD1 and T11.OG1 other bump:2.40651 Ang N9.OD1 and T11.CB T0191 86 :LDGVDIIINATPIGMYPNIDVEPIVKAEK 1gegA 77 :LGGFDVIVNNAGVAPSTPIESITPEIVDK Fragment has 26 clashes (null) has 26 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 31 residues other bump:1.89471 Ang I25.CG1 and E29.OE2 other bump:2.18272 Ang I25.CD1 and E29.OE2 other bump:2.42293 Ang I25.O and E29.OE2 other bump:2.78434 Ang V26.CA and E29.OE1 other bump:0.976067 Ang I25.O and E29.OE1 other bump:1.92808 Ang I25.C and E29.OE1 other bump:2.95778 Ang I25.CG1 and E29.CD other bump:1.88106 Ang I25.O and E29.CD other bump:2.81622 Ang I25.C and E29.CD other bump:2.63461 Ang M16.SD and K27.NZ other bump:1.56368 Ang M16.CE and K27.NZ other bump:2.88386 Ang M16.CE and K27.CE other bump:2.92791 Ang P24.CG and K27.CD other bump:2.6561 Ang P24.CD and K27.CD other bump:2.95736 Ang P24.CG and K27.CG neighbor-bump: 1.99253 Ang Y17.C and P18.CD neighbor-bump: 2.49673 Ang Y17.C and P18.CG other bump:2.01595 Ang A11.O and P13.CD other bump:2.66032 Ang A11.C and P13.CD neighbor-bump: 2.15168 Ang T12.O and P13.CD neighbor-bump: 2.00296 Ang T12.CA and P13.CD neighbor-bump: 1.32553 Ang T12.C and P13.CD other bump:2.23158 Ang A11.O and P13.CG other bump:3.13336 Ang A11.C and P13.CG neighbor-bump: 2.2263 Ang T12.O and P13.CG neighbor-bump: 2.20272 Ang T12.C and P13.CG T0191 140 :VNAK 1gegA 106 :VYNI Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 6 residues Number of specific fragments= 5 total=1222 Number of alignments=238 # Reading fragments from alignment file # T0191 read from T0191-1gegA-simpleSW-adpstyle1.pw.a2m.gz # 1gegA read from T0191-1gegA-simpleSW-adpstyle1.pw.a2m.gz # found chain 1gegA in template set T0191 33 :GAARAVAFELAKDN 1gegA 13 :GIGKAIALRLVKDG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 16 residues T0191 47 :NIIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGLD 1gegA 28 :AVAIADYNDATAKAVASEINQAGGHAVAVKVDVSDRD Fragment has 32 clashes (null) has 32 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 39 residues other bump:2.09426 Ang V10.CG1 and E31.OE2 other bump:2.9359 Ang V10.CG1 and E31.CD other bump:1.10458 Ang L16.O and K27.NZ other bump:2.92713 Ang I20.CG1 and K27.NZ other bump:1.97321 Ang L16.C and K27.NZ other bump:2.43746 Ang A17.N and K27.NZ other bump:2.30579 Ang A17.CA and K27.NZ other bump:2.13947 Ang A17.C and K27.NZ other bump:1.64907 Ang A17.O and K27.CE other bump:2.51833 Ang I20.CB and K27.CE other bump:2.97804 Ang I20.CG1 and K27.CE other bump:3.07408 Ang L16.C and K27.CE other bump:2.01908 Ang A17.CA and K27.CE other bump:1.91244 Ang A17.C and K27.CE other bump:3.23272 Ang I20.CG1 and K27.CD other bump:2.81068 Ang I20.CD1 and K27.CD other bump:2.93745 Ang A17.N and K27.CD other bump:2.03154 Ang A17.CA and K27.CD other bump:2.84717 Ang A17.C and K27.CD other bump:2.89385 Ang A17.CB and K27.CD other bump:2.80244 Ang A17.CA and K27.CG other bump:2.92437 Ang A17.CB and K27.CG other bump:2.51821 Ang N2.OD1 and K26.CE other bump:2.94837 Ang N2.CG and K26.CD other bump:1.72232 Ang N2.OD1 and K26.CD other bump:2.38162 Ang N2.OD1 and K26.CG other bump:2.78354 Ang I20.CG2 and N25.ND2 other bump:2.83123 Ang I20.CG2 and N25.CG other bump:2.55965 Ang I20.CG2 and N25.CB other bump:2.12886 Ang N7.CG and T9.OG1 other bump:1.26249 Ang N7.OD1 and T9.OG1 other bump:2.40651 Ang N7.OD1 and T9.CB Number of specific fragments= 2 total=1224 Number of alignments=239 # Reading fragments from alignment file # T0191 read from T0191-1gegA-simpleSW-adpstyle5.pw.a2m.gz # 1gegA read from T0191-1gegA-simpleSW-adpstyle5.pw.a2m.gz # found chain 1gegA in template set T0191 27 :VIYGAG 1gegA 6 :LVTGAG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 8 residues T0191 33 :GAARAVAFELAKDNN 1gegA 13 :GIGKAIALRLVKDGF Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 17 residues T0191 48 :IIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGLD 1gegA 29 :VAIADYNDATAKAVASEINQAGGHAVAVKVDVSDRD Fragment has 28 clashes (null) has 28 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 38 residues other bump:2.09426 Ang V9.CG1 and E30.OE2 other bump:2.9359 Ang V9.CG1 and E30.CD other bump:1.10458 Ang L15.O and K26.NZ other bump:2.92713 Ang I19.CG1 and K26.NZ other bump:1.97321 Ang L15.C and K26.NZ other bump:2.43746 Ang A16.N and K26.NZ other bump:2.30579 Ang A16.CA and K26.NZ other bump:2.13947 Ang A16.C and K26.NZ other bump:1.64907 Ang A16.O and K26.CE other bump:2.51833 Ang I19.CB and K26.CE other bump:2.97804 Ang I19.CG1 and K26.CE other bump:3.07408 Ang L15.C and K26.CE other bump:2.01908 Ang A16.CA and K26.CE other bump:1.91244 Ang A16.C and K26.CE other bump:3.23272 Ang I19.CG1 and K26.CD other bump:2.81068 Ang I19.CD1 and K26.CD other bump:2.93745 Ang A16.N and K26.CD other bump:2.03154 Ang A16.CA and K26.CD other bump:2.84717 Ang A16.C and K26.CD other bump:2.89385 Ang A16.CB and K26.CD other bump:2.80244 Ang A16.CA and K26.CG other bump:2.92437 Ang A16.CB and K26.CG other bump:2.78354 Ang I19.CG2 and N24.ND2 other bump:2.83123 Ang I19.CG2 and N24.CG other bump:2.55965 Ang I19.CG2 and N24.CB other bump:2.12886 Ang N6.CG and T8.OG1 other bump:1.26249 Ang N6.OD1 and T8.OG1 other bump:2.40651 Ang N6.OD1 and T8.CB T0191 85 :DLDGVDIIINAT 1gegA 76 :TLGGFDVIVNNA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues T0191 99 :GMYPNIDVEPI 1gegA 88 :GVAPSTPIESI Fragment has 13 clashes (null) has 13 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 13 residues other bump:3.10729 Ang I7.CD1 and I12.CG1 neighbor-bump: 2.48731 Ang E10.CG and P11.CD neighbor-bump: 2.92915 Ang E10.CD and P11.CD other bump:2.9082 Ang V9.C and P11.CD neighbor-bump: 2.23371 Ang E10.N and P11.CD neighbor-bump: 2.25998 Ang E10.CA and P11.CD neighbor-bump: 2.82026 Ang E10.CB and P11.CD neighbor-bump: 1.89368 Ang E10.C and P11.CD self-bump: 1.28399 Ang P11.N and P11.CD neighbor-bump: 2.95036 Ang E10.CG and P11.CG self-bump: 2.14948 Ang P11.N and P11.CG neighbor-bump: 2.67851 Ang N6.C and I7.CG2 neighbor-bump: 2.44993 Ang N6.O and I7.CG2 Number of specific fragments= 5 total=1229 Number of alignments=240 # Reading fragments from alignment file # T0191 read from T0191-1gegA-vit-adpstyle1.pw.a2m.gz # 1gegA read from T0191-1gegA-vit-adpstyle1.pw.a2m.gz # found chain 1gegA in template set T0191 24 :KNIVIYGAG 1gegA 3 :KVALVTGAG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues T0191 33 :GAARAVAFELAK 1gegA 13 :GIGKAIALRLVK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGLDVD 1gegA 26 :GFAVAIADYNDATAKAVASEINQAGGHAVAVKVDVSDRDQV Fragment has 32 clashes (null) has 32 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 43 residues other bump:2.61574 Ang V34.CG2 and V41.CG1 other bump:2.09426 Ang V12.CG1 and E33.OE2 other bump:2.9359 Ang V12.CG1 and E33.CD other bump:1.10458 Ang L18.O and K29.NZ other bump:2.92713 Ang I22.CG1 and K29.NZ other bump:2.43746 Ang A19.N and K29.NZ other bump:2.30579 Ang A19.CA and K29.NZ other bump:2.13947 Ang A19.C and K29.NZ other bump:1.97321 Ang L18.C and K29.NZ other bump:2.51833 Ang I22.CB and K29.CE other bump:2.97804 Ang I22.CG1 and K29.CE other bump:2.01908 Ang A19.CA and K29.CE other bump:1.64907 Ang A19.O and K29.CE other bump:1.91244 Ang A19.C and K29.CE other bump:3.07408 Ang L18.C and K29.CE other bump:3.23272 Ang I22.CG1 and K29.CD other bump:2.81068 Ang I22.CD1 and K29.CD other bump:2.93745 Ang A19.N and K29.CD other bump:2.03154 Ang A19.CA and K29.CD other bump:2.84717 Ang A19.C and K29.CD other bump:2.89385 Ang A19.CB and K29.CD other bump:2.80244 Ang A19.CA and K29.CG other bump:2.92437 Ang A19.CB and K29.CG other bump:2.87953 Ang N4.CG and K28.CD other bump:2.56843 Ang N4.ND2 and K28.CD other bump:2.69794 Ang N4.OD1 and K28.CB other bump:2.78354 Ang I22.CG2 and N27.ND2 other bump:2.83123 Ang I22.CG2 and N27.CG other bump:2.55965 Ang I22.CG2 and N27.CB other bump:2.12886 Ang N9.CG and T11.OG1 other bump:1.26249 Ang N9.OD1 and T11.OG1 other bump:2.40651 Ang N9.OD1 and T11.CB T0191 86 :LDGVDIIINATPIGMYPNIDVEPIVKAEKL 1gegA 77 :LGGFDVIVNNAGVAPSTPIESITPEIVDKV Fragment has 26 clashes (null) has 26 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 32 residues other bump:1.89471 Ang I25.CG1 and E29.OE2 other bump:2.18272 Ang I25.CD1 and E29.OE2 other bump:2.42293 Ang I25.O and E29.OE2 other bump:2.78434 Ang V26.CA and E29.OE1 other bump:0.976067 Ang I25.O and E29.OE1 other bump:1.92808 Ang I25.C and E29.OE1 other bump:2.95778 Ang I25.CG1 and E29.CD other bump:1.88106 Ang I25.O and E29.CD other bump:2.81622 Ang I25.C and E29.CD other bump:2.63461 Ang M16.SD and K27.NZ other bump:1.56368 Ang M16.CE and K27.NZ other bump:2.88386 Ang M16.CE and K27.CE other bump:2.92791 Ang P24.CG and K27.CD other bump:2.6561 Ang P24.CD and K27.CD other bump:2.95736 Ang P24.CG and K27.CG neighbor-bump: 1.99253 Ang Y17.C and P18.CD neighbor-bump: 2.49673 Ang Y17.C and P18.CG other bump:2.01595 Ang A11.O and P13.CD other bump:2.66032 Ang A11.C and P13.CD neighbor-bump: 2.15168 Ang T12.O and P13.CD neighbor-bump: 2.00296 Ang T12.CA and P13.CD neighbor-bump: 1.32553 Ang T12.C and P13.CD other bump:2.23158 Ang A11.O and P13.CG other bump:3.13336 Ang A11.C and P13.CG neighbor-bump: 2.2263 Ang T12.O and P13.CG neighbor-bump: 2.20272 Ang T12.C and P13.CG Number of specific fragments= 4 total=1233 Number of alignments=241 # Reading fragments from alignment file # T0191 read from T0191-1gegA-vit-adpstyle5.pw.a2m.gz # 1gegA read from T0191-1gegA-vit-adpstyle5.pw.a2m.gz # found chain 1gegA in template set T0191 24 :KNIVIYGAG 1gegA 3 :KVALVTGAG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues T0191 33 :GAARAVAFELAK 1gegA 13 :GIGKAIALRLVK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGLDVD 1gegA 26 :GFAVAIADYNDATAKAVASEINQAGGHAVAVKVDVSDRDQV Fragment has 32 clashes (null) has 32 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 43 residues other bump:2.61574 Ang V34.CG2 and V41.CG1 other bump:2.09426 Ang V12.CG1 and E33.OE2 other bump:2.9359 Ang V12.CG1 and E33.CD other bump:1.10458 Ang L18.O and K29.NZ other bump:2.92713 Ang I22.CG1 and K29.NZ other bump:2.43746 Ang A19.N and K29.NZ other bump:2.30579 Ang A19.CA and K29.NZ other bump:2.13947 Ang A19.C and K29.NZ other bump:1.97321 Ang L18.C and K29.NZ other bump:2.51833 Ang I22.CB and K29.CE other bump:2.97804 Ang I22.CG1 and K29.CE other bump:2.01908 Ang A19.CA and K29.CE other bump:1.64907 Ang A19.O and K29.CE other bump:1.91244 Ang A19.C and K29.CE other bump:3.07408 Ang L18.C and K29.CE other bump:3.23272 Ang I22.CG1 and K29.CD other bump:2.81068 Ang I22.CD1 and K29.CD other bump:2.93745 Ang A19.N and K29.CD other bump:2.03154 Ang A19.CA and K29.CD other bump:2.84717 Ang A19.C and K29.CD other bump:2.89385 Ang A19.CB and K29.CD other bump:2.80244 Ang A19.CA and K29.CG other bump:2.92437 Ang A19.CB and K29.CG other bump:2.87953 Ang N4.CG and K28.CD other bump:2.56843 Ang N4.ND2 and K28.CD other bump:2.69794 Ang N4.OD1 and K28.CB other bump:2.78354 Ang I22.CG2 and N27.ND2 other bump:2.83123 Ang I22.CG2 and N27.CG other bump:2.55965 Ang I22.CG2 and N27.CB other bump:2.12886 Ang N9.CG and T11.OG1 other bump:1.26249 Ang N9.OD1 and T11.OG1 other bump:2.40651 Ang N9.OD1 and T11.CB T0191 86 :LDGVDIIINATPIGMYPNIDVEPIVKAEK 1gegA 77 :LGGFDVIVNNAGVAPSTPIESITPEIVDK Fragment has 26 clashes (null) has 26 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 31 residues other bump:1.89471 Ang I25.CG1 and E29.OE2 other bump:2.18272 Ang I25.CD1 and E29.OE2 other bump:2.42293 Ang I25.O and E29.OE2 other bump:2.78434 Ang V26.CA and E29.OE1 other bump:0.976067 Ang I25.O and E29.OE1 other bump:1.92808 Ang I25.C and E29.OE1 other bump:2.95778 Ang I25.CG1 and E29.CD other bump:1.88106 Ang I25.O and E29.CD other bump:2.81622 Ang I25.C and E29.CD other bump:2.63461 Ang M16.SD and K27.NZ other bump:1.56368 Ang M16.CE and K27.NZ other bump:2.88386 Ang M16.CE and K27.CE other bump:2.92791 Ang P24.CG and K27.CD other bump:2.6561 Ang P24.CD and K27.CD other bump:2.95736 Ang P24.CG and K27.CG neighbor-bump: 1.99253 Ang Y17.C and P18.CD neighbor-bump: 2.49673 Ang Y17.C and P18.CG other bump:2.01595 Ang A11.O and P13.CD other bump:2.66032 Ang A11.C and P13.CD neighbor-bump: 2.15168 Ang T12.O and P13.CD neighbor-bump: 2.00296 Ang T12.CA and P13.CD neighbor-bump: 1.32553 Ang T12.C and P13.CD other bump:2.23158 Ang A11.O and P13.CG other bump:3.13336 Ang A11.C and P13.CG neighbor-bump: 2.2263 Ang T12.O and P13.CG neighbor-bump: 2.20272 Ang T12.C and P13.CG T0191 140 :VNAK 1gegA 106 :VYNI Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 6 residues Number of specific fragments= 5 total=1238 Number of alignments=242 # command:# Prefix for input files set to 1cydA/ # command:# reading script from file read-alignments.under # Reading fragments from alignment file # T0191 read from 1cydA-T0191-fssp-global-adpstyle1.pw.a2m.gz # 1cydA read from 1cydA-T0191-fssp-global-adpstyle1.pw.a2m.gz # found chain 1cydA in template set T0191 23 :DKNIVIYGA 1cydA 7 :GLRALVTGA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues T0191 32 :GGAARAVAFELA 1cydA 17 :KGIGRDTVKALH Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues T0191 44 :KDNNIIIANRTVEKAEALAKEIA 1cydA 30 :SGAKVVAVTRTNSDLVSLAKECP Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 25 residues neighbor-bump: 3.05478 Ang E22.C and I23.CG1 other bump:2.79592 Ang I6.CD1 and I8.CD1 T0191 76 :EVKFSGLDV 1cydA 53 :GIEPVCVDL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues T0191 85 :DLDGVDIIINATPI 1cydA 73 :GIGPVDLLVNNAAL Fragment has 11 clashes (null) has 11 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 16 residues other bump:1.9689 Ang A12.O and P14.CD other bump:2.62767 Ang A12.C and P14.CD neighbor-bump: 2.1246 Ang T13.CA and P14.CD neighbor-bump: 2.20012 Ang T13.O and P14.CD neighbor-bump: 1.41579 Ang T13.C and P14.CD other bump:2.45057 Ang A12.O and P14.CG neighbor-bump: 2.39862 Ang T13.O and P14.CG neighbor-bump: 2.3511 Ang T13.C and P14.CG neighbor-bump: 2.47861 Ang D4.CB and G5.N self-bump: 2.19176 Ang D4.CB and D4.C self-bump: 1.29722 Ang D4.CA and D4.CB T0191 99 :GMYPNIDVEPIVKAEKLR 1cydA 103 :SFSVNLRSVFQVSQMVAR Fragment has 14 clashes (null) has 14 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 20 residues other bump:1.85516 Ang I7.O and P11.CD other bump:2.98857 Ang I7.C and P11.CD other bump:3.23922 Ang D8.CA and P11.CD other bump:2.91281 Ang D8.C and P11.CD other bump:2.22168 Ang N6.O and E10.OE2 other bump:2.34431 Ang N6.O and E10.OE1 other bump:2.61019 Ang N6.C and E10.OE1 other bump:2.28963 Ang I7.CA and E10.OE1 other bump:2.52467 Ang I7.C and E10.OE1 other bump:2.38596 Ang N6.O and E10.CD other bump:3.02201 Ang N6.C and E10.CD other bump:1.74944 Ang G1.O and P5.CD other bump:2.95339 Ang G1.C and P5.CD other bump:2.48587 Ang G1.O and P5.CG T0191 117 :EDMVVMDLIYNP 1cydA 127 :VPGSIVNVSSMV Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues neighbor-bump: 2.1811 Ang N12.N and P13.CD neighbor-bump: 2.13128 Ang N12.ND2 and P13.CD other bump:2.78915 Ang Y11.C and P13.CD neighbor-bump: 2.09424 Ang N12.C and P13.CD self-bump: 1.28005 Ang P13.N and P13.CD other bump:3.03103 Ang Y11.CB and P13.CD self-bump: 2.15233 Ang P13.N and P13.CG neighbor-bump: 2.50302 Ang I10.O and Y11.CD1 neighbor-bump: 2.47769 Ang I10.CB and Y11.N other bump:2.8714 Ang M4.CE and V6.CG1 T0191 129 :LETVLLKEAKKVN 1cydA 156 :MTMLTKAMAMELG Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues other bump:2.14999 Ang A10.O and N14.OD1 other bump:2.04852 Ang A10.O and N14.CG other bump:3.10993 Ang A10.C and N14.CG other bump:2.22263 Ang T4.CG2 and K8.NZ T0191 142 :AKTINGLGMLIYQGAVA 1cydA 227 :SASTSGGGILVDAGYLA Fragment has 15 clashes (null) has 15 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 19 residues other bump:2.92352 Ang Y13.CZ and V17.CB other bump:2.85696 Ang Y13.CD1 and V17.N other bump:2.42029 Ang Y13.CE1 and V17.N other bump:3.11559 Ang Y13.CZ and V17.N other bump:3.09203 Ang Y13.CE1 and A16.C other bump:2.85127 Ang Y13.CD1 and A16.CA other bump:2.06148 Ang Y13.CD1 and A16.N other bump:2.30766 Ang Y13.CE1 and A16.N other bump:2.62904 Ang Y13.CD1 and G15.C other bump:2.16855 Ang Y13.CE1 and G15.C other bump:3.08249 Ang Y13.CD1 and G15.CA other bump:2.6725 Ang Y13.CE1 and G15.CA other bump:2.96465 Ang L11.CB and Y13.CD2 other bump:1.90132 Ang M10.CE and I12.CD1 other bump:2.72175 Ang A2.CB and I5.CD1 Number of specific fragments= 9 total=1247 Number of alignments=243 # Reading fragments from alignment file # T0191 read from 1cydA-T0191-fssp-global-adpstyle5.pw.a2m.gz # 1cydA read from 1cydA-T0191-fssp-global-adpstyle5.pw.a2m.gz # found chain 1cydA in template set T0191 22 :KDKNIVIYGA 1cydA 6 :SGLRALVTGA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 12 residues T0191 32 :GGAARAVAFELA 1cydA 17 :KGIGRDTVKALH Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues T0191 44 :KDNNIIIANRTVEKAEALAKEI 1cydA 30 :SGAKVVAVTRTNSDLVSLAKEC Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 24 residues other bump:2.79592 Ang I6.CD1 and I8.CD1 T0191 76 :EVKFSG 1cydA 53 :GIEPVC Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 8 residues T0191 82 :LDVD 1cydA 71 :LGGI Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 6 residues other bump:2.39996 Ang L2.CD2 and D5.OD1 T0191 87 :DGVDIIINATPIGMYP 1cydA 75 :GPVDLLVNNAALVIMQ Fragment has 11 clashes (null) has 11 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 18 residues other bump:1.9689 Ang A10.O and P12.CD other bump:2.62767 Ang A10.C and P12.CD neighbor-bump: 2.1246 Ang T11.CA and P12.CD neighbor-bump: 2.20012 Ang T11.O and P12.CD neighbor-bump: 1.41579 Ang T11.C and P12.CD other bump:2.45057 Ang A10.O and P12.CG neighbor-bump: 2.39862 Ang T11.O and P12.CG neighbor-bump: 2.3511 Ang T11.C and P12.CG neighbor-bump: 2.47861 Ang D2.CB and G3.N self-bump: 2.19176 Ang D2.CB and D2.C self-bump: 1.29723 Ang D2.CA and D2.CB T0191 103 :NIDVEPIVKAEKLR 1cydA 108 :LRSVFQVSQMVARD Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 16 residues other bump:2.86978 Ang V9.CG1 and K13.CE other bump:3.26061 Ang V9.CG1 and K13.CD T0191 117 :EDMVVMDLIYNP 1cydA 127 :VPGSIVNVSSMV Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues neighbor-bump: 2.1811 Ang N12.N and P13.CD neighbor-bump: 2.13128 Ang N12.ND2 and P13.CD other bump:2.78915 Ang Y11.C and P13.CD neighbor-bump: 2.09424 Ang N12.C and P13.CD self-bump: 1.28005 Ang P13.N and P13.CD other bump:3.03103 Ang Y11.CB and P13.CD self-bump: 2.15233 Ang P13.N and P13.CG neighbor-bump: 2.50302 Ang I10.O and Y11.CD1 neighbor-bump: 2.47769 Ang I10.CB and Y11.N other bump:2.8714 Ang M4.CE and V6.CG1 T0191 129 :LETVLLKEA 1cydA 155 :AMTMLTKAM Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues T0191 138 :KKVN 1cydA 165 :MELG Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 6 residues other bump:2.14999 Ang G1.O and N5.OD1 other bump:2.04852 Ang G1.O and N5.CG other bump:3.10992 Ang G1.C and N5.CG T0191 142 :AKTINGLG 1cydA 171 :KIRVNSVN Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 10 residues other bump:2.84121 Ang T4.CG2 and N6.ND2 T0191 153 :YQGAVAFK 1cydA 236 :LVDAGYLA Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 9 residues neighbor-bump: 2.20443 Ang A5.O and V6.CB neighbor-bump: 2.49971 Ang A5.C and V6.CB Number of specific fragments= 12 total=1259 Number of alignments=244 # Reading fragments from alignment file # T0191 read from 1cydA-T0191-local-adpstyle1.pw.a2m.gz # 1cydA read from 1cydA-T0191-local-adpstyle1.pw.a2m.gz # found chain 1cydA in template set T0191 20 :RVKDKNIVIYGA 1cydA 4 :NFSGLRALVTGA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues T0191 32 :GGAARAVAFELAKDN 1cydA 17 :KGIGRDTVKALHASG Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 17 residues other bump:2.73524 Ang L12.CA and D15.OD2 other bump:2.23678 Ang L12.C and D15.OD2 other bump:1.33867 Ang L12.O and D15.OD2 other bump:2.99402 Ang L12.CA and D15.CG other bump:3.0217 Ang L12.C and D15.CG other bump:2.45245 Ang L12.O and D15.CG T0191 47 :NIIIANRTVEKAEALAKEI 1cydA 33 :KVVAVTRTNSDLVSLAKEC Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 21 residues other bump:2.7959 Ang I3.CD1 and I5.CD1 T0191 74 :G 1cydA 52 :P Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 3 residues T0191 78 :KFSGLDVDLDGVDIIINATP 1cydA 53 :GIEPVCVDLGDWDATEKALG Fragment has 18 clashes (null) has 18 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 22 residues neighbor-bump: 2.22161 Ang T20.N and P21.CD self-bump: 1.37006 Ang P21.N and P21.CD other bump:2.74493 Ang I17.C and P21.CD other bump:1.96108 Ang I17.O and P21.CD other bump:2.99231 Ang N18.C and P21.CD other bump:3.17635 Ang I17.CA and P21.CG other bump:2.05895 Ang I17.C and P21.CG other bump:0.852822 Ang I17.O and P21.CG other bump:2.94963 Ang N18.N and P21.CG other bump:3.17688 Ang N18.CA and P21.CG other bump:3.23286 Ang N18.C and P21.CG other bump:2.25755 Ang I17.O and P21.CB other bump:2.97545 Ang L10.CA and I16.CD1 other bump:2.34258 Ang L10.O and I16.CD1 other bump:2.75797 Ang L10.C and I16.CD1 other bump:2.29126 Ang D9.CG and D11.OD1 other bump:1.60877 Ang D9.OD1 and D11.OD1 other bump:2.50664 Ang D9.OD1 and D11.CG T0191 100 :MYPNIDV 1cydA 73 :GIGPVDL Fragment has 16 clashes (null) has 16 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 9 residues other bump:2.95214 Ang Y3.CZ and I6.CD1 other bump:1.76539 Ang Y3.OH and I6.CD1 other bump:2.67477 Ang Y3.CD1 and I6.CG2 other bump:1.36964 Ang Y3.CE1 and I6.CG2 other bump:1.88245 Ang Y3.CZ and I6.CG2 other bump:2.02941 Ang Y3.OH and I6.CG2 other bump:2.89464 Ang Y3.CZ and I6.CG1 other bump:1.64344 Ang Y3.OH and I6.CG1 other bump:2.86128 Ang Y3.CE1 and I6.CB other bump:2.93003 Ang Y3.CZ and I6.CB other bump:2.2562 Ang Y3.OH and I6.CB neighbor-bump: 2.0588 Ang Y3.O and P4.CD neighbor-bump: 1.87931 Ang Y3.C and P4.CD self-bump: 2.25442 Ang P4.CA and P4.CD other bump:2.48835 Ang M2.O and P4.CD self-bump: 1.25714 Ang P4.CA and P4.CB Number of specific fragments= 6 total=1265 Number of alignments=245 # Reading fragments from alignment file # T0191 read from 1cydA-T0191-local-adpstyle5.pw.a2m.gz # 1cydA read from 1cydA-T0191-local-adpstyle5.pw.a2m.gz # found chain 1cydA in template set T0191 20 :RVKDKNIVIYGAG 1cydA 4 :NFSGLRALVTGAG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues T0191 33 :GAARAVAFELAKDN 1cydA 18 :GIGRDTVKALHASG Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 16 residues other bump:2.73524 Ang L11.CA and D14.OD2 other bump:2.23678 Ang L11.C and D14.OD2 other bump:1.33867 Ang L11.O and D14.OD2 other bump:2.99402 Ang L11.CA and D14.CG other bump:3.0217 Ang L11.C and D14.CG other bump:2.45245 Ang L11.O and D14.CG T0191 47 :NIIIANRTVEKAEALAKEI 1cydA 33 :KVVAVTRTNSDLVSLAKEC Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 21 residues other bump:2.7959 Ang I3.CD1 and I5.CD1 T0191 74 :G 1cydA 52 :P Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 3 residues T0191 76 :EVKFSGLDV 1cydA 53 :GIEPVCVDL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues T0191 85 :DLDGVDIIINATPIGM 1cydA 73 :GIGPVDLLVNNAALVI Fragment has 11 clashes (null) has 11 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 18 residues other bump:1.9689 Ang A12.O and P14.CD other bump:2.62767 Ang A12.C and P14.CD neighbor-bump: 2.20012 Ang T13.O and P14.CD neighbor-bump: 2.1246 Ang T13.CA and P14.CD neighbor-bump: 1.41579 Ang T13.C and P14.CD other bump:2.45057 Ang A12.O and P14.CG neighbor-bump: 2.39862 Ang T13.O and P14.CG neighbor-bump: 2.3511 Ang T13.C and P14.CG neighbor-bump: 2.47861 Ang D4.CB and G5.N self-bump: 2.19176 Ang D4.CB and D4.C self-bump: 1.29722 Ang D4.CA and D4.CB Number of specific fragments= 6 total=1271 Number of alignments=246 # Reading fragments from alignment file # T0191 read from 1cydA-T0191-vit-adpstyle1.pw.a2m.gz # 1cydA read from 1cydA-T0191-vit-adpstyle1.pw.a2m.gz # found chain 1cydA in template set T0191 20 :RVKDKNIVIYGA 1cydA 4 :NFSGLRALVTGA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues T0191 32 :GGAARAVAFELAKDN 1cydA 17 :KGIGRDTVKALHASG Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 17 residues other bump:2.73524 Ang L12.CA and D15.OD2 other bump:2.23678 Ang L12.C and D15.OD2 other bump:1.33867 Ang L12.O and D15.OD2 other bump:2.99402 Ang L12.CA and D15.CG other bump:3.0217 Ang L12.C and D15.CG other bump:2.45245 Ang L12.O and D15.CG T0191 47 :NIIIANRTVEKAEALAKEI 1cydA 33 :KVVAVTRTNSDLVSLAKEC Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 21 residues other bump:2.7959 Ang I3.CD1 and I5.CD1 T0191 74 :G 1cydA 52 :P Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 3 residues T0191 78 :KFSGLDVDLDGVDIIINATP 1cydA 53 :GIEPVCVDLGDWDATEKALG Fragment has 18 clashes (null) has 18 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 22 residues neighbor-bump: 2.22161 Ang T20.N and P21.CD self-bump: 1.37006 Ang P21.N and P21.CD other bump:2.74493 Ang I17.C and P21.CD other bump:1.96108 Ang I17.O and P21.CD other bump:2.99231 Ang N18.C and P21.CD other bump:3.17635 Ang I17.CA and P21.CG other bump:2.05895 Ang I17.C and P21.CG other bump:0.852822 Ang I17.O and P21.CG other bump:2.94963 Ang N18.N and P21.CG other bump:3.17688 Ang N18.CA and P21.CG other bump:3.23286 Ang N18.C and P21.CG other bump:2.25755 Ang I17.O and P21.CB other bump:2.97545 Ang L10.CA and I16.CD1 other bump:2.34258 Ang L10.O and I16.CD1 other bump:2.75797 Ang L10.C and I16.CD1 other bump:2.29126 Ang D9.CG and D11.OD1 other bump:1.60877 Ang D9.OD1 and D11.OD1 other bump:2.50664 Ang D9.OD1 and D11.CG T0191 100 :MYPNIDV 1cydA 73 :GIGPVDL Fragment has 16 clashes (null) has 16 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 9 residues other bump:2.95214 Ang Y3.CZ and I6.CD1 other bump:1.76539 Ang Y3.OH and I6.CD1 other bump:2.67477 Ang Y3.CD1 and I6.CG2 other bump:1.36964 Ang Y3.CE1 and I6.CG2 other bump:1.88245 Ang Y3.CZ and I6.CG2 other bump:2.02941 Ang Y3.OH and I6.CG2 other bump:2.89464 Ang Y3.CZ and I6.CG1 other bump:1.64344 Ang Y3.OH and I6.CG1 other bump:2.86128 Ang Y3.CE1 and I6.CB other bump:2.93003 Ang Y3.CZ and I6.CB other bump:2.2562 Ang Y3.OH and I6.CB neighbor-bump: 2.0588 Ang Y3.O and P4.CD neighbor-bump: 1.87931 Ang Y3.C and P4.CD self-bump: 2.25442 Ang P4.CA and P4.CD other bump:2.48835 Ang M2.O and P4.CD self-bump: 1.25714 Ang P4.CA and P4.CB Number of specific fragments= 6 total=1277 Number of alignments=247 # Reading fragments from alignment file # T0191 read from 1cydA-T0191-vit-adpstyle5.pw.a2m.gz # 1cydA read from 1cydA-T0191-vit-adpstyle5.pw.a2m.gz # found chain 1cydA in template set T0191 20 :RVKDKNIVIYGAG 1cydA 4 :NFSGLRALVTGAG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues T0191 33 :GAARAVAFELAKDN 1cydA 18 :GIGRDTVKALHASG Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 16 residues other bump:2.73524 Ang L11.CA and D14.OD2 other bump:2.23678 Ang L11.C and D14.OD2 other bump:1.33867 Ang L11.O and D14.OD2 other bump:2.99402 Ang L11.CA and D14.CG other bump:3.0217 Ang L11.C and D14.CG other bump:2.45245 Ang L11.O and D14.CG T0191 47 :NIIIANRTVEKAEALAKEI 1cydA 33 :KVVAVTRTNSDLVSLAKEC Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 21 residues other bump:2.7959 Ang I3.CD1 and I5.CD1 T0191 74 :G 1cydA 52 :P Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 3 residues T0191 76 :EVKFSGLDV 1cydA 53 :GIEPVCVDL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues T0191 85 :DLDGVDIIINATPIGM 1cydA 73 :GIGPVDLLVNNAALVI Fragment has 11 clashes (null) has 11 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 18 residues other bump:1.9689 Ang A12.O and P14.CD other bump:2.62767 Ang A12.C and P14.CD neighbor-bump: 2.20012 Ang T13.O and P14.CD neighbor-bump: 2.1246 Ang T13.CA and P14.CD neighbor-bump: 1.41579 Ang T13.C and P14.CD other bump:2.45057 Ang A12.O and P14.CG neighbor-bump: 2.39862 Ang T13.O and P14.CG neighbor-bump: 2.3511 Ang T13.C and P14.CG neighbor-bump: 2.47861 Ang D4.CB and G5.N self-bump: 2.19176 Ang D4.CB and D4.C self-bump: 1.29722 Ang D4.CA and D4.CB Number of specific fragments= 6 total=1283 Number of alignments=248 # Reading fragments from alignment file # T0191 read from T0191-1cydA-2track-protein-EBGHSTL-global-adpstyle1.pw.a2m.gz # 1cydA read from T0191-1cydA-2track-protein-EBGHSTL-global-adpstyle1.pw.a2m.gz # found chain 1cydA in template set T0191 20 :RVKDKNIVIYGAG 1cydA 4 :NFSGLRALVTGAG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues T0191 33 :GAARAVAFELAK 1cydA 18 :GIGRDTVKALHA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKK 1cydA 31 :GAKVVAVTRTNSDLVSLAKECPGIEPVC Fragment has 28 clashes (null) has 28 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 30 residues other bump:2.35913 Ang V12.N and K29.NZ other bump:2.01342 Ang V12.CA and K29.NZ other bump:1.17289 Ang V12.CB and K29.NZ other bump:1.53911 Ang V12.CG1 and K29.NZ other bump:1.25603 Ang V12.CG2 and K29.NZ other bump:3.06242 Ang T11.C and K29.CE other bump:1.94247 Ang V12.N and K29.CE other bump:1.84487 Ang V12.CA and K29.CE other bump:1.71937 Ang V12.CB and K29.CE other bump:1.3082 Ang V12.CG1 and K29.CE other bump:2.69639 Ang V12.CG2 and K29.CE other bump:2.91086 Ang V12.CB and K29.CD other bump:1.67655 Ang V12.CG1 and K29.CD other bump:2.86538 Ang V12.CG1 and K29.CG other bump:2.48335 Ang I5.CD1 and K25.NZ other bump:2.18248 Ang I7.CG1 and K25.NZ other bump:1.72455 Ang I7.CD1 and K25.NZ other bump:2.2857 Ang I5.CD1 and K25.CE other bump:2.57236 Ang I5.CG1 and K25.CE other bump:2.09268 Ang I7.CG1 and K25.CE other bump:2.12582 Ang I7.CD1 and K25.CE other bump:2.88053 Ang I5.CD1 and K25.CD other bump:3.07312 Ang I5.CG1 and K25.CD other bump:3.15783 Ang I5.CG1 and K25.CG neighbor-bump: 2.28952 Ang A23.O and E24.CG neighbor-bump: 2.81687 Ang A23.C and E24.CG neighbor-bump: 3.05478 Ang E21.C and I22.CG1 other bump:2.79592 Ang I5.CD1 and I7.CD1 T0191 74 :GEEVKFSGLDVD 1cydA 59 :VDLGDWDATEKA Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:3.07981 Ang E4.CA and L10.CD2 other bump:2.63169 Ang E4.OE1 and L10.CD2 other bump:2.78259 Ang E4.CD and L10.CD2 other bump:2.95609 Ang E4.CA and L10.CD1 other bump:2.49321 Ang E4.O and L10.CD1 other bump:2.6863 Ang E3.CD and K6.CE other bump:2.41592 Ang E3.OE1 and K6.CE T0191 86 :LDGVDIIINATPIGMYPNIDVE 1cydA 125 :RGVPGSIVNVSSMVAHVTFPNL Fragment has 9 clashes (null) has 9 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 24 residues neighbor-bump: 2.64359 Ang D21.C and V22.CB neighbor-bump: 2.82523 Ang Y17.CB and P18.CD other bump:2.16934 Ang I14.O and P18.CD other bump:3.3358 Ang T12.CA and M16.SD other bump:2.59798 Ang T12.CB and M16.SD other bump:2.97612 Ang P13.CD and M16.SD neighbor-bump: 2.30704 Ang T12.CA and P13.CD neighbor-bump: 1.70213 Ang T12.C and P13.CD neighbor-bump: 2.47592 Ang T12.CB and P13.N T0191 108 :PIVKAEKLREDMVVMDLIYNPLE 1cydA 160 :TKAMAMELGPHKIRVNSVNPTVV Fragment has 27 clashes (null) has 27 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 25 residues self-bump: 2.21871 Ang P22.N and P22.CG other bump:2.85845 Ang L18.CB and Y20.OH other bump:1.5385 Ang L18.CG and Y20.OH other bump:0.995592 Ang L18.CD1 and Y20.OH other bump:1.85364 Ang L18.CD2 and Y20.OH other bump:1.76372 Ang L18.CG and Y20.CZ other bump:1.3799 Ang L18.CD1 and Y20.CZ other bump:2.54102 Ang L18.CD2 and Y20.CZ other bump:2.16087 Ang L18.CG and Y20.CE2 other bump:2.60251 Ang L18.CD1 and Y20.CE2 other bump:2.53206 Ang L18.CD2 and Y20.CE2 other bump:2.77042 Ang L18.CG and Y20.CE1 other bump:1.89325 Ang L18.CD1 and Y20.CE1 other bump:2.15469 Ang K5.NZ and M16.CE other bump:2.1214 Ang K5.CB and M16.CE other bump:2.31019 Ang K5.CG and M16.CE other bump:1.88613 Ang K5.CD and M16.CE other bump:1.12863 Ang K5.CE and M16.CE other bump:2.92519 Ang K5.CA and M16.SD other bump:2.64357 Ang K5.C and M16.SD other bump:2.16255 Ang K5.CB and M16.SD other bump:2.83191 Ang K5.CE and M16.SD neighbor-bump: 2.67566 Ang D12.C and M13.CB other bump:2.43018 Ang A6.O and R10.CD other bump:3.10026 Ang A6.C and R10.CD other bump:1.79271 Ang A6.O and R10.CG other bump:2.87315 Ang A6.C and R10.CG T0191 131 :TVLLKEAKKVNAKTINGLGMLIYQGAVAF 1cydA 195 :EFARKLKERHPLRKFAEVEDVVNSILFLL Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 31 residues self-bump: 1.38453 Ang N12.CA and N12.CB Number of specific fragments= 7 total=1290 Number of alignments=249 # Reading fragments from alignment file # T0191 read from T0191-1cydA-2track-protein-EBGHSTL-global-adpstyle5.pw.a2m.gz # 1cydA read from T0191-1cydA-2track-protein-EBGHSTL-global-adpstyle5.pw.a2m.gz # found chain 1cydA in template set T0191 20 :RVKDKNIVIYGAG 1cydA 4 :NFSGLRALVTGAG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues T0191 33 :GAARAVAFELAK 1cydA 18 :GIGRDTVKALHA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKK 1cydA 31 :GAKVVAVTRTNSDLVSLAKECPGIEPVC Fragment has 28 clashes (null) has 28 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 30 residues other bump:2.35913 Ang V12.N and K29.NZ other bump:2.01342 Ang V12.CA and K29.NZ other bump:1.17289 Ang V12.CB and K29.NZ other bump:1.53911 Ang V12.CG1 and K29.NZ other bump:1.25603 Ang V12.CG2 and K29.NZ other bump:3.06242 Ang T11.C and K29.CE other bump:1.94247 Ang V12.N and K29.CE other bump:1.84487 Ang V12.CA and K29.CE other bump:1.71937 Ang V12.CB and K29.CE other bump:1.3082 Ang V12.CG1 and K29.CE other bump:2.69639 Ang V12.CG2 and K29.CE other bump:2.91086 Ang V12.CB and K29.CD other bump:1.67655 Ang V12.CG1 and K29.CD other bump:2.86538 Ang V12.CG1 and K29.CG other bump:2.48335 Ang I5.CD1 and K25.NZ other bump:2.18248 Ang I7.CG1 and K25.NZ other bump:1.72455 Ang I7.CD1 and K25.NZ other bump:2.2857 Ang I5.CD1 and K25.CE other bump:2.57236 Ang I5.CG1 and K25.CE other bump:2.09268 Ang I7.CG1 and K25.CE other bump:2.12582 Ang I7.CD1 and K25.CE other bump:2.88053 Ang I5.CD1 and K25.CD other bump:3.07312 Ang I5.CG1 and K25.CD other bump:3.15783 Ang I5.CG1 and K25.CG neighbor-bump: 2.28952 Ang A23.O and E24.CG neighbor-bump: 2.81687 Ang A23.C and E24.CG neighbor-bump: 3.05478 Ang E21.C and I22.CG1 other bump:2.79592 Ang I5.CD1 and I7.CD1 T0191 74 :GEEVKFSGLDVD 1cydA 59 :VDLGDWDATEKA Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:3.07981 Ang E4.CA and L10.CD2 other bump:2.63169 Ang E4.OE1 and L10.CD2 other bump:2.78259 Ang E4.CD and L10.CD2 other bump:2.95609 Ang E4.CA and L10.CD1 other bump:2.49321 Ang E4.O and L10.CD1 other bump:2.6863 Ang E3.CD and K6.CE other bump:2.41592 Ang E3.OE1 and K6.CE T0191 89 :VDIIINATPIGMYPNIDVE 1cydA 77 :VDLLVNNAALVIMQPFLEV Fragment has 8 clashes (null) has 8 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 21 residues other bump:1.9689 Ang A8.O and P10.CD other bump:2.62767 Ang A8.C and P10.CD neighbor-bump: 2.1246 Ang T9.CA and P10.CD neighbor-bump: 2.20012 Ang T9.O and P10.CD neighbor-bump: 1.41579 Ang T9.C and P10.CD other bump:2.45057 Ang A8.O and P10.CG neighbor-bump: 2.39862 Ang T9.O and P10.CG neighbor-bump: 2.3511 Ang T9.C and P10.CG T0191 109 :IVKAEKLREDMVVMDLIYNPLE 1cydA 161 :KAMAMELGPHKIRVNSVNPTVV Fragment has 27 clashes (null) has 27 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 24 residues self-bump: 2.21871 Ang P21.N and P21.CG other bump:2.85845 Ang L17.CB and Y19.OH other bump:1.5385 Ang L17.CG and Y19.OH other bump:0.995592 Ang L17.CD1 and Y19.OH other bump:1.85364 Ang L17.CD2 and Y19.OH other bump:1.76372 Ang L17.CG and Y19.CZ other bump:1.3799 Ang L17.CD1 and Y19.CZ other bump:2.54102 Ang L17.CD2 and Y19.CZ other bump:2.16087 Ang L17.CG and Y19.CE2 other bump:2.60251 Ang L17.CD1 and Y19.CE2 other bump:2.53206 Ang L17.CD2 and Y19.CE2 other bump:2.77042 Ang L17.CG and Y19.CE1 other bump:1.89325 Ang L17.CD1 and Y19.CE1 other bump:2.15469 Ang K4.NZ and M15.CE other bump:2.1214 Ang K4.CB and M15.CE other bump:2.31019 Ang K4.CG and M15.CE other bump:1.88613 Ang K4.CD and M15.CE other bump:1.12863 Ang K4.CE and M15.CE other bump:2.92519 Ang K4.CA and M15.SD other bump:2.64357 Ang K4.C and M15.SD other bump:2.16255 Ang K4.CB and M15.SD other bump:2.83191 Ang K4.CE and M15.SD neighbor-bump: 2.67566 Ang D11.C and M12.CB other bump:2.43018 Ang A5.O and R9.CD other bump:3.10026 Ang A5.C and R9.CD other bump:1.79271 Ang A5.O and R9.CG other bump:2.87315 Ang A5.C and R9.CG T0191 131 :TVLLKEAKKVNAKTINGLGMLIYQGAV 1cydA 195 :EFARKLKERHPLRKFAEVEDVVNSILF Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 29 residues self-bump: 1.38453 Ang N12.CA and N12.CB Number of specific fragments= 7 total=1297 Number of alignments=250 # Reading fragments from alignment file # T0191 read from T0191-1cydA-2track-protein-EBGHSTL-local-adpstyle1.pw.a2m.gz # 1cydA read from T0191-1cydA-2track-protein-EBGHSTL-local-adpstyle1.pw.a2m.gz # found chain 1cydA in template set T0191 20 :RVKDKNIVIYGAG 1cydA 4 :NFSGLRALVTGAG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues T0191 33 :GAARAVAFELAK 1cydA 18 :GIGRDTVKALHA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKK 1cydA 31 :GAKVVAVTRTNSDLVSLAKECPGIEPVC Fragment has 28 clashes (null) has 28 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 30 residues other bump:2.35913 Ang V12.N and K29.NZ other bump:2.01342 Ang V12.CA and K29.NZ other bump:1.17289 Ang V12.CB and K29.NZ other bump:1.53911 Ang V12.CG1 and K29.NZ other bump:1.25603 Ang V12.CG2 and K29.NZ other bump:3.06242 Ang T11.C and K29.CE other bump:1.94247 Ang V12.N and K29.CE other bump:1.84487 Ang V12.CA and K29.CE other bump:1.71937 Ang V12.CB and K29.CE other bump:1.3082 Ang V12.CG1 and K29.CE other bump:2.69639 Ang V12.CG2 and K29.CE other bump:2.91086 Ang V12.CB and K29.CD other bump:1.67655 Ang V12.CG1 and K29.CD other bump:2.86538 Ang V12.CG1 and K29.CG other bump:2.48335 Ang I5.CD1 and K25.NZ other bump:2.18248 Ang I7.CG1 and K25.NZ other bump:1.72455 Ang I7.CD1 and K25.NZ other bump:2.2857 Ang I5.CD1 and K25.CE other bump:2.57236 Ang I5.CG1 and K25.CE other bump:2.09268 Ang I7.CG1 and K25.CE other bump:2.12582 Ang I7.CD1 and K25.CE other bump:2.88053 Ang I5.CD1 and K25.CD other bump:3.07312 Ang I5.CG1 and K25.CD other bump:3.15783 Ang I5.CG1 and K25.CG neighbor-bump: 2.28952 Ang A23.O and E24.CG neighbor-bump: 2.81687 Ang A23.C and E24.CG neighbor-bump: 3.05478 Ang E21.C and I22.CG1 other bump:2.79592 Ang I5.CD1 and I7.CD1 T0191 74 :GEEVKFSGLDVD 1cydA 59 :VDLGDWDATEKA Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:3.07981 Ang E4.CA and L10.CD2 other bump:2.63169 Ang E4.OE1 and L10.CD2 other bump:2.78259 Ang E4.CD and L10.CD2 other bump:2.95609 Ang E4.CA and L10.CD1 other bump:2.49321 Ang E4.O and L10.CD1 other bump:2.6863 Ang E3.CD and K6.CE other bump:2.41592 Ang E3.OE1 and K6.CE T0191 86 :LDGVDIIINATPIGMYPNIDVEPIVKAEK 1cydA 74 :IGPVDLLVNNAALVIMQPFLEVTKEAFDR Fragment has 19 clashes (null) has 19 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 31 residues other bump:1.99886 Ang P18.CG and K27.NZ other bump:2.20825 Ang P18.CD and K27.NZ other bump:2.95241 Ang P18.CG and K27.CE other bump:2.3839 Ang P18.CD and K27.CE other bump:2.87469 Ang P18.CG and K27.CD other bump:1.84345 Ang P18.CD and K27.CD other bump:2.9136 Ang P24.CG and K27.CG other bump:2.74651 Ang P18.CD and P24.CD other bump:1.9689 Ang A11.O and P13.CD other bump:2.62767 Ang A11.C and P13.CD neighbor-bump: 2.1246 Ang T12.CA and P13.CD neighbor-bump: 2.20012 Ang T12.O and P13.CD neighbor-bump: 1.41579 Ang T12.C and P13.CD other bump:2.45057 Ang A11.O and P13.CG neighbor-bump: 2.39862 Ang T12.O and P13.CG neighbor-bump: 2.3511 Ang T12.C and P13.CG neighbor-bump: 2.47861 Ang D3.CB and G4.N self-bump: 2.19176 Ang D3.CB and D3.C self-bump: 1.29723 Ang D3.CA and D3.CB Number of specific fragments= 5 total=1302 Number of alignments=251 # Reading fragments from alignment file # T0191 read from T0191-1cydA-2track-protein-EBGHSTL-local-adpstyle5.pw.a2m.gz # 1cydA read from T0191-1cydA-2track-protein-EBGHSTL-local-adpstyle5.pw.a2m.gz # found chain 1cydA in template set T0191 20 :RVKDKNIVIYGAG 1cydA 4 :NFSGLRALVTGAG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues T0191 33 :GAARAVAFELAK 1cydA 18 :GIGRDTVKALHA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKK 1cydA 31 :GAKVVAVTRTNSDLVSLAKECPGIEPVC Fragment has 28 clashes (null) has 28 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 30 residues other bump:2.35913 Ang V12.N and K29.NZ other bump:2.01342 Ang V12.CA and K29.NZ other bump:1.17289 Ang V12.CB and K29.NZ other bump:1.53911 Ang V12.CG1 and K29.NZ other bump:1.25603 Ang V12.CG2 and K29.NZ other bump:3.06242 Ang T11.C and K29.CE other bump:1.94247 Ang V12.N and K29.CE other bump:1.84487 Ang V12.CA and K29.CE other bump:1.71937 Ang V12.CB and K29.CE other bump:1.3082 Ang V12.CG1 and K29.CE other bump:2.69639 Ang V12.CG2 and K29.CE other bump:2.91086 Ang V12.CB and K29.CD other bump:1.67655 Ang V12.CG1 and K29.CD other bump:2.86538 Ang V12.CG1 and K29.CG other bump:2.48335 Ang I5.CD1 and K25.NZ other bump:2.18248 Ang I7.CG1 and K25.NZ other bump:1.72455 Ang I7.CD1 and K25.NZ other bump:2.2857 Ang I5.CD1 and K25.CE other bump:2.57236 Ang I5.CG1 and K25.CE other bump:2.09268 Ang I7.CG1 and K25.CE other bump:2.12582 Ang I7.CD1 and K25.CE other bump:2.88053 Ang I5.CD1 and K25.CD other bump:3.07312 Ang I5.CG1 and K25.CD other bump:3.15783 Ang I5.CG1 and K25.CG neighbor-bump: 2.28952 Ang A23.O and E24.CG neighbor-bump: 2.81687 Ang A23.C and E24.CG neighbor-bump: 3.05478 Ang E21.C and I22.CG1 other bump:2.79592 Ang I5.CD1 and I7.CD1 T0191 74 :GEEVKFSGLDVD 1cydA 59 :VDLGDWDATEKA Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:3.07981 Ang E4.CA and L10.CD2 other bump:2.63169 Ang E4.OE1 and L10.CD2 other bump:2.78259 Ang E4.CD and L10.CD2 other bump:2.95609 Ang E4.CA and L10.CD1 other bump:2.49321 Ang E4.O and L10.CD1 other bump:2.6863 Ang E3.CD and K6.CE other bump:2.41592 Ang E3.OE1 and K6.CE T0191 86 :LDGVDIIINATPIGMYPNIDVEPIV 1cydA 74 :IGPVDLLVNNAALVIMQPFLEVTKE Fragment has 12 clashes (null) has 12 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 27 residues other bump:2.74651 Ang P18.CD and P24.CD other bump:1.9689 Ang A11.O and P13.CD other bump:2.62767 Ang A11.C and P13.CD neighbor-bump: 2.1246 Ang T12.CA and P13.CD neighbor-bump: 2.20012 Ang T12.O and P13.CD neighbor-bump: 1.41579 Ang T12.C and P13.CD other bump:2.45057 Ang A11.O and P13.CG neighbor-bump: 2.39862 Ang T12.O and P13.CG neighbor-bump: 2.3511 Ang T12.C and P13.CG neighbor-bump: 2.47861 Ang D3.CB and G4.N self-bump: 2.19176 Ang D3.CB and D3.C self-bump: 1.29723 Ang D3.CA and D3.CB Number of specific fragments= 5 total=1307 Number of alignments=252 # Reading fragments from alignment file # T0191 read from T0191-1cydA-2track-protein-EBGHTL-global-adpstyle1.pw.a2m.gz # 1cydA read from T0191-1cydA-2track-protein-EBGHTL-global-adpstyle1.pw.a2m.gz # found chain 1cydA in template set T0191 20 :RVKDKNIVIYGAG 1cydA 4 :NFSGLRALVTGAG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues T0191 33 :GAARAVAFELAK 1cydA 18 :GIGRDTVKALHA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKK 1cydA 31 :GAKVVAVTRTNSDLVSLAKECPGIEPVC Fragment has 28 clashes (null) has 28 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 30 residues other bump:2.35913 Ang V12.N and K29.NZ other bump:2.01342 Ang V12.CA and K29.NZ other bump:1.17289 Ang V12.CB and K29.NZ other bump:1.53911 Ang V12.CG1 and K29.NZ other bump:1.25603 Ang V12.CG2 and K29.NZ other bump:3.06242 Ang T11.C and K29.CE other bump:1.94247 Ang V12.N and K29.CE other bump:1.84487 Ang V12.CA and K29.CE other bump:1.71937 Ang V12.CB and K29.CE other bump:1.3082 Ang V12.CG1 and K29.CE other bump:2.69639 Ang V12.CG2 and K29.CE other bump:2.91086 Ang V12.CB and K29.CD other bump:1.67655 Ang V12.CG1 and K29.CD other bump:2.86538 Ang V12.CG1 and K29.CG other bump:2.48335 Ang I5.CD1 and K25.NZ other bump:2.18248 Ang I7.CG1 and K25.NZ other bump:1.72455 Ang I7.CD1 and K25.NZ other bump:2.2857 Ang I5.CD1 and K25.CE other bump:2.57236 Ang I5.CG1 and K25.CE other bump:2.09268 Ang I7.CG1 and K25.CE other bump:2.12582 Ang I7.CD1 and K25.CE other bump:2.88053 Ang I5.CD1 and K25.CD other bump:3.07312 Ang I5.CG1 and K25.CD other bump:3.15783 Ang I5.CG1 and K25.CG neighbor-bump: 2.28952 Ang A23.O and E24.CG neighbor-bump: 2.81687 Ang A23.C and E24.CG neighbor-bump: 3.05478 Ang E21.C and I22.CG1 other bump:2.79592 Ang I5.CD1 and I7.CD1 T0191 74 :GEEVKFSGLDVD 1cydA 59 :VDLGDWDATEKA Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:3.07981 Ang E4.CA and L10.CD2 other bump:2.63169 Ang E4.OE1 and L10.CD2 other bump:2.78259 Ang E4.CD and L10.CD2 other bump:2.95609 Ang E4.CA and L10.CD1 other bump:2.49321 Ang E4.O and L10.CD1 other bump:2.6863 Ang E3.CD and K6.CE other bump:2.41592 Ang E3.OE1 and K6.CE T0191 86 :LDGVDIIINATPIGMYP 1cydA 167 :LGPHKIRVNSVNPTVVL Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 19 residues self-bump: 2.20303 Ang P18.CA and P18.CD neighbor-bump: 2.77485 Ang T12.C and P13.CG T0191 105 :DVE 1cydA 184 :TDM Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 5 residues T0191 108 :PIVKAEKLREDMVVMDLIYNPLETVLLKEAKKVNAKTINGLGMLIYQGAVA 1cydA 193 :DPEFARKLKERHPLRKFAEVEDVVNSILFLLSDRSASTSGGGILVDAGYLA Fragment has 84 clashes (null) has 84 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 53 residues other bump:2.92352 Ang Y47.CZ and V51.CB other bump:2.85696 Ang Y47.CD1 and V51.N other bump:2.42029 Ang Y47.CE1 and V51.N other bump:3.11559 Ang Y47.CZ and V51.N other bump:3.09203 Ang Y47.CE1 and A50.C other bump:2.07234 Ang M13.SD and A50.CB other bump:2.18365 Ang M13.CE and A50.CB other bump:2.36965 Ang M13.SD and A50.CA other bump:2.85127 Ang Y47.CD1 and A50.CA other bump:2.91809 Ang M13.SD and A50.N other bump:2.06148 Ang Y47.CD1 and A50.N other bump:2.30766 Ang Y47.CE1 and A50.N other bump:2.62904 Ang Y47.CD1 and G49.C other bump:2.16855 Ang Y47.CE1 and G49.C other bump:3.08249 Ang Y47.CD1 and G49.CA other bump:2.6725 Ang Y47.CE1 and G49.CA other bump:1.89283 Ang D17.O and Q48.NE2 other bump:2.59827 Ang D17.C and Q48.NE2 other bump:2.26194 Ang L18.CA and Q48.NE2 other bump:2.73171 Ang L18.C and Q48.NE2 other bump:2.45894 Ang D17.C and Q48.OE1 other bump:2.26714 Ang L18.N and Q48.OE1 other bump:2.22328 Ang L18.CA and Q48.OE1 other bump:1.55797 Ang L18.O and Q48.OE1 other bump:1.60786 Ang L18.C and Q48.OE1 other bump:2.25482 Ang D17.O and Q48.CD other bump:2.64829 Ang D17.C and Q48.CD other bump:2.81496 Ang L18.N and Q48.CD other bump:2.54303 Ang L18.CA and Q48.CD other bump:2.31235 Ang L18.C and Q48.CD other bump:2.74388 Ang I19.N and Q48.CD other bump:2.96465 Ang L45.CB and Y47.CD2 other bump:1.8315 Ang L27.CG and I46.CD1 other bump:1.90132 Ang M44.CE and I46.CD1 other bump:0.671855 Ang L27.CD1 and I46.CD1 other bump:2.76043 Ang L27.CB and I46.CD1 other bump:1.65529 Ang I19.CD1 and I46.CG2 other bump:1.78723 Ang L27.CD1 and I46.CG1 other bump:2.97555 Ang L27.CD1 and I46.CB other bump:3.07945 Ang I19.CD1 and I46.CB other bump:0.92932 Ang L27.CG and M44.CE other bump:1.46345 Ang L27.CD2 and M44.CE other bump:1.31817 Ang L27.CD1 and M44.CE other bump:1.74131 Ang L27.CB and M44.CE other bump:2.48793 Ang L27.CG and M44.SD other bump:1.48005 Ang L27.CD2 and M44.SD other bump:2.77222 Ang L27.CD1 and M44.SD other bump:2.72175 Ang A36.CB and I39.CD1 other bump:2.13954 Ang V34.CG1 and K37.NZ other bump:2.74095 Ang V34.C and K37.NZ other bump:1.7079 Ang V34.CB and K37.NZ other bump:1.58301 Ang V34.CA and K37.NZ other bump:1.93497 Ang V34.CG2 and K37.NZ other bump:2.7805 Ang V34.CG1 and K37.CE other bump:3.1711 Ang R10.CZ and L18.N other bump:2.1846 Ang R10.CZ and D17.C other bump:2.97721 Ang R10.CD and D17.C other bump:2.65225 Ang R10.NE and D17.C other bump:1.85732 Ang R10.NH1 and D17.C other bump:2.81623 Ang R10.CZ and D17.O other bump:1.85204 Ang R10.NH1 and D17.O other bump:2.348 Ang V15.CG1 and D17.OD1 other bump:2.0854 Ang R10.NH2 and D17.CG other bump:1.90595 Ang R10.CZ and D17.CB other bump:1.37666 Ang R10.NH2 and D17.CB other bump:2.64104 Ang R10.NE and D17.CB other bump:2.68097 Ang R10.NH1 and D17.CB other bump:0.820909 Ang R10.CZ and D17.CA other bump:1.59922 Ang R10.NH2 and D17.CA other bump:2.63343 Ang R10.CD and D17.CA other bump:1.61353 Ang R10.NE and D17.CA other bump:1.47053 Ang R10.NH1 and D17.CA other bump:0.909899 Ang R10.CZ and D17.N other bump:1.69095 Ang R10.NH2 and D17.N other bump:2.93754 Ang R10.CD and D17.N other bump:2.0685 Ang R10.NE and D17.N other bump:0.8298 Ang R10.NH1 and D17.N other bump:1.61979 Ang R10.CZ and M16.C other bump:1.80846 Ang R10.NH2 and M16.C other bump:2.31312 Ang R10.NE and M16.C other bump:2.11834 Ang R10.NH1 and M16.C other bump:1.99831 Ang R10.CZ and M16.O other bump:1.81552 Ang R10.NH2 and M16.O other bump:3.05422 Ang R10.CZ and M16.CA Number of specific fragments= 7 total=1314 Number of alignments=253 # Reading fragments from alignment file # T0191 read from T0191-1cydA-2track-protein-EBGHTL-global-adpstyle5.pw.a2m.gz # 1cydA read from T0191-1cydA-2track-protein-EBGHTL-global-adpstyle5.pw.a2m.gz # found chain 1cydA in template set T0191 20 :RVKDKNIVIYGAG 1cydA 4 :NFSGLRALVTGAG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues T0191 33 :GAARAVAFELAK 1cydA 18 :GIGRDTVKALHA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKK 1cydA 31 :GAKVVAVTRTNSDLVSLAKECPGIEPVC Fragment has 28 clashes (null) has 28 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 30 residues other bump:2.35913 Ang V12.N and K29.NZ other bump:2.01342 Ang V12.CA and K29.NZ other bump:1.17289 Ang V12.CB and K29.NZ other bump:1.53911 Ang V12.CG1 and K29.NZ other bump:1.25603 Ang V12.CG2 and K29.NZ other bump:3.06242 Ang T11.C and K29.CE other bump:1.94247 Ang V12.N and K29.CE other bump:1.84487 Ang V12.CA and K29.CE other bump:1.71937 Ang V12.CB and K29.CE other bump:1.3082 Ang V12.CG1 and K29.CE other bump:2.69639 Ang V12.CG2 and K29.CE other bump:2.91086 Ang V12.CB and K29.CD other bump:1.67655 Ang V12.CG1 and K29.CD other bump:2.86538 Ang V12.CG1 and K29.CG other bump:2.48335 Ang I5.CD1 and K25.NZ other bump:2.18248 Ang I7.CG1 and K25.NZ other bump:1.72455 Ang I7.CD1 and K25.NZ other bump:2.2857 Ang I5.CD1 and K25.CE other bump:2.57236 Ang I5.CG1 and K25.CE other bump:2.09268 Ang I7.CG1 and K25.CE other bump:2.12582 Ang I7.CD1 and K25.CE other bump:2.88053 Ang I5.CD1 and K25.CD other bump:3.07312 Ang I5.CG1 and K25.CD other bump:3.15783 Ang I5.CG1 and K25.CG neighbor-bump: 2.28952 Ang A23.O and E24.CG neighbor-bump: 2.81687 Ang A23.C and E24.CG neighbor-bump: 3.05478 Ang E21.C and I22.CG1 other bump:2.79592 Ang I5.CD1 and I7.CD1 T0191 74 :GEEVKFSGLDVD 1cydA 59 :VDLGDWDATEKA Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:3.07981 Ang E4.CA and L10.CD2 other bump:2.63169 Ang E4.OE1 and L10.CD2 other bump:2.78259 Ang E4.CD and L10.CD2 other bump:2.95609 Ang E4.CA and L10.CD1 other bump:2.49321 Ang E4.O and L10.CD1 other bump:2.6863 Ang E3.CD and K6.CE other bump:2.41592 Ang E3.OE1 and K6.CE T0191 86 :LDGVDIIINATPIGMYPNIDVE 1cydA 74 :IGPVDLLVNNAALVIMQPFLEV Fragment has 11 clashes (null) has 11 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 24 residues other bump:1.9689 Ang A11.O and P13.CD other bump:2.62767 Ang A11.C and P13.CD neighbor-bump: 2.1246 Ang T12.CA and P13.CD neighbor-bump: 2.20012 Ang T12.O and P13.CD neighbor-bump: 1.41579 Ang T12.C and P13.CD other bump:2.45057 Ang A11.O and P13.CG neighbor-bump: 2.39862 Ang T12.O and P13.CG neighbor-bump: 2.3511 Ang T12.C and P13.CG neighbor-bump: 2.47861 Ang D3.CB and G4.N self-bump: 2.19176 Ang D3.CB and D3.C self-bump: 1.29723 Ang D3.CA and D3.CB T0191 108 :PIVKAEKLREDMVVMDLIYNPLETVLLKEAK 1cydA 118 :VARDMINRGVPGSIVNVSSMVAHVTFPNLIT Fragment has 29 clashes (null) has 29 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 33 residues other bump:2.6737 Ang L27.CD1 and E30.OE2 other bump:2.25954 Ang L28.O and E30.OE2 other bump:2.65321 Ang L27.CD1 and E30.OE1 other bump:2.44321 Ang L27.C and E30.OE1 other bump:2.26464 Ang L27.O and E30.OE1 other bump:1.47778 Ang L28.O and E30.OE1 other bump:2.11837 Ang L28.C and E30.OE1 other bump:2.55655 Ang L27.CD1 and E30.CD other bump:2.03021 Ang L28.O and E30.CD neighbor-bump: 2.42202 Ang L28.CB and K29.N self-bump: 2.20098 Ang L28.CB and L28.C self-bump: 1.30193 Ang L28.CA and L28.CB other bump:2.88091 Ang I19.CB and L23.CD1 neighbor-bump: 2.09423 Ang N21.C and P22.CD self-bump: 1.28005 Ang P22.N and P22.CD neighbor-bump: 2.13128 Ang N21.ND2 and P22.CD other bump:3.03103 Ang Y20.CB and P22.CD other bump:2.78915 Ang Y20.C and P22.CD neighbor-bump: 2.1811 Ang N21.N and P22.CD self-bump: 2.15233 Ang P22.N and P22.CG neighbor-bump: 2.50302 Ang I19.O and Y20.CD1 neighbor-bump: 2.47769 Ang I19.CB and Y20.N other bump:2.8714 Ang M13.CE and V15.CG1 other bump:2.57276 Ang I3.CD1 and M13.CE other bump:2.43301 Ang I3.CD1 and M13.SD neighbor-bump: 2.70854 Ang L9.C and R10.CG neighbor-bump: 2.48507 Ang L9.C and R10.CB neighbor-bump: 2.23086 Ang L9.O and R10.CB other bump:2.84159 Ang V4.CG1 and K8.NZ T0191 139 :KV 1cydA 152 :TK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues T0191 147 :GLGMLIYQGAVA 1cydA 154 :GAMTMLTKAMAM Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues Number of specific fragments= 8 total=1322 Number of alignments=254 # Reading fragments from alignment file # T0191 read from T0191-1cydA-2track-protein-EBGHTL-local-adpstyle1.pw.a2m.gz # 1cydA read from T0191-1cydA-2track-protein-EBGHTL-local-adpstyle1.pw.a2m.gz # found chain 1cydA in template set T0191 20 :RVKDKNIVIYGAG 1cydA 4 :NFSGLRALVTGAG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues T0191 33 :GAARAVAFELAK 1cydA 18 :GIGRDTVKALHA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKK 1cydA 31 :GAKVVAVTRTNSDLVSLAKECPGIEPVC Fragment has 28 clashes (null) has 28 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 30 residues other bump:2.35913 Ang V12.N and K29.NZ other bump:2.01342 Ang V12.CA and K29.NZ other bump:1.17289 Ang V12.CB and K29.NZ other bump:1.53911 Ang V12.CG1 and K29.NZ other bump:1.25603 Ang V12.CG2 and K29.NZ other bump:3.06242 Ang T11.C and K29.CE other bump:1.94247 Ang V12.N and K29.CE other bump:1.84487 Ang V12.CA and K29.CE other bump:1.71937 Ang V12.CB and K29.CE other bump:1.3082 Ang V12.CG1 and K29.CE other bump:2.69639 Ang V12.CG2 and K29.CE other bump:2.91086 Ang V12.CB and K29.CD other bump:1.67655 Ang V12.CG1 and K29.CD other bump:2.86538 Ang V12.CG1 and K29.CG other bump:2.48335 Ang I5.CD1 and K25.NZ other bump:2.18248 Ang I7.CG1 and K25.NZ other bump:1.72455 Ang I7.CD1 and K25.NZ other bump:2.2857 Ang I5.CD1 and K25.CE other bump:2.57236 Ang I5.CG1 and K25.CE other bump:2.09268 Ang I7.CG1 and K25.CE other bump:2.12582 Ang I7.CD1 and K25.CE other bump:2.88053 Ang I5.CD1 and K25.CD other bump:3.07312 Ang I5.CG1 and K25.CD other bump:3.15783 Ang I5.CG1 and K25.CG neighbor-bump: 2.28952 Ang A23.O and E24.CG neighbor-bump: 2.81687 Ang A23.C and E24.CG neighbor-bump: 3.05478 Ang E21.C and I22.CG1 other bump:2.79592 Ang I5.CD1 and I7.CD1 T0191 74 :GEEVKFSGLDVD 1cydA 59 :VDLGDWDATEKA Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:3.07981 Ang E4.CA and L10.CD2 other bump:2.63169 Ang E4.OE1 and L10.CD2 other bump:2.78259 Ang E4.CD and L10.CD2 other bump:2.95609 Ang E4.CA and L10.CD1 other bump:2.49321 Ang E4.O and L10.CD1 other bump:2.6863 Ang E3.CD and K6.CE other bump:2.41592 Ang E3.OE1 and K6.CE T0191 86 :LDGVDIIINATPIGMYPNIDVEPIVKAEK 1cydA 74 :IGPVDLLVNNAALVIMQPFLEVTKEAFDR Fragment has 19 clashes (null) has 19 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 31 residues other bump:1.99886 Ang P18.CG and K27.NZ other bump:2.20825 Ang P18.CD and K27.NZ other bump:2.95241 Ang P18.CG and K27.CE other bump:2.3839 Ang P18.CD and K27.CE other bump:2.87469 Ang P18.CG and K27.CD other bump:1.84345 Ang P18.CD and K27.CD other bump:2.9136 Ang P24.CG and K27.CG other bump:2.74651 Ang P18.CD and P24.CD other bump:1.9689 Ang A11.O and P13.CD other bump:2.62767 Ang A11.C and P13.CD neighbor-bump: 2.1246 Ang T12.CA and P13.CD neighbor-bump: 2.20012 Ang T12.O and P13.CD neighbor-bump: 1.41579 Ang T12.C and P13.CD other bump:2.45057 Ang A11.O and P13.CG neighbor-bump: 2.39862 Ang T12.O and P13.CG neighbor-bump: 2.3511 Ang T12.C and P13.CG neighbor-bump: 2.47861 Ang D3.CB and G4.N self-bump: 2.19176 Ang D3.CB and D3.C self-bump: 1.29723 Ang D3.CA and D3.CB Number of specific fragments= 5 total=1327 Number of alignments=255 # Reading fragments from alignment file # T0191 read from T0191-1cydA-2track-protein-EBGHTL-local-adpstyle5.pw.a2m.gz # 1cydA read from T0191-1cydA-2track-protein-EBGHTL-local-adpstyle5.pw.a2m.gz # found chain 1cydA in template set T0191 20 :RVKDKNIVIYGAG 1cydA 4 :NFSGLRALVTGAG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues T0191 33 :GAARAVAFELAK 1cydA 18 :GIGRDTVKALHA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKK 1cydA 31 :GAKVVAVTRTNSDLVSLAKECPGIEPVC Fragment has 28 clashes (null) has 28 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 30 residues other bump:2.35913 Ang V12.N and K29.NZ other bump:2.01342 Ang V12.CA and K29.NZ other bump:1.17289 Ang V12.CB and K29.NZ other bump:1.53911 Ang V12.CG1 and K29.NZ other bump:1.25603 Ang V12.CG2 and K29.NZ other bump:3.06242 Ang T11.C and K29.CE other bump:1.94247 Ang V12.N and K29.CE other bump:1.84487 Ang V12.CA and K29.CE other bump:1.71937 Ang V12.CB and K29.CE other bump:1.3082 Ang V12.CG1 and K29.CE other bump:2.69639 Ang V12.CG2 and K29.CE other bump:2.91086 Ang V12.CB and K29.CD other bump:1.67655 Ang V12.CG1 and K29.CD other bump:2.86538 Ang V12.CG1 and K29.CG other bump:2.48335 Ang I5.CD1 and K25.NZ other bump:2.18248 Ang I7.CG1 and K25.NZ other bump:1.72455 Ang I7.CD1 and K25.NZ other bump:2.2857 Ang I5.CD1 and K25.CE other bump:2.57236 Ang I5.CG1 and K25.CE other bump:2.09268 Ang I7.CG1 and K25.CE other bump:2.12582 Ang I7.CD1 and K25.CE other bump:2.88053 Ang I5.CD1 and K25.CD other bump:3.07312 Ang I5.CG1 and K25.CD other bump:3.15783 Ang I5.CG1 and K25.CG neighbor-bump: 2.28952 Ang A23.O and E24.CG neighbor-bump: 2.81687 Ang A23.C and E24.CG neighbor-bump: 3.05478 Ang E21.C and I22.CG1 other bump:2.79592 Ang I5.CD1 and I7.CD1 T0191 74 :GEEVKFSGLDVD 1cydA 59 :VDLGDWDATEKA Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:3.07981 Ang E4.CA and L10.CD2 other bump:2.63169 Ang E4.OE1 and L10.CD2 other bump:2.78259 Ang E4.CD and L10.CD2 other bump:2.95609 Ang E4.CA and L10.CD1 other bump:2.49321 Ang E4.O and L10.CD1 other bump:2.6863 Ang E3.CD and K6.CE other bump:2.41592 Ang E3.OE1 and K6.CE T0191 86 :LDGVDIIINATPIGMYPNIDVEPIVKAE 1cydA 74 :IGPVDLLVNNAALVIMQPFLEVTKEAFD Fragment has 19 clashes (null) has 19 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 30 residues other bump:1.99886 Ang P18.CG and K27.NZ other bump:2.20825 Ang P18.CD and K27.NZ other bump:2.95241 Ang P18.CG and K27.CE other bump:2.3839 Ang P18.CD and K27.CE other bump:2.87469 Ang P18.CG and K27.CD other bump:1.84345 Ang P18.CD and K27.CD other bump:2.9136 Ang P24.CG and K27.CG other bump:2.74651 Ang P18.CD and P24.CD other bump:1.9689 Ang A11.O and P13.CD other bump:2.62767 Ang A11.C and P13.CD neighbor-bump: 2.1246 Ang T12.CA and P13.CD neighbor-bump: 2.20012 Ang T12.O and P13.CD neighbor-bump: 1.41579 Ang T12.C and P13.CD other bump:2.45057 Ang A11.O and P13.CG neighbor-bump: 2.39862 Ang T12.O and P13.CG neighbor-bump: 2.3511 Ang T12.C and P13.CG neighbor-bump: 2.47861 Ang D3.CB and G4.N self-bump: 2.19176 Ang D3.CB and D3.C self-bump: 1.29723 Ang D3.CA and D3.CB Number of specific fragments= 5 total=1332 Number of alignments=256 # Reading fragments from alignment file # T0191 read from T0191-1cydA-2track-protein-STR-global-adpstyle1.pw.a2m.gz # 1cydA read from T0191-1cydA-2track-protein-STR-global-adpstyle1.pw.a2m.gz # found chain 1cydA in template set T0191 20 :RVKDKNIVIYGAG 1cydA 4 :NFSGLRALVTGAG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues T0191 33 :GAARAVAFELAK 1cydA 18 :GIGRDTVKALHA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKK 1cydA 31 :GAKVVAVTRTNSDLVSLAKECPGIEPVC Fragment has 28 clashes (null) has 28 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 30 residues other bump:2.35913 Ang V12.N and K29.NZ other bump:2.01342 Ang V12.CA and K29.NZ other bump:1.17289 Ang V12.CB and K29.NZ other bump:1.53911 Ang V12.CG1 and K29.NZ other bump:1.25603 Ang V12.CG2 and K29.NZ other bump:3.06242 Ang T11.C and K29.CE other bump:1.94247 Ang V12.N and K29.CE other bump:1.84487 Ang V12.CA and K29.CE other bump:1.71937 Ang V12.CB and K29.CE other bump:1.3082 Ang V12.CG1 and K29.CE other bump:2.69639 Ang V12.CG2 and K29.CE other bump:2.91086 Ang V12.CB and K29.CD other bump:1.67655 Ang V12.CG1 and K29.CD other bump:2.86538 Ang V12.CG1 and K29.CG other bump:2.48335 Ang I5.CD1 and K25.NZ other bump:2.18248 Ang I7.CG1 and K25.NZ other bump:1.72455 Ang I7.CD1 and K25.NZ other bump:2.2857 Ang I5.CD1 and K25.CE other bump:2.57236 Ang I5.CG1 and K25.CE other bump:2.09268 Ang I7.CG1 and K25.CE other bump:2.12582 Ang I7.CD1 and K25.CE other bump:2.88053 Ang I5.CD1 and K25.CD other bump:3.07312 Ang I5.CG1 and K25.CD other bump:3.15783 Ang I5.CG1 and K25.CG neighbor-bump: 2.28952 Ang A23.O and E24.CG neighbor-bump: 2.81687 Ang A23.C and E24.CG neighbor-bump: 3.05478 Ang E21.C and I22.CG1 other bump:2.79592 Ang I5.CD1 and I7.CD1 T0191 74 :GEEVKFSGLDVD 1cydA 59 :VDLGDWDATEKA Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:3.07981 Ang E4.CA and L10.CD2 other bump:2.63169 Ang E4.OE1 and L10.CD2 other bump:2.78259 Ang E4.CD and L10.CD2 other bump:2.95609 Ang E4.CA and L10.CD1 other bump:2.49321 Ang E4.O and L10.CD1 other bump:2.6863 Ang E3.CD and K6.CE other bump:2.41592 Ang E3.OE1 and K6.CE T0191 86 :LDGVDIIINATPIGMYPNIDVE 1cydA 74 :IGPVDLLVNNAALVIMQPFLEV Fragment has 11 clashes (null) has 11 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 24 residues other bump:1.9689 Ang A11.O and P13.CD other bump:2.62767 Ang A11.C and P13.CD neighbor-bump: 2.1246 Ang T12.CA and P13.CD neighbor-bump: 2.20012 Ang T12.O and P13.CD neighbor-bump: 1.41579 Ang T12.C and P13.CD other bump:2.45057 Ang A11.O and P13.CG neighbor-bump: 2.39862 Ang T12.O and P13.CG neighbor-bump: 2.3511 Ang T12.C and P13.CG neighbor-bump: 2.47861 Ang D3.CB and G4.N self-bump: 2.19176 Ang D3.CB and D3.C self-bump: 1.29723 Ang D3.CA and D3.CB T0191 108 :PIVKAEKLREDMVVMDLIYNPLE 1cydA 118 :VARDMINRGVPGSIVNVSSMVAH Fragment has 17 clashes (null) has 17 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 25 residues other bump:2.88091 Ang I19.CB and L23.CD1 neighbor-bump: 2.1811 Ang N21.N and P22.CD neighbor-bump: 2.13128 Ang N21.ND2 and P22.CD neighbor-bump: 2.09423 Ang N21.C and P22.CD self-bump: 1.28005 Ang P22.N and P22.CD other bump:2.78915 Ang Y20.C and P22.CD other bump:3.03103 Ang Y20.CB and P22.CD self-bump: 2.15233 Ang P22.N and P22.CG neighbor-bump: 2.50302 Ang I19.O and Y20.CD1 neighbor-bump: 2.47769 Ang I19.CB and Y20.N other bump:2.8714 Ang M13.CE and V15.CG1 other bump:2.57276 Ang I3.CD1 and M13.CE other bump:2.43301 Ang I3.CD1 and M13.SD neighbor-bump: 2.70854 Ang L9.C and R10.CG neighbor-bump: 2.23086 Ang L9.O and R10.CB neighbor-bump: 2.48507 Ang L9.C and R10.CB other bump:2.84159 Ang V4.CG1 and K8.NZ T0191 131 :TVLLKEAKKVNAKTINGLGMLIYQGAVAFK 1cydA 144 :PNLITYSSTKGAMTMLTKAMAMELGPHKIR Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 31 residues other bump:2.51823 Ang V28.CG1 and F30.CE1 other bump:2.62653 Ang V28.CG1 and F30.CD1 other bump:2.21336 Ang G20.O and Y24.CD1 neighbor-bump: 2.6436 Ang T2.C and V3.CB Number of specific fragments= 7 total=1339 Number of alignments=257 # Reading fragments from alignment file # T0191 read from T0191-1cydA-2track-protein-STR-global-adpstyle5.pw.a2m.gz # 1cydA read from T0191-1cydA-2track-protein-STR-global-adpstyle5.pw.a2m.gz # found chain 1cydA in template set T0191 20 :RVKDKNIVIYGAG 1cydA 4 :NFSGLRALVTGAG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues T0191 33 :GAARAVAFELAK 1cydA 18 :GIGRDTVKALHA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKK 1cydA 31 :GAKVVAVTRTNSDLVSLAKECPGIEPVC Fragment has 28 clashes (null) has 28 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 30 residues other bump:2.35913 Ang V12.N and K29.NZ other bump:2.01342 Ang V12.CA and K29.NZ other bump:1.17289 Ang V12.CB and K29.NZ other bump:1.53911 Ang V12.CG1 and K29.NZ other bump:1.25603 Ang V12.CG2 and K29.NZ other bump:3.06242 Ang T11.C and K29.CE other bump:1.94247 Ang V12.N and K29.CE other bump:1.84487 Ang V12.CA and K29.CE other bump:1.71937 Ang V12.CB and K29.CE other bump:1.3082 Ang V12.CG1 and K29.CE other bump:2.69639 Ang V12.CG2 and K29.CE other bump:2.91086 Ang V12.CB and K29.CD other bump:1.67655 Ang V12.CG1 and K29.CD other bump:2.86538 Ang V12.CG1 and K29.CG other bump:2.48335 Ang I5.CD1 and K25.NZ other bump:2.18248 Ang I7.CG1 and K25.NZ other bump:1.72455 Ang I7.CD1 and K25.NZ other bump:2.2857 Ang I5.CD1 and K25.CE other bump:2.57236 Ang I5.CG1 and K25.CE other bump:2.09268 Ang I7.CG1 and K25.CE other bump:2.12582 Ang I7.CD1 and K25.CE other bump:2.88053 Ang I5.CD1 and K25.CD other bump:3.07312 Ang I5.CG1 and K25.CD other bump:3.15783 Ang I5.CG1 and K25.CG neighbor-bump: 2.28952 Ang A23.O and E24.CG neighbor-bump: 2.81687 Ang A23.C and E24.CG neighbor-bump: 3.05478 Ang E21.C and I22.CG1 other bump:2.79592 Ang I5.CD1 and I7.CD1 T0191 74 :GEEVKFSGLDVD 1cydA 59 :VDLGDWDATEKA Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:3.07981 Ang E4.CA and L10.CD2 other bump:2.63169 Ang E4.OE1 and L10.CD2 other bump:2.78259 Ang E4.CD and L10.CD2 other bump:2.95609 Ang E4.CA and L10.CD1 other bump:2.49321 Ang E4.O and L10.CD1 other bump:2.6863 Ang E3.CD and K6.CE other bump:2.41592 Ang E3.OE1 and K6.CE T0191 86 :LDGVDIIINATPIGMYPNIDVE 1cydA 74 :IGPVDLLVNNAALVIMQPFLEV Fragment has 11 clashes (null) has 11 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 24 residues other bump:1.9689 Ang A11.O and P13.CD other bump:2.62767 Ang A11.C and P13.CD neighbor-bump: 2.1246 Ang T12.CA and P13.CD neighbor-bump: 2.20012 Ang T12.O and P13.CD neighbor-bump: 1.41579 Ang T12.C and P13.CD other bump:2.45057 Ang A11.O and P13.CG neighbor-bump: 2.39862 Ang T12.O and P13.CG neighbor-bump: 2.3511 Ang T12.C and P13.CG neighbor-bump: 2.47861 Ang D3.CB and G4.N self-bump: 2.19176 Ang D3.CB and D3.C self-bump: 1.29723 Ang D3.CA and D3.CB T0191 108 :PIVKAEKLREDMVVMDL 1cydA 118 :VARDMINRGVPGSIVNV Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 19 residues other bump:2.8714 Ang M13.CE and V15.CG1 other bump:2.57276 Ang I3.CD1 and M13.CE other bump:2.43301 Ang I3.CD1 and M13.SD neighbor-bump: 2.70854 Ang L9.C and R10.CG neighbor-bump: 2.48507 Ang L9.C and R10.CB neighbor-bump: 2.23086 Ang L9.O and R10.CB other bump:2.84159 Ang V4.CG1 and K8.NZ T0191 125 :IYNPLETV 1cydA 136 :SMVAHVTF Fragment has 11 clashes (null) has 11 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 10 residues other bump:2.97458 Ang N4.CG and V9.CG2 other bump:2.09621 Ang N4.OD1 and V9.CG2 other bump:2.69464 Ang Y3.C and P5.CD other bump:1.59043 Ang I2.O and P5.CD other bump:3.28372 Ang I2.CA and P5.CD other bump:2.374 Ang I2.C and P5.CD neighbor-bump: 2.50644 Ang N4.N and P5.CD other bump:1.76404 Ang I2.O and P5.CG other bump:2.96441 Ang I2.C and P5.CG other bump:2.77415 Ang I2.CG2 and N4.N neighbor-bump: 3.02778 Ang G1.C and I2.CG1 T0191 133 :LLKEAKKVNAKTINGLGMLIYQ 1cydA 146 :LITYSSTKGAMTMLTKAMAMEL Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 24 residues other bump:2.21336 Ang G18.O and Y22.CD1 Number of specific fragments= 8 total=1347 Number of alignments=258 # Reading fragments from alignment file # T0191 read from T0191-1cydA-2track-protein-STR-local-adpstyle1.pw.a2m.gz # 1cydA read from T0191-1cydA-2track-protein-STR-local-adpstyle1.pw.a2m.gz # found chain 1cydA in template set T0191 20 :RVKDKNIVIYGAG 1cydA 4 :NFSGLRALVTGAG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues T0191 33 :GAARAVAFELAK 1cydA 18 :GIGRDTVKALHA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKK 1cydA 31 :GAKVVAVTRTNSDLVSLAKECPGIEPVC Fragment has 28 clashes (null) has 28 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 30 residues other bump:2.35913 Ang V12.N and K29.NZ other bump:2.01342 Ang V12.CA and K29.NZ other bump:1.17289 Ang V12.CB and K29.NZ other bump:1.53911 Ang V12.CG1 and K29.NZ other bump:1.25603 Ang V12.CG2 and K29.NZ other bump:3.06242 Ang T11.C and K29.CE other bump:1.94247 Ang V12.N and K29.CE other bump:1.84487 Ang V12.CA and K29.CE other bump:1.71937 Ang V12.CB and K29.CE other bump:1.3082 Ang V12.CG1 and K29.CE other bump:2.69639 Ang V12.CG2 and K29.CE other bump:2.91086 Ang V12.CB and K29.CD other bump:1.67655 Ang V12.CG1 and K29.CD other bump:2.86538 Ang V12.CG1 and K29.CG other bump:2.48335 Ang I5.CD1 and K25.NZ other bump:2.18248 Ang I7.CG1 and K25.NZ other bump:1.72455 Ang I7.CD1 and K25.NZ other bump:2.2857 Ang I5.CD1 and K25.CE other bump:2.57236 Ang I5.CG1 and K25.CE other bump:2.09268 Ang I7.CG1 and K25.CE other bump:2.12582 Ang I7.CD1 and K25.CE other bump:2.88053 Ang I5.CD1 and K25.CD other bump:3.07312 Ang I5.CG1 and K25.CD other bump:3.15783 Ang I5.CG1 and K25.CG neighbor-bump: 2.28952 Ang A23.O and E24.CG neighbor-bump: 2.81687 Ang A23.C and E24.CG neighbor-bump: 3.05478 Ang E21.C and I22.CG1 other bump:2.79592 Ang I5.CD1 and I7.CD1 T0191 74 :GEEVKFSGLDVD 1cydA 59 :VDLGDWDATEKA Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:3.07981 Ang E4.CA and L10.CD2 other bump:2.63169 Ang E4.OE1 and L10.CD2 other bump:2.78259 Ang E4.CD and L10.CD2 other bump:2.95609 Ang E4.CA and L10.CD1 other bump:2.49321 Ang E4.O and L10.CD1 other bump:2.6863 Ang E3.CD and K6.CE other bump:2.41592 Ang E3.OE1 and K6.CE T0191 86 :LDGVDIIINATPIGMYPNIDVEPIVKAEK 1cydA 74 :IGPVDLLVNNAALVIMQPFLEVTKEAFDR Fragment has 19 clashes (null) has 19 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 31 residues other bump:1.99886 Ang P18.CG and K27.NZ other bump:2.20825 Ang P18.CD and K27.NZ other bump:2.95241 Ang P18.CG and K27.CE other bump:2.3839 Ang P18.CD and K27.CE other bump:2.87469 Ang P18.CG and K27.CD other bump:1.84345 Ang P18.CD and K27.CD other bump:2.9136 Ang P24.CG and K27.CG other bump:2.74651 Ang P18.CD and P24.CD other bump:1.9689 Ang A11.O and P13.CD other bump:2.62767 Ang A11.C and P13.CD neighbor-bump: 2.1246 Ang T12.CA and P13.CD neighbor-bump: 2.20012 Ang T12.O and P13.CD neighbor-bump: 1.41579 Ang T12.C and P13.CD other bump:2.45057 Ang A11.O and P13.CG neighbor-bump: 2.39862 Ang T12.O and P13.CG neighbor-bump: 2.3511 Ang T12.C and P13.CG neighbor-bump: 2.47861 Ang D3.CB and G4.N self-bump: 2.19176 Ang D3.CB and D3.C self-bump: 1.29723 Ang D3.CA and D3.CB Number of specific fragments= 5 total=1352 Number of alignments=259 # Reading fragments from alignment file # T0191 read from T0191-1cydA-2track-protein-STR-local-adpstyle5.pw.a2m.gz # 1cydA read from T0191-1cydA-2track-protein-STR-local-adpstyle5.pw.a2m.gz # found chain 1cydA in template set T0191 20 :RVKDKNIVIYGAG 1cydA 4 :NFSGLRALVTGAG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues T0191 33 :GAARAVAFELAK 1cydA 18 :GIGRDTVKALHA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKK 1cydA 31 :GAKVVAVTRTNSDLVSLAKECPGIEPVC Fragment has 28 clashes (null) has 28 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 30 residues other bump:2.35913 Ang V12.N and K29.NZ other bump:2.01342 Ang V12.CA and K29.NZ other bump:1.17289 Ang V12.CB and K29.NZ other bump:1.53911 Ang V12.CG1 and K29.NZ other bump:1.25603 Ang V12.CG2 and K29.NZ other bump:3.06242 Ang T11.C and K29.CE other bump:1.94247 Ang V12.N and K29.CE other bump:1.84487 Ang V12.CA and K29.CE other bump:1.71937 Ang V12.CB and K29.CE other bump:1.3082 Ang V12.CG1 and K29.CE other bump:2.69639 Ang V12.CG2 and K29.CE other bump:2.91086 Ang V12.CB and K29.CD other bump:1.67655 Ang V12.CG1 and K29.CD other bump:2.86538 Ang V12.CG1 and K29.CG other bump:2.48335 Ang I5.CD1 and K25.NZ other bump:2.18248 Ang I7.CG1 and K25.NZ other bump:1.72455 Ang I7.CD1 and K25.NZ other bump:2.2857 Ang I5.CD1 and K25.CE other bump:2.57236 Ang I5.CG1 and K25.CE other bump:2.09268 Ang I7.CG1 and K25.CE other bump:2.12582 Ang I7.CD1 and K25.CE other bump:2.88053 Ang I5.CD1 and K25.CD other bump:3.07312 Ang I5.CG1 and K25.CD other bump:3.15783 Ang I5.CG1 and K25.CG neighbor-bump: 2.28952 Ang A23.O and E24.CG neighbor-bump: 2.81687 Ang A23.C and E24.CG neighbor-bump: 3.05478 Ang E21.C and I22.CG1 other bump:2.79592 Ang I5.CD1 and I7.CD1 T0191 74 :GEEVKFSGLDVD 1cydA 59 :VDLGDWDATEKA Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:3.07981 Ang E4.CA and L10.CD2 other bump:2.63169 Ang E4.OE1 and L10.CD2 other bump:2.78259 Ang E4.CD and L10.CD2 other bump:2.95609 Ang E4.CA and L10.CD1 other bump:2.49321 Ang E4.O and L10.CD1 other bump:2.6863 Ang E3.CD and K6.CE other bump:2.41592 Ang E3.OE1 and K6.CE T0191 86 :LDGVDIIINATPIGMYPNIDVEPIVKA 1cydA 74 :IGPVDLLVNNAALVIMQPFLEVTKEAF Fragment has 19 clashes (null) has 19 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 29 residues other bump:1.99886 Ang P18.CG and K27.NZ other bump:2.20825 Ang P18.CD and K27.NZ other bump:2.95241 Ang P18.CG and K27.CE other bump:2.3839 Ang P18.CD and K27.CE other bump:2.87469 Ang P18.CG and K27.CD other bump:1.84345 Ang P18.CD and K27.CD other bump:2.9136 Ang P24.CG and K27.CG other bump:2.74651 Ang P18.CD and P24.CD other bump:1.9689 Ang A11.O and P13.CD other bump:2.62767 Ang A11.C and P13.CD neighbor-bump: 2.1246 Ang T12.CA and P13.CD neighbor-bump: 2.20012 Ang T12.O and P13.CD neighbor-bump: 1.41579 Ang T12.C and P13.CD other bump:2.45057 Ang A11.O and P13.CG neighbor-bump: 2.39862 Ang T12.O and P13.CG neighbor-bump: 2.3511 Ang T12.C and P13.CG neighbor-bump: 2.47861 Ang D3.CB and G4.N self-bump: 2.19176 Ang D3.CB and D3.C self-bump: 1.29723 Ang D3.CA and D3.CB Number of specific fragments= 5 total=1357 Number of alignments=260 # Reading fragments from alignment file # T0191 read from T0191-1cydA-local-adpstyle1.pw.a2m.gz # 1cydA read from T0191-1cydA-local-adpstyle1.pw.a2m.gz # found chain 1cydA in template set T0191 20 :RVKDKNIVIYGAG 1cydA 4 :NFSGLRALVTGAG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues T0191 33 :GAARAVAFELAK 1cydA 18 :GIGRDTVKALHA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKK 1cydA 31 :GAKVVAVTRTNSDLVSLAKECPGIEPVC Fragment has 28 clashes (null) has 28 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 30 residues other bump:2.35913 Ang V12.N and K29.NZ other bump:2.01342 Ang V12.CA and K29.NZ other bump:1.17289 Ang V12.CB and K29.NZ other bump:1.53911 Ang V12.CG1 and K29.NZ other bump:1.25603 Ang V12.CG2 and K29.NZ other bump:3.06242 Ang T11.C and K29.CE other bump:1.94247 Ang V12.N and K29.CE other bump:1.84487 Ang V12.CA and K29.CE other bump:1.71937 Ang V12.CB and K29.CE other bump:1.3082 Ang V12.CG1 and K29.CE other bump:2.69639 Ang V12.CG2 and K29.CE other bump:2.91086 Ang V12.CB and K29.CD other bump:1.67655 Ang V12.CG1 and K29.CD other bump:2.86538 Ang V12.CG1 and K29.CG other bump:2.48335 Ang I5.CD1 and K25.NZ other bump:2.18248 Ang I7.CG1 and K25.NZ other bump:1.72455 Ang I7.CD1 and K25.NZ other bump:2.2857 Ang I5.CD1 and K25.CE other bump:2.57236 Ang I5.CG1 and K25.CE other bump:2.09268 Ang I7.CG1 and K25.CE other bump:2.12582 Ang I7.CD1 and K25.CE other bump:2.88053 Ang I5.CD1 and K25.CD other bump:3.07312 Ang I5.CG1 and K25.CD other bump:3.15783 Ang I5.CG1 and K25.CG neighbor-bump: 2.28952 Ang A23.O and E24.CG neighbor-bump: 2.81687 Ang A23.C and E24.CG neighbor-bump: 3.05478 Ang E21.C and I22.CG1 other bump:2.79592 Ang I5.CD1 and I7.CD1 T0191 74 :GEEVKFSGLDVD 1cydA 59 :VDLGDWDATEKA Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:3.07981 Ang E4.CA and L10.CD2 other bump:2.63169 Ang E4.OE1 and L10.CD2 other bump:2.78259 Ang E4.CD and L10.CD2 other bump:2.95609 Ang E4.CA and L10.CD1 other bump:2.49321 Ang E4.O and L10.CD1 other bump:2.6863 Ang E3.CD and K6.CE other bump:2.41592 Ang E3.OE1 and K6.CE T0191 86 :LDGVDIIINA 1cydA 74 :IGPVDLLVNN Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 12 residues neighbor-bump: 2.47861 Ang D3.CB and G4.N self-bump: 2.19176 Ang D3.CB and D3.C self-bump: 1.29723 Ang D3.CA and D3.CB Number of specific fragments= 5 total=1362 Number of alignments=261 # Reading fragments from alignment file # T0191 read from T0191-1cydA-local-adpstyle5.pw.a2m.gz # 1cydA read from T0191-1cydA-local-adpstyle5.pw.a2m.gz # found chain 1cydA in template set T0191 20 :RVKDKNIVIYGAG 1cydA 4 :NFSGLRALVTGAG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues T0191 33 :GAARAVAFELAK 1cydA 18 :GIGRDTVKALHA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKK 1cydA 31 :GAKVVAVTRTNSDLVSLAKECPGIEPVC Fragment has 28 clashes (null) has 28 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 30 residues other bump:2.35913 Ang V12.N and K29.NZ other bump:2.01342 Ang V12.CA and K29.NZ other bump:1.17289 Ang V12.CB and K29.NZ other bump:1.53911 Ang V12.CG1 and K29.NZ other bump:1.25603 Ang V12.CG2 and K29.NZ other bump:3.06242 Ang T11.C and K29.CE other bump:1.94247 Ang V12.N and K29.CE other bump:1.84487 Ang V12.CA and K29.CE other bump:1.71937 Ang V12.CB and K29.CE other bump:1.3082 Ang V12.CG1 and K29.CE other bump:2.69639 Ang V12.CG2 and K29.CE other bump:2.91086 Ang V12.CB and K29.CD other bump:1.67655 Ang V12.CG1 and K29.CD other bump:2.86538 Ang V12.CG1 and K29.CG other bump:2.48335 Ang I5.CD1 and K25.NZ other bump:2.18248 Ang I7.CG1 and K25.NZ other bump:1.72455 Ang I7.CD1 and K25.NZ other bump:2.2857 Ang I5.CD1 and K25.CE other bump:2.57236 Ang I5.CG1 and K25.CE other bump:2.09268 Ang I7.CG1 and K25.CE other bump:2.12582 Ang I7.CD1 and K25.CE other bump:2.88053 Ang I5.CD1 and K25.CD other bump:3.07312 Ang I5.CG1 and K25.CD other bump:3.15783 Ang I5.CG1 and K25.CG neighbor-bump: 2.28952 Ang A23.O and E24.CG neighbor-bump: 2.81687 Ang A23.C and E24.CG neighbor-bump: 3.05478 Ang E21.C and I22.CG1 other bump:2.79592 Ang I5.CD1 and I7.CD1 T0191 74 :GEEVKFSGLDVD 1cydA 59 :VDLGDWDATEKA Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:3.07981 Ang E4.CA and L10.CD2 other bump:2.63169 Ang E4.OE1 and L10.CD2 other bump:2.78259 Ang E4.CD and L10.CD2 other bump:2.95609 Ang E4.CA and L10.CD1 other bump:2.49321 Ang E4.O and L10.CD1 other bump:2.6863 Ang E3.CD and K6.CE other bump:2.41592 Ang E3.OE1 and K6.CE T0191 86 :LDGVDIIINATPIGMYPNID 1cydA 74 :IGPVDLLVNNAALVIMQPFL Fragment has 11 clashes (null) has 11 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 22 residues other bump:1.9689 Ang A11.O and P13.CD other bump:2.62767 Ang A11.C and P13.CD neighbor-bump: 2.1246 Ang T12.CA and P13.CD neighbor-bump: 2.20012 Ang T12.O and P13.CD neighbor-bump: 1.41579 Ang T12.C and P13.CD other bump:2.45057 Ang A11.O and P13.CG neighbor-bump: 2.39862 Ang T12.O and P13.CG neighbor-bump: 2.3511 Ang T12.C and P13.CG neighbor-bump: 2.47861 Ang D3.CB and G4.N self-bump: 2.19176 Ang D3.CB and D3.C self-bump: 1.29723 Ang D3.CA and D3.CB Number of specific fragments= 5 total=1367 Number of alignments=262 # Reading fragments from alignment file # T0191 read from T0191-1cydA-simpleSW-adpstyle1.pw.a2m.gz # 1cydA read from T0191-1cydA-simpleSW-adpstyle1.pw.a2m.gz # found chain 1cydA in template set T0191 78 :KFSGLDVDLDG 1cydA 4 :NFSGLRALVTG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 13 residues Number of specific fragments= 1 total=1368 # Reading fragments from alignment file # T0191 read from T0191-1cydA-simpleSW-adpstyle5.pw.a2m.gz # 1cydA read from T0191-1cydA-simpleSW-adpstyle5.pw.a2m.gz # found chain 1cydA in template set Number of specific fragments= 0 total=1368 # Reading fragments from alignment file # T0191 read from T0191-1cydA-vit-adpstyle1.pw.a2m.gz # 1cydA read from T0191-1cydA-vit-adpstyle1.pw.a2m.gz # found chain 1cydA in template set T0191 20 :RVKDKNIVIYGAG 1cydA 4 :NFSGLRALVTGAG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues T0191 33 :GAARAVAFELAK 1cydA 18 :GIGRDTVKALHA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKK 1cydA 31 :GAKVVAVTRTNSDLVSLAKECPGIEPVC Fragment has 28 clashes (null) has 28 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 30 residues other bump:2.35913 Ang V12.N and K29.NZ other bump:2.01342 Ang V12.CA and K29.NZ other bump:1.17289 Ang V12.CB and K29.NZ other bump:1.53911 Ang V12.CG1 and K29.NZ other bump:1.25603 Ang V12.CG2 and K29.NZ other bump:3.06242 Ang T11.C and K29.CE other bump:1.94247 Ang V12.N and K29.CE other bump:1.84487 Ang V12.CA and K29.CE other bump:1.71937 Ang V12.CB and K29.CE other bump:1.3082 Ang V12.CG1 and K29.CE other bump:2.69639 Ang V12.CG2 and K29.CE other bump:2.91086 Ang V12.CB and K29.CD other bump:1.67655 Ang V12.CG1 and K29.CD other bump:2.86538 Ang V12.CG1 and K29.CG other bump:2.48335 Ang I5.CD1 and K25.NZ other bump:2.18248 Ang I7.CG1 and K25.NZ other bump:1.72455 Ang I7.CD1 and K25.NZ other bump:2.2857 Ang I5.CD1 and K25.CE other bump:2.57236 Ang I5.CG1 and K25.CE other bump:2.09268 Ang I7.CG1 and K25.CE other bump:2.12582 Ang I7.CD1 and K25.CE other bump:2.88053 Ang I5.CD1 and K25.CD other bump:3.07312 Ang I5.CG1 and K25.CD other bump:3.15783 Ang I5.CG1 and K25.CG neighbor-bump: 2.28952 Ang A23.O and E24.CG neighbor-bump: 2.81687 Ang A23.C and E24.CG neighbor-bump: 3.05478 Ang E21.C and I22.CG1 other bump:2.79592 Ang I5.CD1 and I7.CD1 T0191 74 :GEEVKFSGLDVD 1cydA 59 :VDLGDWDATEKA Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:3.07981 Ang E4.CA and L10.CD2 other bump:2.63169 Ang E4.OE1 and L10.CD2 other bump:2.78259 Ang E4.CD and L10.CD2 other bump:2.95609 Ang E4.CA and L10.CD1 other bump:2.49321 Ang E4.O and L10.CD1 other bump:2.6863 Ang E3.CD and K6.CE other bump:2.41592 Ang E3.OE1 and K6.CE T0191 86 :LDGVDIIINA 1cydA 74 :IGPVDLLVNN Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 12 residues neighbor-bump: 2.47861 Ang D3.CB and G4.N self-bump: 2.19176 Ang D3.CB and D3.C self-bump: 1.29723 Ang D3.CA and D3.CB Number of specific fragments= 5 total=1373 Number of alignments=263 # Reading fragments from alignment file # T0191 read from T0191-1cydA-vit-adpstyle5.pw.a2m.gz # 1cydA read from T0191-1cydA-vit-adpstyle5.pw.a2m.gz # found chain 1cydA in template set T0191 20 :RVKDKNIVIYGAG 1cydA 4 :NFSGLRALVTGAG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues T0191 33 :GAARAVAFELAK 1cydA 18 :GIGRDTVKALHA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLNKK 1cydA 31 :GAKVVAVTRTNSDLVSLAKECPGIEPVC Fragment has 28 clashes (null) has 28 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 30 residues other bump:2.35913 Ang V12.N and K29.NZ other bump:2.01342 Ang V12.CA and K29.NZ other bump:1.17289 Ang V12.CB and K29.NZ other bump:1.53911 Ang V12.CG1 and K29.NZ other bump:1.25603 Ang V12.CG2 and K29.NZ other bump:3.06242 Ang T11.C and K29.CE other bump:1.94247 Ang V12.N and K29.CE other bump:1.84487 Ang V12.CA and K29.CE other bump:1.71937 Ang V12.CB and K29.CE other bump:1.3082 Ang V12.CG1 and K29.CE other bump:2.69639 Ang V12.CG2 and K29.CE other bump:2.91086 Ang V12.CB and K29.CD other bump:1.67655 Ang V12.CG1 and K29.CD other bump:2.86538 Ang V12.CG1 and K29.CG other bump:2.48335 Ang I5.CD1 and K25.NZ other bump:2.18248 Ang I7.CG1 and K25.NZ other bump:1.72455 Ang I7.CD1 and K25.NZ other bump:2.2857 Ang I5.CD1 and K25.CE other bump:2.57236 Ang I5.CG1 and K25.CE other bump:2.09268 Ang I7.CG1 and K25.CE other bump:2.12582 Ang I7.CD1 and K25.CE other bump:2.88053 Ang I5.CD1 and K25.CD other bump:3.07312 Ang I5.CG1 and K25.CD other bump:3.15783 Ang I5.CG1 and K25.CG neighbor-bump: 2.28952 Ang A23.O and E24.CG neighbor-bump: 2.81687 Ang A23.C and E24.CG neighbor-bump: 3.05478 Ang E21.C and I22.CG1 other bump:2.79592 Ang I5.CD1 and I7.CD1 T0191 74 :GEEVKFSGLDVD 1cydA 59 :VDLGDWDATEKA Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:3.07981 Ang E4.CA and L10.CD2 other bump:2.63169 Ang E4.OE1 and L10.CD2 other bump:2.78259 Ang E4.CD and L10.CD2 other bump:2.95609 Ang E4.CA and L10.CD1 other bump:2.49321 Ang E4.O and L10.CD1 other bump:2.6863 Ang E3.CD and K6.CE other bump:2.41592 Ang E3.OE1 and K6.CE T0191 86 :LDGVDIIINATPIGMYPNID 1cydA 74 :IGPVDLLVNNAALVIMQPFL Fragment has 11 clashes (null) has 11 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 22 residues other bump:1.9689 Ang A11.O and P13.CD other bump:2.62767 Ang A11.C and P13.CD neighbor-bump: 2.1246 Ang T12.CA and P13.CD neighbor-bump: 2.20012 Ang T12.O and P13.CD neighbor-bump: 1.41579 Ang T12.C and P13.CD other bump:2.45057 Ang A11.O and P13.CG neighbor-bump: 2.39862 Ang T12.O and P13.CG neighbor-bump: 2.3511 Ang T12.C and P13.CG neighbor-bump: 2.47861 Ang D3.CB and G4.N self-bump: 2.19176 Ang D3.CB and D3.C self-bump: 1.29723 Ang D3.CA and D3.CB Number of specific fragments= 5 total=1378 Number of alignments=264 # command:# Prefix for input files set to 1pjcA/ # command:# reading script from file read-alignments.under # Reading fragments from alignment file # T0191 read from 1pjcA-T0191-local-adpstyle1.pw.a2m.gz # 1pjcA read from 1pjcA-T0191-local-adpstyle1.pw.a2m.gz # found chain 1pjcA in template set T0191 18 :IGRVKDKNIVIYGAGGAARAVA 1pjcA 162 :VPGVKPGKVVILGGGVVGTEAA Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 24 residues other bump:1.86201 Ang G14.O and A19.CB other bump:2.86011 Ang G14.C and A19.CB T0191 41 :ELAKD 1pjcA 184 :KMAVG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 7 residues T0191 46 :NNIIIANRTVEKAEALAKEIAEKLNKKFGEEVK 1pjcA 191 :AQVQIFDINVERLSYLETLFGSRVELLYSNSAE Fragment has 21 clashes (null) has 21 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 35 residues other bump:1.83363 Ang A14.O and K27.NZ other bump:2.78947 Ang L17.C and K27.NZ other bump:2.51554 Ang L17.CB and K27.NZ other bump:2.30354 Ang A14.O and K27.CE other bump:2.91712 Ang A14.C and K27.CE other bump:2.86297 Ang A14.CA and K27.CE other bump:2.82109 Ang I21.CD1 and L25.CD2 other bump:2.87292 Ang I4.CD1 and L25.CD2 other bump:2.54449 Ang I4.CG1 and L25.CD1 other bump:2.47902 Ang I4.CD1 and L25.CD1 other bump:2.67771 Ang I4.CG1 and L25.CG other bump:2.50606 Ang I4.CD1 and L25.CG self-bump: 2.21466 Ang A22.CB and A22.C self-bump: 1.23794 Ang A22.CA and A22.CB other bump:1.89358 Ang V11.CG1 and E15.OE2 other bump:2.34526 Ang E12.CA and E15.OE1 other bump:1.30061 Ang V11.O and E15.OE1 other bump:2.01321 Ang V11.C and E15.OE1 other bump:2.89138 Ang V11.CG1 and E15.CD other bump:2.11374 Ang V11.O and E15.CD other bump:2.88633 Ang V11.C and E15.CD T0191 82 :LDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLREDMVVMDL 1pjcA 224 :IETAVAEADLLIGAVLVPGRRAPILVPASLVEQMRTGSVIVDV Fragment has 51 clashes (null) has 51 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 45 residues other bump:2.22384 Ang N14.CB and D43.OD2 other bump:2.12652 Ang N14.CG and D43.OD2 other bump:1.83036 Ang N14.OD1 and D43.OD1 other bump:2.52796 Ang N14.CB and D43.CG other bump:2.57643 Ang N14.CG and D43.CG other bump:2.19514 Ang N14.OD1 and D43.CG other bump:3.15042 Ang N14.CB and D43.CA other bump:3.02336 Ang I12.CG1 and V41.CG1 other bump:3.00794 Ang I12.CD1 and V41.CG1 other bump:0.885492 Ang V9.O and M39.CE other bump:2.06576 Ang V9.C and M39.CE other bump:2.08315 Ang V9.O and M39.SD other bump:2.68608 Ang V9.C and M39.SD other bump:2.74619 Ang D10.CA and M39.SD other bump:2.55118 Ang D10.O and M39.SD other bump:2.46645 Ang D10.C and M39.SD other bump:2.58219 Ang L6.O and L35.CD2 other bump:2.16854 Ang D7.OD1 and K34.O other bump:2.74141 Ang L6.CB and K31.NZ other bump:2.81738 Ang D25.OD1 and E27.C other bump:2.45887 Ang L6.CD1 and E27.OE2 neighbor-bump: 2.83758 Ang Y21.CD2 and P22.C neighbor-bump: 1.7655 Ang Y21.CD2 and P22.O neighbor-bump: 2.40903 Ang Y21.CE2 and P22.O other bump:2.79301 Ang I18.CA and Y21.OH other bump:1.40781 Ang I18.CB and Y21.OH other bump:1.87505 Ang I18.CG1 and Y21.OH other bump:2.11198 Ang I18.CG2 and Y21.OH other bump:1.85864 Ang I18.CD1 and Y21.OH other bump:2.96035 Ang I18.CA and Y21.CZ other bump:1.49795 Ang I18.CB and Y21.CZ other bump:1.76954 Ang I18.CG1 and Y21.CZ other bump:1.25798 Ang I18.CG2 and Y21.CZ other bump:1.81553 Ang I18.CD1 and Y21.CZ other bump:2.46327 Ang I18.CB and Y21.CE2 other bump:3.11928 Ang I18.CG1 and Y21.CE2 other bump:1.2137 Ang I18.CG2 and Y21.CE2 other bump:2.08915 Ang I18.CB and Y21.CE1 other bump:1.35619 Ang I18.CG1 and Y21.CE1 other bump:2.12197 Ang I18.CG2 and Y21.CE1 other bump:1.70083 Ang I18.CD1 and Y21.CE1 other bump:2.06228 Ang I18.CG2 and Y21.CD2 other bump:2.68452 Ang I18.CG1 and Y21.CD1 other bump:2.70559 Ang I18.CG2 and Y21.CD1 other bump:2.71812 Ang I18.CG2 and Y21.CG neighbor-bump: 2.44044 Ang T16.CA and P17.CD neighbor-bump: 1.80648 Ang T16.C and P17.CD neighbor-bump: 2.66854 Ang T16.C and P17.CG other bump:2.68906 Ang V9.CG1 and I12.CG2 other bump:2.87441 Ang V9.CG1 and I11.C other bump:2.61781 Ang V9.CG1 and I11.O Number of specific fragments= 4 total=1382 Number of alignments=265 # Reading fragments from alignment file # T0191 read from 1pjcA-T0191-local-adpstyle5.pw.a2m.gz # 1pjcA read from 1pjcA-T0191-local-adpstyle5.pw.a2m.gz # found chain 1pjcA in template set T0191 14 :LEEEIGRVKDKNIVIYGAGGAARAVA 1pjcA 158 :LLGGVPGVKPGKVVILGGGVVGTEAA Fragment has 33 clashes (null) has 33 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:1.86201 Ang G18.O and A23.CB other bump:2.86011 Ang G18.C and A23.CB other bump:1.72107 Ang E3.CG and K12.NZ other bump:2.44458 Ang E3.CD and K12.NZ other bump:2.6744 Ang E3.CG and K12.CE other bump:2.47836 Ang E3.CA and K12.CG other bump:2.98842 Ang E3.N and K12.CG other bump:3.26277 Ang L2.C and K12.CG other bump:3.04216 Ang E3.CA and K12.CB other bump:2.32131 Ang E5.OE1 and D11.OD2 other bump:2.21081 Ang E5.OE2 and D11.OD1 other bump:2.14321 Ang E5.CB and D11.OD1 other bump:1.91964 Ang E4.O and D11.OD1 other bump:1.85471 Ang E5.CG and D11.OD1 other bump:1.73073 Ang E5.CD and D11.OD1 other bump:2.66234 Ang E4.C and D11.OD1 other bump:2.52479 Ang E5.OE2 and D11.CG other bump:2.46152 Ang E5.CG and D11.CG other bump:1.80936 Ang E5.CD and D11.CG other bump:1.69794 Ang E5.OE1 and D11.CG other bump:2.58721 Ang E5.CG and D11.CB other bump:2.26708 Ang E5.CD and D11.CB other bump:1.56543 Ang E5.OE1 and D11.CB other bump:1.87339 Ang E5.CG and D11.CA other bump:2.23758 Ang E5.CD and D11.CA other bump:2.00932 Ang E5.OE1 and D11.CA other bump:2.0714 Ang E5.CG and D11.N other bump:1.88704 Ang E5.CD and D11.N other bump:1.7677 Ang E5.OE1 and D11.N other bump:2.55344 Ang E5.CG and K10.C other bump:2.78114 Ang E5.CD and K10.C neighbor-bump: 2.16376 Ang E4.O and E5.CB neighbor-bump: 2.55243 Ang E4.C and E5.CB T0191 41 :ELAKD 1pjcA 184 :KMAVG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 7 residues T0191 46 :NNIIIANRTVEKAEALAKEIAEKLNKKFGEEVK 1pjcA 191 :AQVQIFDINVERLSYLETLFGSRVELLYSNSAE Fragment has 21 clashes (null) has 21 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 35 residues other bump:1.83363 Ang A14.O and K27.NZ other bump:2.78947 Ang L17.C and K27.NZ other bump:2.51554 Ang L17.CB and K27.NZ other bump:2.30354 Ang A14.O and K27.CE other bump:2.91712 Ang A14.C and K27.CE other bump:2.86297 Ang A14.CA and K27.CE other bump:2.82109 Ang I21.CD1 and L25.CD2 other bump:2.87292 Ang I4.CD1 and L25.CD2 other bump:2.54449 Ang I4.CG1 and L25.CD1 other bump:2.47902 Ang I4.CD1 and L25.CD1 other bump:2.67771 Ang I4.CG1 and L25.CG other bump:2.50606 Ang I4.CD1 and L25.CG self-bump: 2.21466 Ang A22.CB and A22.C self-bump: 1.23794 Ang A22.CA and A22.CB other bump:1.89358 Ang V11.CG1 and E15.OE2 other bump:2.34526 Ang E12.CA and E15.OE1 other bump:1.30061 Ang V11.O and E15.OE1 other bump:2.01321 Ang V11.C and E15.OE1 other bump:2.89138 Ang V11.CG1 and E15.CD other bump:2.11374 Ang V11.O and E15.CD other bump:2.88633 Ang V11.C and E15.CD T0191 82 :LDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLREDMVVMDL 1pjcA 224 :IETAVAEADLLIGAVLVPGRRAPILVPASLVEQMRTGSVIVDV Fragment has 51 clashes (null) has 51 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 45 residues other bump:2.22384 Ang N14.CB and D43.OD2 other bump:2.12652 Ang N14.CG and D43.OD2 other bump:1.83036 Ang N14.OD1 and D43.OD1 other bump:2.52796 Ang N14.CB and D43.CG other bump:2.57643 Ang N14.CG and D43.CG other bump:2.19514 Ang N14.OD1 and D43.CG other bump:3.15042 Ang N14.CB and D43.CA other bump:3.02336 Ang I12.CG1 and V41.CG1 other bump:3.00794 Ang I12.CD1 and V41.CG1 other bump:0.885492 Ang V9.O and M39.CE other bump:2.06576 Ang V9.C and M39.CE other bump:2.08315 Ang V9.O and M39.SD other bump:2.68608 Ang V9.C and M39.SD other bump:2.74619 Ang D10.CA and M39.SD other bump:2.55118 Ang D10.O and M39.SD other bump:2.46645 Ang D10.C and M39.SD other bump:2.58219 Ang L6.O and L35.CD2 other bump:2.16854 Ang D7.OD1 and K34.O other bump:2.74141 Ang L6.CB and K31.NZ other bump:2.81738 Ang D25.OD1 and E27.C other bump:2.45887 Ang L6.CD1 and E27.OE2 neighbor-bump: 2.83758 Ang Y21.CD2 and P22.C neighbor-bump: 1.7655 Ang Y21.CD2 and P22.O neighbor-bump: 2.40903 Ang Y21.CE2 and P22.O other bump:2.79301 Ang I18.CA and Y21.OH other bump:1.40781 Ang I18.CB and Y21.OH other bump:1.87505 Ang I18.CG1 and Y21.OH other bump:2.11198 Ang I18.CG2 and Y21.OH other bump:1.85864 Ang I18.CD1 and Y21.OH other bump:2.96035 Ang I18.CA and Y21.CZ other bump:1.49795 Ang I18.CB and Y21.CZ other bump:1.76954 Ang I18.CG1 and Y21.CZ other bump:1.25798 Ang I18.CG2 and Y21.CZ other bump:1.81553 Ang I18.CD1 and Y21.CZ other bump:2.46327 Ang I18.CB and Y21.CE2 other bump:3.11928 Ang I18.CG1 and Y21.CE2 other bump:1.2137 Ang I18.CG2 and Y21.CE2 other bump:2.08915 Ang I18.CB and Y21.CE1 other bump:1.35619 Ang I18.CG1 and Y21.CE1 other bump:2.12197 Ang I18.CG2 and Y21.CE1 other bump:1.70083 Ang I18.CD1 and Y21.CE1 other bump:2.06228 Ang I18.CG2 and Y21.CD2 other bump:2.68452 Ang I18.CG1 and Y21.CD1 other bump:2.70559 Ang I18.CG2 and Y21.CD1 other bump:2.71812 Ang I18.CG2 and Y21.CG neighbor-bump: 2.44044 Ang T16.CA and P17.CD neighbor-bump: 1.80648 Ang T16.C and P17.CD neighbor-bump: 2.66854 Ang T16.C and P17.CG other bump:2.68906 Ang V9.CG1 and I12.CG2 other bump:2.87441 Ang V9.CG1 and I11.C other bump:2.61781 Ang V9.CG1 and I11.O Number of specific fragments= 4 total=1386 Number of alignments=266 # Reading fragments from alignment file # T0191 read from 1pjcA-T0191-vit-adpstyle1.pw.a2m.gz # 1pjcA read from 1pjcA-T0191-vit-adpstyle1.pw.a2m.gz # found chain 1pjcA in template set T0191 18 :IGRVKDKNIVIYGAGGAARAVA 1pjcA 162 :VPGVKPGKVVILGGGVVGTEAA Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 24 residues other bump:1.86201 Ang G14.O and A19.CB other bump:2.86011 Ang G14.C and A19.CB T0191 41 :ELAKD 1pjcA 184 :KMAVG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 7 residues T0191 46 :NNIIIANRTVEKAEALAKEIAEKLNKKFGEEVK 1pjcA 191 :AQVQIFDINVERLSYLETLFGSRVELLYSNSAE Fragment has 21 clashes (null) has 21 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 35 residues other bump:1.83363 Ang A14.O and K27.NZ other bump:2.78947 Ang L17.C and K27.NZ other bump:2.51554 Ang L17.CB and K27.NZ other bump:2.30354 Ang A14.O and K27.CE other bump:2.91712 Ang A14.C and K27.CE other bump:2.86297 Ang A14.CA and K27.CE other bump:2.82109 Ang I21.CD1 and L25.CD2 other bump:2.87292 Ang I4.CD1 and L25.CD2 other bump:2.54449 Ang I4.CG1 and L25.CD1 other bump:2.47902 Ang I4.CD1 and L25.CD1 other bump:2.67771 Ang I4.CG1 and L25.CG other bump:2.50606 Ang I4.CD1 and L25.CG self-bump: 2.21466 Ang A22.CB and A22.C self-bump: 1.23794 Ang A22.CA and A22.CB other bump:1.89358 Ang V11.CG1 and E15.OE2 other bump:2.34526 Ang E12.CA and E15.OE1 other bump:1.30061 Ang V11.O and E15.OE1 other bump:2.01321 Ang V11.C and E15.OE1 other bump:2.89138 Ang V11.CG1 and E15.CD other bump:2.11374 Ang V11.O and E15.CD other bump:2.88633 Ang V11.C and E15.CD T0191 82 :LDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLREDMVVMDL 1pjcA 224 :IETAVAEADLLIGAVLVPGRRAPILVPASLVEQMRTGSVIVDV Fragment has 51 clashes (null) has 51 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 45 residues other bump:2.22384 Ang N14.CB and D43.OD2 other bump:2.12652 Ang N14.CG and D43.OD2 other bump:1.83036 Ang N14.OD1 and D43.OD1 other bump:2.52796 Ang N14.CB and D43.CG other bump:2.57643 Ang N14.CG and D43.CG other bump:2.19514 Ang N14.OD1 and D43.CG other bump:3.15042 Ang N14.CB and D43.CA other bump:3.02336 Ang I12.CG1 and V41.CG1 other bump:3.00794 Ang I12.CD1 and V41.CG1 other bump:0.885492 Ang V9.O and M39.CE other bump:2.06576 Ang V9.C and M39.CE other bump:2.08315 Ang V9.O and M39.SD other bump:2.68608 Ang V9.C and M39.SD other bump:2.74619 Ang D10.CA and M39.SD other bump:2.55118 Ang D10.O and M39.SD other bump:2.46645 Ang D10.C and M39.SD other bump:2.58219 Ang L6.O and L35.CD2 other bump:2.16854 Ang D7.OD1 and K34.O other bump:2.74141 Ang L6.CB and K31.NZ other bump:2.81738 Ang D25.OD1 and E27.C other bump:2.45887 Ang L6.CD1 and E27.OE2 neighbor-bump: 2.83758 Ang Y21.CD2 and P22.C neighbor-bump: 1.7655 Ang Y21.CD2 and P22.O neighbor-bump: 2.40903 Ang Y21.CE2 and P22.O other bump:2.79301 Ang I18.CA and Y21.OH other bump:1.40781 Ang I18.CB and Y21.OH other bump:1.87505 Ang I18.CG1 and Y21.OH other bump:2.11198 Ang I18.CG2 and Y21.OH other bump:1.85864 Ang I18.CD1 and Y21.OH other bump:2.96035 Ang I18.CA and Y21.CZ other bump:1.49795 Ang I18.CB and Y21.CZ other bump:1.76954 Ang I18.CG1 and Y21.CZ other bump:1.25798 Ang I18.CG2 and Y21.CZ other bump:1.81553 Ang I18.CD1 and Y21.CZ other bump:2.46327 Ang I18.CB and Y21.CE2 other bump:3.11928 Ang I18.CG1 and Y21.CE2 other bump:1.2137 Ang I18.CG2 and Y21.CE2 other bump:2.08915 Ang I18.CB and Y21.CE1 other bump:1.35619 Ang I18.CG1 and Y21.CE1 other bump:2.12197 Ang I18.CG2 and Y21.CE1 other bump:1.70083 Ang I18.CD1 and Y21.CE1 other bump:2.06228 Ang I18.CG2 and Y21.CD2 other bump:2.68452 Ang I18.CG1 and Y21.CD1 other bump:2.70559 Ang I18.CG2 and Y21.CD1 other bump:2.71812 Ang I18.CG2 and Y21.CG neighbor-bump: 2.44044 Ang T16.CA and P17.CD neighbor-bump: 1.80648 Ang T16.C and P17.CD neighbor-bump: 2.66854 Ang T16.C and P17.CG other bump:2.68906 Ang V9.CG1 and I12.CG2 other bump:2.87441 Ang V9.CG1 and I11.C other bump:2.61781 Ang V9.CG1 and I11.O Number of specific fragments= 4 total=1390 Number of alignments=267 # Reading fragments from alignment file # T0191 read from 1pjcA-T0191-vit-adpstyle5.pw.a2m.gz # 1pjcA read from 1pjcA-T0191-vit-adpstyle5.pw.a2m.gz # found chain 1pjcA in template set T0191 14 :LEEEIGRVKDKNIVIYGAGGAARAVA 1pjcA 158 :LLGGVPGVKPGKVVILGGGVVGTEAA Fragment has 33 clashes (null) has 33 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:1.86201 Ang G18.O and A23.CB other bump:2.86011 Ang G18.C and A23.CB other bump:1.72107 Ang E3.CG and K12.NZ other bump:2.44458 Ang E3.CD and K12.NZ other bump:2.6744 Ang E3.CG and K12.CE other bump:2.47836 Ang E3.CA and K12.CG other bump:2.98842 Ang E3.N and K12.CG other bump:3.26277 Ang L2.C and K12.CG other bump:3.04216 Ang E3.CA and K12.CB other bump:2.32131 Ang E5.OE1 and D11.OD2 other bump:2.21081 Ang E5.OE2 and D11.OD1 other bump:2.14321 Ang E5.CB and D11.OD1 other bump:1.91964 Ang E4.O and D11.OD1 other bump:1.85471 Ang E5.CG and D11.OD1 other bump:1.73073 Ang E5.CD and D11.OD1 other bump:2.66234 Ang E4.C and D11.OD1 other bump:2.52479 Ang E5.OE2 and D11.CG other bump:2.46152 Ang E5.CG and D11.CG other bump:1.80936 Ang E5.CD and D11.CG other bump:1.69794 Ang E5.OE1 and D11.CG other bump:2.58721 Ang E5.CG and D11.CB other bump:2.26708 Ang E5.CD and D11.CB other bump:1.56543 Ang E5.OE1 and D11.CB other bump:1.87339 Ang E5.CG and D11.CA other bump:2.23758 Ang E5.CD and D11.CA other bump:2.00932 Ang E5.OE1 and D11.CA other bump:2.0714 Ang E5.CG and D11.N other bump:1.88704 Ang E5.CD and D11.N other bump:1.7677 Ang E5.OE1 and D11.N other bump:2.55344 Ang E5.CG and K10.C other bump:2.78114 Ang E5.CD and K10.C neighbor-bump: 2.16376 Ang E4.O and E5.CB neighbor-bump: 2.55243 Ang E4.C and E5.CB T0191 41 :ELAKD 1pjcA 184 :KMAVG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 7 residues T0191 46 :NNIIIANRTVEKAEALAKEIAEKLNKKFGEEVK 1pjcA 191 :AQVQIFDINVERLSYLETLFGSRVELLYSNSAE Fragment has 21 clashes (null) has 21 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 35 residues other bump:1.83363 Ang A14.O and K27.NZ other bump:2.78947 Ang L17.C and K27.NZ other bump:2.51554 Ang L17.CB and K27.NZ other bump:2.30354 Ang A14.O and K27.CE other bump:2.91712 Ang A14.C and K27.CE other bump:2.86297 Ang A14.CA and K27.CE other bump:2.82109 Ang I21.CD1 and L25.CD2 other bump:2.87292 Ang I4.CD1 and L25.CD2 other bump:2.54449 Ang I4.CG1 and L25.CD1 other bump:2.47902 Ang I4.CD1 and L25.CD1 other bump:2.67771 Ang I4.CG1 and L25.CG other bump:2.50606 Ang I4.CD1 and L25.CG self-bump: 2.21466 Ang A22.CB and A22.C self-bump: 1.23794 Ang A22.CA and A22.CB other bump:1.89358 Ang V11.CG1 and E15.OE2 other bump:2.34526 Ang E12.CA and E15.OE1 other bump:1.30061 Ang V11.O and E15.OE1 other bump:2.01321 Ang V11.C and E15.OE1 other bump:2.89138 Ang V11.CG1 and E15.CD other bump:2.11374 Ang V11.O and E15.CD other bump:2.88633 Ang V11.C and E15.CD T0191 82 :LDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLREDMVVMDL 1pjcA 224 :IETAVAEADLLIGAVLVPGRRAPILVPASLVEQMRTGSVIVDV Fragment has 51 clashes (null) has 51 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 45 residues other bump:2.22384 Ang N14.CB and D43.OD2 other bump:2.12652 Ang N14.CG and D43.OD2 other bump:1.83036 Ang N14.OD1 and D43.OD1 other bump:2.52796 Ang N14.CB and D43.CG other bump:2.57643 Ang N14.CG and D43.CG other bump:2.19514 Ang N14.OD1 and D43.CG other bump:3.15042 Ang N14.CB and D43.CA other bump:3.02336 Ang I12.CG1 and V41.CG1 other bump:3.00794 Ang I12.CD1 and V41.CG1 other bump:0.885492 Ang V9.O and M39.CE other bump:2.06576 Ang V9.C and M39.CE other bump:2.08315 Ang V9.O and M39.SD other bump:2.68608 Ang V9.C and M39.SD other bump:2.74619 Ang D10.CA and M39.SD other bump:2.55118 Ang D10.O and M39.SD other bump:2.46645 Ang D10.C and M39.SD other bump:2.58219 Ang L6.O and L35.CD2 other bump:2.16854 Ang D7.OD1 and K34.O other bump:2.74141 Ang L6.CB and K31.NZ other bump:2.81738 Ang D25.OD1 and E27.C other bump:2.45887 Ang L6.CD1 and E27.OE2 neighbor-bump: 2.83758 Ang Y21.CD2 and P22.C neighbor-bump: 1.7655 Ang Y21.CD2 and P22.O neighbor-bump: 2.40903 Ang Y21.CE2 and P22.O other bump:2.79301 Ang I18.CA and Y21.OH other bump:1.40781 Ang I18.CB and Y21.OH other bump:1.87505 Ang I18.CG1 and Y21.OH other bump:2.11198 Ang I18.CG2 and Y21.OH other bump:1.85864 Ang I18.CD1 and Y21.OH other bump:2.96035 Ang I18.CA and Y21.CZ other bump:1.49795 Ang I18.CB and Y21.CZ other bump:1.76954 Ang I18.CG1 and Y21.CZ other bump:1.25798 Ang I18.CG2 and Y21.CZ other bump:1.81553 Ang I18.CD1 and Y21.CZ other bump:2.46327 Ang I18.CB and Y21.CE2 other bump:3.11928 Ang I18.CG1 and Y21.CE2 other bump:1.2137 Ang I18.CG2 and Y21.CE2 other bump:2.08915 Ang I18.CB and Y21.CE1 other bump:1.35619 Ang I18.CG1 and Y21.CE1 other bump:2.12197 Ang I18.CG2 and Y21.CE1 other bump:1.70083 Ang I18.CD1 and Y21.CE1 other bump:2.06228 Ang I18.CG2 and Y21.CD2 other bump:2.68452 Ang I18.CG1 and Y21.CD1 other bump:2.70559 Ang I18.CG2 and Y21.CD1 other bump:2.71812 Ang I18.CG2 and Y21.CG neighbor-bump: 2.44044 Ang T16.CA and P17.CD neighbor-bump: 1.80648 Ang T16.C and P17.CD neighbor-bump: 2.66854 Ang T16.C and P17.CG other bump:2.68906 Ang V9.CG1 and I12.CG2 other bump:2.87441 Ang V9.CG1 and I11.C other bump:2.61781 Ang V9.CG1 and I11.O Number of specific fragments= 4 total=1394 Number of alignments=268 # Reading fragments from alignment file # T0191 read from T0191-1pjcA-2track-protein-EBGHSTL-global-adpstyle1.pw.a2m.gz # 1pjcA read from T0191-1pjcA-2track-protein-EBGHSTL-global-adpstyle1.pw.a2m.gz # found chain 1pjcA in template set T0191 3 :YNTDGIGARMALEEEIGR 1pjcA 15 :RVGLSPSSVRTLVEAGHT Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 20 residues neighbor-bump: 2.58907 Ang E16.O and I17.CD1 neighbor-bump: 2.17629 Ang E16.O and I17.CG1 neighbor-bump: 2.67119 Ang E16.C and I17.CG1 neighbor-bump: 1.92435 Ang E16.O and I17.CB neighbor-bump: 2.41844 Ang E16.C and I17.CB T0191 21 :VKDKNIVIYGAGGAARAVAFELAK 1pjcA 165 :VKPGKVVILGGGVVGTEAAKMAVG Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 26 residues other bump:2.70113 Ang I7.CD1 and L23.CD2 other bump:2.51188 Ang I7.CG1 and L23.CD1 other bump:1.10707 Ang I7.CD1 and L23.CD1 other bump:1.96604 Ang I7.CD1 and L23.CG other bump:2.36271 Ang I7.CD1 and L23.CB other bump:1.86201 Ang G11.O and A16.CB other bump:2.86011 Ang G11.C and A16.CB T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLN 1pjcA 190 :GAQVQIFDINVERLSYLETLFGSRVE Fragment has 17 clashes (null) has 17 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:2.82109 Ang I22.CD1 and L26.CD2 other bump:2.87292 Ang I5.CD1 and L26.CD2 other bump:2.54449 Ang I5.CG1 and L26.CD1 other bump:2.47902 Ang I5.CD1 and L26.CD1 other bump:2.67771 Ang I5.CG1 and L26.CG other bump:2.50607 Ang I5.CD1 and L26.CG self-bump: 2.21466 Ang A23.CB and A23.C self-bump: 1.23794 Ang A23.CA and A23.CB other bump:1.89358 Ang V12.CG1 and E16.OE2 other bump:1.30061 Ang V12.O and E16.OE1 other bump:2.01321 Ang V12.C and E16.OE1 other bump:2.34526 Ang E13.CA and E16.OE1 other bump:2.11374 Ang V12.O and E16.CD other bump:2.88633 Ang V12.C and E16.CD other bump:2.89138 Ang V12.CG1 and E16.CD other bump:2.91217 Ang N3.CG and I5.CG2 other bump:1.91995 Ang N3.ND2 and I5.CG2 T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLREDMVVMDLIY 1pjcA 216 :LLYSNSAEIETAVAEADLLIGAVLVPGRRAPILVPASLVEQMRTGSVIVDVAV Fragment has 60 clashes (null) has 60 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 55 residues other bump:2.47383 Ang A23.C and I53.CD1 other bump:1.70319 Ang T24.N and I53.CD1 other bump:2.48239 Ang A23.N and I53.CD1 other bump:2.62884 Ang A23.CA and I53.CD1 other bump:2.78794 Ang T24.CA and I53.CD1 other bump:2.18911 Ang N22.ND2 and I53.CD1 other bump:2.82658 Ang T24.N and I53.CG1 other bump:3.16951 Ang N22.ND2 and I53.CG1 other bump:2.22384 Ang N22.CB and D51.OD2 other bump:2.12652 Ang N22.CG and D51.OD2 other bump:1.83036 Ang N22.OD1 and D51.OD1 other bump:2.52796 Ang N22.CB and D51.CG other bump:2.57643 Ang N22.CG and D51.CG other bump:2.19514 Ang N22.OD1 and D51.CG other bump:3.15042 Ang N22.CB and D51.CA other bump:3.02336 Ang I20.CG1 and V49.CG1 other bump:3.00794 Ang I20.CD1 and V49.CG1 other bump:0.885492 Ang V17.O and M47.CE other bump:2.06576 Ang V17.C and M47.CE other bump:2.08315 Ang V17.O and M47.SD other bump:2.68608 Ang V17.C and M47.SD other bump:2.74619 Ang D18.CA and M47.SD other bump:2.55118 Ang D18.O and M47.SD other bump:2.46645 Ang D18.C and M47.SD other bump:2.58219 Ang L14.O and L43.CD2 other bump:2.16854 Ang D15.OD1 and K42.O other bump:2.74141 Ang L14.CB and K39.NZ other bump:2.81738 Ang D33.OD1 and E35.C other bump:2.45887 Ang L14.CD1 and E35.OE2 neighbor-bump: 2.83758 Ang Y29.CD2 and P30.C neighbor-bump: 1.7655 Ang Y29.CD2 and P30.O neighbor-bump: 2.40903 Ang Y29.CE2 and P30.O other bump:2.79301 Ang I26.CA and Y29.OH other bump:1.40781 Ang I26.CB and Y29.OH other bump:1.87505 Ang I26.CG1 and Y29.OH other bump:2.11198 Ang I26.CG2 and Y29.OH other bump:1.85864 Ang I26.CD1 and Y29.OH other bump:2.96035 Ang I26.CA and Y29.CZ other bump:1.49795 Ang I26.CB and Y29.CZ other bump:1.76954 Ang I26.CG1 and Y29.CZ other bump:1.25798 Ang I26.CG2 and Y29.CZ other bump:1.81553 Ang I26.CD1 and Y29.CZ other bump:2.46327 Ang I26.CB and Y29.CE2 other bump:3.11928 Ang I26.CG1 and Y29.CE2 other bump:1.2137 Ang I26.CG2 and Y29.CE2 other bump:2.08915 Ang I26.CB and Y29.CE1 other bump:1.35619 Ang I26.CG1 and Y29.CE1 other bump:2.12197 Ang I26.CG2 and Y29.CE1 other bump:1.70083 Ang I26.CD1 and Y29.CE1 other bump:2.06228 Ang I26.CG2 and Y29.CD2 other bump:2.68452 Ang I26.CG1 and Y29.CD1 other bump:2.70559 Ang I26.CG2 and Y29.CD1 other bump:2.71812 Ang I26.CG2 and Y29.CG neighbor-bump: 1.80648 Ang T24.C and P25.CD neighbor-bump: 2.44044 Ang T24.CA and P25.CD neighbor-bump: 2.66854 Ang T24.C and P25.CG other bump:2.68906 Ang V17.CG1 and I20.CG2 other bump:2.87441 Ang V17.CG1 and I19.C other bump:2.61781 Ang V17.CG1 and I19.O other bump:2.83154 Ang F7.CD1 and D11.OD2 T0191 127 :NPLETVLLKEAKKVNAKTINGLGMLIYQGAVAFK 1pjcA 299 :NMPGAVPWTATQALNNSTLPYVVKLANQGLKALE Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 35 residues other bump:2.15954 Ang G24.O and Y28.CD1 other bump:2.61299 Ang N16.O and I20.CD1 other bump:2.08694 Ang L4.CD2 and E11.OE2 other bump:3.04729 Ang L4.CB and E11.CD other bump:2.68377 Ang L4.CD2 and E11.CD other bump:2.53407 Ang L4.O and E11.CG neighbor-bump: 2.62832 Ang N2.N and P3.CD Number of specific fragments= 5 total=1399 Number of alignments=269 # Reading fragments from alignment file # T0191 read from T0191-1pjcA-2track-protein-EBGHSTL-global-adpstyle5.pw.a2m.gz # 1pjcA read from T0191-1pjcA-2track-protein-EBGHSTL-global-adpstyle5.pw.a2m.gz # found chain 1pjcA in template set T0191 1 :I 1pjcA 1 :M Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 2 residues T0191 3 :YNTDGIGARMALEEEIGR 1pjcA 15 :RVGLSPSSVRTLVEAGHT Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 20 residues neighbor-bump: 2.58907 Ang E16.O and I17.CD1 neighbor-bump: 2.17629 Ang E16.O and I17.CG1 neighbor-bump: 2.67119 Ang E16.C and I17.CG1 neighbor-bump: 1.92435 Ang E16.O and I17.CB neighbor-bump: 2.41844 Ang E16.C and I17.CB T0191 21 :VKDKNIVIYGAGGAARAVAFELAK 1pjcA 165 :VKPGKVVILGGGVVGTEAAKMAVG Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 26 residues other bump:2.70113 Ang I7.CD1 and L23.CD2 other bump:2.51188 Ang I7.CG1 and L23.CD1 other bump:1.10707 Ang I7.CD1 and L23.CD1 other bump:1.96604 Ang I7.CD1 and L23.CG other bump:2.36271 Ang I7.CD1 and L23.CB other bump:1.86201 Ang G11.O and A16.CB other bump:2.86011 Ang G11.C and A16.CB T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLN 1pjcA 190 :GAQVQIFDINVERLSYLETLFGSRVE Fragment has 17 clashes (null) has 17 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:2.82109 Ang I22.CD1 and L26.CD2 other bump:2.87292 Ang I5.CD1 and L26.CD2 other bump:2.54449 Ang I5.CG1 and L26.CD1 other bump:2.47902 Ang I5.CD1 and L26.CD1 other bump:2.67771 Ang I5.CG1 and L26.CG other bump:2.50607 Ang I5.CD1 and L26.CG self-bump: 2.21466 Ang A23.CB and A23.C self-bump: 1.23794 Ang A23.CA and A23.CB other bump:1.89358 Ang V12.CG1 and E16.OE2 other bump:1.30061 Ang V12.O and E16.OE1 other bump:2.01321 Ang V12.C and E16.OE1 other bump:2.34526 Ang E13.CA and E16.OE1 other bump:2.11374 Ang V12.O and E16.CD other bump:2.88633 Ang V12.C and E16.CD other bump:2.89138 Ang V12.CG1 and E16.CD other bump:2.91217 Ang N3.CG and I5.CG2 other bump:1.91995 Ang N3.ND2 and I5.CG2 T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLREDMVVMDLIY 1pjcA 216 :LLYSNSAEIETAVAEADLLIGAVLVPGRRAPILVPASLVEQMRTGSVIVDVAV Fragment has 60 clashes (null) has 60 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 55 residues other bump:2.47383 Ang A23.C and I53.CD1 other bump:1.70319 Ang T24.N and I53.CD1 other bump:2.48239 Ang A23.N and I53.CD1 other bump:2.62884 Ang A23.CA and I53.CD1 other bump:2.78794 Ang T24.CA and I53.CD1 other bump:2.18911 Ang N22.ND2 and I53.CD1 other bump:2.82658 Ang T24.N and I53.CG1 other bump:3.16951 Ang N22.ND2 and I53.CG1 other bump:2.22384 Ang N22.CB and D51.OD2 other bump:2.12652 Ang N22.CG and D51.OD2 other bump:1.83036 Ang N22.OD1 and D51.OD1 other bump:2.52796 Ang N22.CB and D51.CG other bump:2.57643 Ang N22.CG and D51.CG other bump:2.19514 Ang N22.OD1 and D51.CG other bump:3.15042 Ang N22.CB and D51.CA other bump:3.02336 Ang I20.CG1 and V49.CG1 other bump:3.00794 Ang I20.CD1 and V49.CG1 other bump:0.885492 Ang V17.O and M47.CE other bump:2.06576 Ang V17.C and M47.CE other bump:2.08315 Ang V17.O and M47.SD other bump:2.68608 Ang V17.C and M47.SD other bump:2.74619 Ang D18.CA and M47.SD other bump:2.55118 Ang D18.O and M47.SD other bump:2.46645 Ang D18.C and M47.SD other bump:2.58219 Ang L14.O and L43.CD2 other bump:2.16854 Ang D15.OD1 and K42.O other bump:2.74141 Ang L14.CB and K39.NZ other bump:2.81738 Ang D33.OD1 and E35.C other bump:2.45887 Ang L14.CD1 and E35.OE2 neighbor-bump: 2.83758 Ang Y29.CD2 and P30.C neighbor-bump: 1.7655 Ang Y29.CD2 and P30.O neighbor-bump: 2.40903 Ang Y29.CE2 and P30.O other bump:2.79301 Ang I26.CA and Y29.OH other bump:1.40781 Ang I26.CB and Y29.OH other bump:1.87505 Ang I26.CG1 and Y29.OH other bump:2.11198 Ang I26.CG2 and Y29.OH other bump:1.85864 Ang I26.CD1 and Y29.OH other bump:2.96035 Ang I26.CA and Y29.CZ other bump:1.49795 Ang I26.CB and Y29.CZ other bump:1.76954 Ang I26.CG1 and Y29.CZ other bump:1.25798 Ang I26.CG2 and Y29.CZ other bump:1.81553 Ang I26.CD1 and Y29.CZ other bump:2.46327 Ang I26.CB and Y29.CE2 other bump:3.11928 Ang I26.CG1 and Y29.CE2 other bump:1.2137 Ang I26.CG2 and Y29.CE2 other bump:2.08915 Ang I26.CB and Y29.CE1 other bump:1.35619 Ang I26.CG1 and Y29.CE1 other bump:2.12197 Ang I26.CG2 and Y29.CE1 other bump:1.70083 Ang I26.CD1 and Y29.CE1 other bump:2.06228 Ang I26.CG2 and Y29.CD2 other bump:2.68452 Ang I26.CG1 and Y29.CD1 other bump:2.70559 Ang I26.CG2 and Y29.CD1 other bump:2.71812 Ang I26.CG2 and Y29.CG neighbor-bump: 1.80648 Ang T24.C and P25.CD neighbor-bump: 2.44044 Ang T24.CA and P25.CD neighbor-bump: 2.66854 Ang T24.C and P25.CG other bump:2.68906 Ang V17.CG1 and I20.CG2 other bump:2.87441 Ang V17.CG1 and I19.C other bump:2.61781 Ang V17.CG1 and I19.O other bump:2.83154 Ang F7.CD1 and D11.OD2 T0191 127 :NPLETVLLKEAK 1pjcA 300 :MPGAVPWTATQA Fragment has 22 clashes (null) has 22 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:1.78605 Ang P3.O and K10.NZ other bump:2.16955 Ang N2.O and K10.NZ other bump:2.34626 Ang N2.C and K10.NZ other bump:1.97352 Ang P3.N and K10.NZ other bump:1.16918 Ang P3.CA and K10.NZ other bump:2.54234 Ang P3.CB and K10.NZ other bump:0.782421 Ang P3.C and K10.NZ other bump:1.59579 Ang L4.N and K10.NZ other bump:1.40352 Ang P3.O and K10.CE other bump:1.57896 Ang P3.CA and K10.CE other bump:2.46384 Ang P3.CB and K10.CE other bump:1.51101 Ang P3.C and K10.CE other bump:2.81153 Ang L4.N and K10.CE other bump:1.16201 Ang P3.O and K10.CD other bump:2.57873 Ang P3.CA and K10.CD other bump:2.75976 Ang P3.CB and K10.CD other bump:1.95199 Ang P3.C and K10.CD other bump:2.55851 Ang P3.O and K10.CG other bump:1.09307 Ang N2.O and E5.OE1 other bump:2.22568 Ang N2.C and E5.OE1 other bump:2.11216 Ang N2.O and E5.CD other bump:3.1411 Ang N2.C and E5.CD T0191 140 :VNAKTINGLGMLIYQGAVAFK 1pjcA 312 :LNNSTLPYVVKLANQGLKALE Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 22 residues other bump:2.15954 Ang G11.O and Y15.CD1 other bump:2.61299 Ang N3.O and I7.CD1 Number of specific fragments= 7 total=1406 Number of alignments=270 # Reading fragments from alignment file # T0191 read from T0191-1pjcA-2track-protein-EBGHSTL-local-adpstyle1.pw.a2m.gz # 1pjcA read from T0191-1pjcA-2track-protein-EBGHSTL-local-adpstyle1.pw.a2m.gz # found chain 1pjcA in template set T0191 25 :NIVIYGAGGAARAVAFELAK 1pjcA 169 :KVVILGGGVVGTEAAKMAVG Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 22 residues other bump:2.70113 Ang I3.CD1 and L19.CD2 other bump:2.51189 Ang I3.CG1 and L19.CD1 other bump:1.10707 Ang I3.CD1 and L19.CD1 other bump:1.96604 Ang I3.CD1 and L19.CG other bump:2.36271 Ang I3.CD1 and L19.CB other bump:2.86011 Ang G7.C and A12.CB other bump:1.86201 Ang G7.O and A12.CB T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLN 1pjcA 190 :GAQVQIFDINVERLSYLETLFGSRVE Fragment has 17 clashes (null) has 17 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:2.82109 Ang I22.CD1 and L26.CD2 other bump:2.87292 Ang I5.CD1 and L26.CD2 other bump:2.54449 Ang I5.CG1 and L26.CD1 other bump:2.47902 Ang I5.CD1 and L26.CD1 other bump:2.67771 Ang I5.CG1 and L26.CG other bump:2.50607 Ang I5.CD1 and L26.CG self-bump: 2.21466 Ang A23.CB and A23.C self-bump: 1.23794 Ang A23.CA and A23.CB other bump:1.89358 Ang V12.CG1 and E16.OE2 other bump:1.30061 Ang V12.O and E16.OE1 other bump:2.01321 Ang V12.C and E16.OE1 other bump:2.34526 Ang E13.CA and E16.OE1 other bump:2.11374 Ang V12.O and E16.CD other bump:2.88633 Ang V12.C and E16.CD other bump:2.89138 Ang V12.CG1 and E16.CD other bump:2.91217 Ang N3.CG and I5.CG2 other bump:1.91995 Ang N3.ND2 and I5.CG2 T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLREDMVVMDLIY 1pjcA 216 :LLYSNSAEIETAVAEADLLIGAVLVPGRRAPILVPASLVEQMRTGSVIVDVAV Fragment has 60 clashes (null) has 60 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 55 residues other bump:2.47383 Ang A23.C and I53.CD1 other bump:1.70319 Ang T24.N and I53.CD1 other bump:2.48239 Ang A23.N and I53.CD1 other bump:2.62884 Ang A23.CA and I53.CD1 other bump:2.78794 Ang T24.CA and I53.CD1 other bump:2.18911 Ang N22.ND2 and I53.CD1 other bump:2.82658 Ang T24.N and I53.CG1 other bump:3.16951 Ang N22.ND2 and I53.CG1 other bump:2.22384 Ang N22.CB and D51.OD2 other bump:2.12652 Ang N22.CG and D51.OD2 other bump:1.83036 Ang N22.OD1 and D51.OD1 other bump:2.52796 Ang N22.CB and D51.CG other bump:2.57643 Ang N22.CG and D51.CG other bump:2.19514 Ang N22.OD1 and D51.CG other bump:3.15042 Ang N22.CB and D51.CA other bump:3.02336 Ang I20.CG1 and V49.CG1 other bump:3.00794 Ang I20.CD1 and V49.CG1 other bump:0.885492 Ang V17.O and M47.CE other bump:2.06576 Ang V17.C and M47.CE other bump:2.08315 Ang V17.O and M47.SD other bump:2.68608 Ang V17.C and M47.SD other bump:2.74619 Ang D18.CA and M47.SD other bump:2.55118 Ang D18.O and M47.SD other bump:2.46645 Ang D18.C and M47.SD other bump:2.58219 Ang L14.O and L43.CD2 other bump:2.16854 Ang D15.OD1 and K42.O other bump:2.74141 Ang L14.CB and K39.NZ other bump:2.81738 Ang D33.OD1 and E35.C other bump:2.45887 Ang L14.CD1 and E35.OE2 neighbor-bump: 2.83758 Ang Y29.CD2 and P30.C neighbor-bump: 1.7655 Ang Y29.CD2 and P30.O neighbor-bump: 2.40903 Ang Y29.CE2 and P30.O other bump:2.79301 Ang I26.CA and Y29.OH other bump:1.40781 Ang I26.CB and Y29.OH other bump:1.87505 Ang I26.CG1 and Y29.OH other bump:2.11198 Ang I26.CG2 and Y29.OH other bump:1.85864 Ang I26.CD1 and Y29.OH other bump:2.96035 Ang I26.CA and Y29.CZ other bump:1.49795 Ang I26.CB and Y29.CZ other bump:1.76954 Ang I26.CG1 and Y29.CZ other bump:1.25798 Ang I26.CG2 and Y29.CZ other bump:1.81553 Ang I26.CD1 and Y29.CZ other bump:2.46327 Ang I26.CB and Y29.CE2 other bump:3.11928 Ang I26.CG1 and Y29.CE2 other bump:1.2137 Ang I26.CG2 and Y29.CE2 other bump:2.08915 Ang I26.CB and Y29.CE1 other bump:1.35619 Ang I26.CG1 and Y29.CE1 other bump:2.12197 Ang I26.CG2 and Y29.CE1 other bump:1.70083 Ang I26.CD1 and Y29.CE1 other bump:2.06228 Ang I26.CG2 and Y29.CD2 other bump:2.68452 Ang I26.CG1 and Y29.CD1 other bump:2.70559 Ang I26.CG2 and Y29.CD1 other bump:2.71812 Ang I26.CG2 and Y29.CG neighbor-bump: 1.80648 Ang T24.C and P25.CD neighbor-bump: 2.44044 Ang T24.CA and P25.CD neighbor-bump: 2.66854 Ang T24.C and P25.CG other bump:2.68906 Ang V17.CG1 and I20.CG2 other bump:2.87441 Ang V17.CG1 and I19.C other bump:2.61781 Ang V17.CG1 and I19.O other bump:2.83154 Ang F7.CD1 and D11.OD2 Number of specific fragments= 3 total=1409 Number of alignments=271 # Reading fragments from alignment file # T0191 read from T0191-1pjcA-2track-protein-EBGHSTL-local-adpstyle5.pw.a2m.gz # 1pjcA read from T0191-1pjcA-2track-protein-EBGHSTL-local-adpstyle5.pw.a2m.gz # found chain 1pjcA in template set T0191 19 :GRVKDKNIVIYGAGGAARAVAFELAK 1pjcA 163 :PGVKPGKVVILGGGVVGTEAAKMAVG Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:2.70113 Ang I9.CD1 and L25.CD2 other bump:2.51188 Ang I9.CG1 and L25.CD1 other bump:1.10707 Ang I9.CD1 and L25.CD1 other bump:1.96604 Ang I9.CD1 and L25.CG other bump:2.36271 Ang I9.CD1 and L25.CB other bump:1.86201 Ang G13.O and A18.CB other bump:2.86011 Ang G13.C and A18.CB T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLN 1pjcA 190 :GAQVQIFDINVERLSYLETLFGSRVE Fragment has 17 clashes (null) has 17 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:2.82109 Ang I22.CD1 and L26.CD2 other bump:2.87292 Ang I5.CD1 and L26.CD2 other bump:2.54449 Ang I5.CG1 and L26.CD1 other bump:2.47902 Ang I5.CD1 and L26.CD1 other bump:2.67771 Ang I5.CG1 and L26.CG other bump:2.50607 Ang I5.CD1 and L26.CG self-bump: 2.21466 Ang A23.CB and A23.C self-bump: 1.23794 Ang A23.CA and A23.CB other bump:1.89358 Ang V12.CG1 and E16.OE2 other bump:1.30061 Ang V12.O and E16.OE1 other bump:2.01321 Ang V12.C and E16.OE1 other bump:2.34526 Ang E13.CA and E16.OE1 other bump:2.11374 Ang V12.O and E16.CD other bump:2.88633 Ang V12.C and E16.CD other bump:2.89138 Ang V12.CG1 and E16.CD other bump:2.91217 Ang N3.CG and I5.CG2 other bump:1.91995 Ang N3.ND2 and I5.CG2 T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLREDMVVMDLIY 1pjcA 216 :LLYSNSAEIETAVAEADLLIGAVLVPGRRAPILVPASLVEQMRTGSVIVDVAV Fragment has 60 clashes (null) has 60 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 55 residues other bump:2.47383 Ang A23.C and I53.CD1 other bump:1.70319 Ang T24.N and I53.CD1 other bump:2.48239 Ang A23.N and I53.CD1 other bump:2.62884 Ang A23.CA and I53.CD1 other bump:2.78794 Ang T24.CA and I53.CD1 other bump:2.18911 Ang N22.ND2 and I53.CD1 other bump:2.82658 Ang T24.N and I53.CG1 other bump:3.16951 Ang N22.ND2 and I53.CG1 other bump:2.22384 Ang N22.CB and D51.OD2 other bump:2.12652 Ang N22.CG and D51.OD2 other bump:1.83036 Ang N22.OD1 and D51.OD1 other bump:2.52796 Ang N22.CB and D51.CG other bump:2.57643 Ang N22.CG and D51.CG other bump:2.19514 Ang N22.OD1 and D51.CG other bump:3.15042 Ang N22.CB and D51.CA other bump:3.02336 Ang I20.CG1 and V49.CG1 other bump:3.00794 Ang I20.CD1 and V49.CG1 other bump:0.885492 Ang V17.O and M47.CE other bump:2.06576 Ang V17.C and M47.CE other bump:2.08315 Ang V17.O and M47.SD other bump:2.68608 Ang V17.C and M47.SD other bump:2.74619 Ang D18.CA and M47.SD other bump:2.55118 Ang D18.O and M47.SD other bump:2.46645 Ang D18.C and M47.SD other bump:2.58219 Ang L14.O and L43.CD2 other bump:2.16854 Ang D15.OD1 and K42.O other bump:2.74141 Ang L14.CB and K39.NZ other bump:2.81738 Ang D33.OD1 and E35.C other bump:2.45887 Ang L14.CD1 and E35.OE2 neighbor-bump: 2.83758 Ang Y29.CD2 and P30.C neighbor-bump: 1.7655 Ang Y29.CD2 and P30.O neighbor-bump: 2.40903 Ang Y29.CE2 and P30.O other bump:2.79301 Ang I26.CA and Y29.OH other bump:1.40781 Ang I26.CB and Y29.OH other bump:1.87505 Ang I26.CG1 and Y29.OH other bump:2.11198 Ang I26.CG2 and Y29.OH other bump:1.85864 Ang I26.CD1 and Y29.OH other bump:2.96035 Ang I26.CA and Y29.CZ other bump:1.49795 Ang I26.CB and Y29.CZ other bump:1.76954 Ang I26.CG1 and Y29.CZ other bump:1.25798 Ang I26.CG2 and Y29.CZ other bump:1.81553 Ang I26.CD1 and Y29.CZ other bump:2.46327 Ang I26.CB and Y29.CE2 other bump:3.11928 Ang I26.CG1 and Y29.CE2 other bump:1.2137 Ang I26.CG2 and Y29.CE2 other bump:2.08915 Ang I26.CB and Y29.CE1 other bump:1.35619 Ang I26.CG1 and Y29.CE1 other bump:2.12197 Ang I26.CG2 and Y29.CE1 other bump:1.70083 Ang I26.CD1 and Y29.CE1 other bump:2.06228 Ang I26.CG2 and Y29.CD2 other bump:2.68452 Ang I26.CG1 and Y29.CD1 other bump:2.70559 Ang I26.CG2 and Y29.CD1 other bump:2.71812 Ang I26.CG2 and Y29.CG neighbor-bump: 1.80648 Ang T24.C and P25.CD neighbor-bump: 2.44044 Ang T24.CA and P25.CD neighbor-bump: 2.66854 Ang T24.C and P25.CG other bump:2.68906 Ang V17.CG1 and I20.CG2 other bump:2.87441 Ang V17.CG1 and I19.C other bump:2.61781 Ang V17.CG1 and I19.O other bump:2.83154 Ang F7.CD1 and D11.OD2 Number of specific fragments= 3 total=1412 Number of alignments=272 # Reading fragments from alignment file # T0191 read from T0191-1pjcA-2track-protein-EBGHTL-global-adpstyle1.pw.a2m.gz # 1pjcA read from T0191-1pjcA-2track-protein-EBGHTL-global-adpstyle1.pw.a2m.gz # found chain 1pjcA in template set T0191 3 :YNTDGIGARMALEEEIGR 1pjcA 15 :RVGLSPSSVRTLVEAGHT Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 20 residues neighbor-bump: 2.58907 Ang E16.O and I17.CD1 neighbor-bump: 2.17629 Ang E16.O and I17.CG1 neighbor-bump: 2.67119 Ang E16.C and I17.CG1 neighbor-bump: 1.92435 Ang E16.O and I17.CB neighbor-bump: 2.41844 Ang E16.C and I17.CB T0191 21 :VKDKNIVIYGAGGAARAVAFELAK 1pjcA 165 :VKPGKVVILGGGVVGTEAAKMAVG Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 26 residues other bump:2.70113 Ang I7.CD1 and L23.CD2 other bump:2.51188 Ang I7.CG1 and L23.CD1 other bump:1.10707 Ang I7.CD1 and L23.CD1 other bump:1.96604 Ang I7.CD1 and L23.CG other bump:2.36271 Ang I7.CD1 and L23.CB other bump:1.86201 Ang G11.O and A16.CB other bump:2.86011 Ang G11.C and A16.CB T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLN 1pjcA 190 :GAQVQIFDINVERLSYLETLFGSRVE Fragment has 17 clashes (null) has 17 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:2.82109 Ang I22.CD1 and L26.CD2 other bump:2.87292 Ang I5.CD1 and L26.CD2 other bump:2.54449 Ang I5.CG1 and L26.CD1 other bump:2.47902 Ang I5.CD1 and L26.CD1 other bump:2.67771 Ang I5.CG1 and L26.CG other bump:2.50607 Ang I5.CD1 and L26.CG self-bump: 2.21466 Ang A23.CB and A23.C self-bump: 1.23794 Ang A23.CA and A23.CB other bump:1.89358 Ang V12.CG1 and E16.OE2 other bump:1.30061 Ang V12.O and E16.OE1 other bump:2.01321 Ang V12.C and E16.OE1 other bump:2.34526 Ang E13.CA and E16.OE1 other bump:2.11374 Ang V12.O and E16.CD other bump:2.88633 Ang V12.C and E16.CD other bump:2.89138 Ang V12.CG1 and E16.CD other bump:2.91217 Ang N3.CG and I5.CG2 other bump:1.91995 Ang N3.ND2 and I5.CG2 T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLREDMVVMDLIY 1pjcA 216 :LLYSNSAEIETAVAEADLLIGAVLVPGRRAPILVPASLVEQMRTGSVIVDVAV Fragment has 60 clashes (null) has 60 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 55 residues other bump:2.47383 Ang A23.C and I53.CD1 other bump:1.70319 Ang T24.N and I53.CD1 other bump:2.48239 Ang A23.N and I53.CD1 other bump:2.62884 Ang A23.CA and I53.CD1 other bump:2.78794 Ang T24.CA and I53.CD1 other bump:2.18911 Ang N22.ND2 and I53.CD1 other bump:2.82658 Ang T24.N and I53.CG1 other bump:3.16951 Ang N22.ND2 and I53.CG1 other bump:2.22384 Ang N22.CB and D51.OD2 other bump:2.12652 Ang N22.CG and D51.OD2 other bump:1.83036 Ang N22.OD1 and D51.OD1 other bump:2.52796 Ang N22.CB and D51.CG other bump:2.57643 Ang N22.CG and D51.CG other bump:2.19514 Ang N22.OD1 and D51.CG other bump:3.15042 Ang N22.CB and D51.CA other bump:3.02336 Ang I20.CG1 and V49.CG1 other bump:3.00794 Ang I20.CD1 and V49.CG1 other bump:0.885492 Ang V17.O and M47.CE other bump:2.06576 Ang V17.C and M47.CE other bump:2.08315 Ang V17.O and M47.SD other bump:2.68608 Ang V17.C and M47.SD other bump:2.74619 Ang D18.CA and M47.SD other bump:2.55118 Ang D18.O and M47.SD other bump:2.46645 Ang D18.C and M47.SD other bump:2.58219 Ang L14.O and L43.CD2 other bump:2.16854 Ang D15.OD1 and K42.O other bump:2.74141 Ang L14.CB and K39.NZ other bump:2.81738 Ang D33.OD1 and E35.C other bump:2.45887 Ang L14.CD1 and E35.OE2 neighbor-bump: 2.83758 Ang Y29.CD2 and P30.C neighbor-bump: 1.7655 Ang Y29.CD2 and P30.O neighbor-bump: 2.40903 Ang Y29.CE2 and P30.O other bump:2.79301 Ang I26.CA and Y29.OH other bump:1.40781 Ang I26.CB and Y29.OH other bump:1.87505 Ang I26.CG1 and Y29.OH other bump:2.11198 Ang I26.CG2 and Y29.OH other bump:1.85864 Ang I26.CD1 and Y29.OH other bump:2.96035 Ang I26.CA and Y29.CZ other bump:1.49795 Ang I26.CB and Y29.CZ other bump:1.76954 Ang I26.CG1 and Y29.CZ other bump:1.25798 Ang I26.CG2 and Y29.CZ other bump:1.81553 Ang I26.CD1 and Y29.CZ other bump:2.46327 Ang I26.CB and Y29.CE2 other bump:3.11928 Ang I26.CG1 and Y29.CE2 other bump:1.2137 Ang I26.CG2 and Y29.CE2 other bump:2.08915 Ang I26.CB and Y29.CE1 other bump:1.35619 Ang I26.CG1 and Y29.CE1 other bump:2.12197 Ang I26.CG2 and Y29.CE1 other bump:1.70083 Ang I26.CD1 and Y29.CE1 other bump:2.06228 Ang I26.CG2 and Y29.CD2 other bump:2.68452 Ang I26.CG1 and Y29.CD1 other bump:2.70559 Ang I26.CG2 and Y29.CD1 other bump:2.71812 Ang I26.CG2 and Y29.CG neighbor-bump: 1.80648 Ang T24.C and P25.CD neighbor-bump: 2.44044 Ang T24.CA and P25.CD neighbor-bump: 2.66854 Ang T24.C and P25.CG other bump:2.68906 Ang V17.CG1 and I20.CG2 other bump:2.87441 Ang V17.CG1 and I19.C other bump:2.61781 Ang V17.CG1 and I19.O other bump:2.83154 Ang F7.CD1 and D11.OD2 T0191 127 :NPLETVLLKEAKKVNAKTINGLGMLIYQGAVAFK 1pjcA 299 :NMPGAVPWTATQALNNSTLPYVVKLANQGLKALE Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 35 residues other bump:2.15954 Ang G24.O and Y28.CD1 other bump:2.61299 Ang N16.O and I20.CD1 other bump:2.08694 Ang L4.CD2 and E11.OE2 other bump:3.04729 Ang L4.CB and E11.CD other bump:2.68377 Ang L4.CD2 and E11.CD other bump:2.53407 Ang L4.O and E11.CG neighbor-bump: 2.62832 Ang N2.N and P3.CD Number of specific fragments= 5 total=1417 Number of alignments=273 # Reading fragments from alignment file # T0191 read from T0191-1pjcA-2track-protein-EBGHTL-global-adpstyle5.pw.a2m.gz # 1pjcA read from T0191-1pjcA-2track-protein-EBGHTL-global-adpstyle5.pw.a2m.gz # found chain 1pjcA in template set T0191 1 :I 1pjcA 1 :M Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 2 residues T0191 3 :YNTDGIGARMALEEEIGR 1pjcA 15 :RVGLSPSSVRTLVEAGHT Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 20 residues neighbor-bump: 2.58907 Ang E16.O and I17.CD1 neighbor-bump: 2.17629 Ang E16.O and I17.CG1 neighbor-bump: 2.67119 Ang E16.C and I17.CG1 neighbor-bump: 1.92435 Ang E16.O and I17.CB neighbor-bump: 2.41844 Ang E16.C and I17.CB T0191 21 :VKDKNIVIYGAGGAARAVAFELAK 1pjcA 165 :VKPGKVVILGGGVVGTEAAKMAVG Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 26 residues other bump:2.70113 Ang I7.CD1 and L23.CD2 other bump:2.51188 Ang I7.CG1 and L23.CD1 other bump:1.10707 Ang I7.CD1 and L23.CD1 other bump:1.96604 Ang I7.CD1 and L23.CG other bump:2.36271 Ang I7.CD1 and L23.CB other bump:1.86201 Ang G11.O and A16.CB other bump:2.86011 Ang G11.C and A16.CB T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLN 1pjcA 190 :GAQVQIFDINVERLSYLETLFGSRVE Fragment has 17 clashes (null) has 17 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:2.82109 Ang I22.CD1 and L26.CD2 other bump:2.87292 Ang I5.CD1 and L26.CD2 other bump:2.54449 Ang I5.CG1 and L26.CD1 other bump:2.47902 Ang I5.CD1 and L26.CD1 other bump:2.67771 Ang I5.CG1 and L26.CG other bump:2.50607 Ang I5.CD1 and L26.CG self-bump: 2.21466 Ang A23.CB and A23.C self-bump: 1.23794 Ang A23.CA and A23.CB other bump:1.89358 Ang V12.CG1 and E16.OE2 other bump:1.30061 Ang V12.O and E16.OE1 other bump:2.01321 Ang V12.C and E16.OE1 other bump:2.34526 Ang E13.CA and E16.OE1 other bump:2.11374 Ang V12.O and E16.CD other bump:2.88633 Ang V12.C and E16.CD other bump:2.89138 Ang V12.CG1 and E16.CD other bump:2.91217 Ang N3.CG and I5.CG2 other bump:1.91995 Ang N3.ND2 and I5.CG2 T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLREDMVVMDLIY 1pjcA 216 :LLYSNSAEIETAVAEADLLIGAVLVPGRRAPILVPASLVEQMRTGSVIVDVAV Fragment has 60 clashes (null) has 60 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 55 residues other bump:2.47383 Ang A23.C and I53.CD1 other bump:1.70319 Ang T24.N and I53.CD1 other bump:2.48239 Ang A23.N and I53.CD1 other bump:2.62884 Ang A23.CA and I53.CD1 other bump:2.78794 Ang T24.CA and I53.CD1 other bump:2.18911 Ang N22.ND2 and I53.CD1 other bump:2.82658 Ang T24.N and I53.CG1 other bump:3.16951 Ang N22.ND2 and I53.CG1 other bump:2.22384 Ang N22.CB and D51.OD2 other bump:2.12652 Ang N22.CG and D51.OD2 other bump:1.83036 Ang N22.OD1 and D51.OD1 other bump:2.52796 Ang N22.CB and D51.CG other bump:2.57643 Ang N22.CG and D51.CG other bump:2.19514 Ang N22.OD1 and D51.CG other bump:3.15042 Ang N22.CB and D51.CA other bump:3.02336 Ang I20.CG1 and V49.CG1 other bump:3.00794 Ang I20.CD1 and V49.CG1 other bump:0.885492 Ang V17.O and M47.CE other bump:2.06576 Ang V17.C and M47.CE other bump:2.08315 Ang V17.O and M47.SD other bump:2.68608 Ang V17.C and M47.SD other bump:2.74619 Ang D18.CA and M47.SD other bump:2.55118 Ang D18.O and M47.SD other bump:2.46645 Ang D18.C and M47.SD other bump:2.58219 Ang L14.O and L43.CD2 other bump:2.16854 Ang D15.OD1 and K42.O other bump:2.74141 Ang L14.CB and K39.NZ other bump:2.81738 Ang D33.OD1 and E35.C other bump:2.45887 Ang L14.CD1 and E35.OE2 neighbor-bump: 2.83758 Ang Y29.CD2 and P30.C neighbor-bump: 1.7655 Ang Y29.CD2 and P30.O neighbor-bump: 2.40903 Ang Y29.CE2 and P30.O other bump:2.79301 Ang I26.CA and Y29.OH other bump:1.40781 Ang I26.CB and Y29.OH other bump:1.87505 Ang I26.CG1 and Y29.OH other bump:2.11198 Ang I26.CG2 and Y29.OH other bump:1.85864 Ang I26.CD1 and Y29.OH other bump:2.96035 Ang I26.CA and Y29.CZ other bump:1.49795 Ang I26.CB and Y29.CZ other bump:1.76954 Ang I26.CG1 and Y29.CZ other bump:1.25798 Ang I26.CG2 and Y29.CZ other bump:1.81553 Ang I26.CD1 and Y29.CZ other bump:2.46327 Ang I26.CB and Y29.CE2 other bump:3.11928 Ang I26.CG1 and Y29.CE2 other bump:1.2137 Ang I26.CG2 and Y29.CE2 other bump:2.08915 Ang I26.CB and Y29.CE1 other bump:1.35619 Ang I26.CG1 and Y29.CE1 other bump:2.12197 Ang I26.CG2 and Y29.CE1 other bump:1.70083 Ang I26.CD1 and Y29.CE1 other bump:2.06228 Ang I26.CG2 and Y29.CD2 other bump:2.68452 Ang I26.CG1 and Y29.CD1 other bump:2.70559 Ang I26.CG2 and Y29.CD1 other bump:2.71812 Ang I26.CG2 and Y29.CG neighbor-bump: 1.80648 Ang T24.C and P25.CD neighbor-bump: 2.44044 Ang T24.CA and P25.CD neighbor-bump: 2.66854 Ang T24.C and P25.CG other bump:2.68906 Ang V17.CG1 and I20.CG2 other bump:2.87441 Ang V17.CG1 and I19.C other bump:2.61781 Ang V17.CG1 and I19.O other bump:2.83154 Ang F7.CD1 and D11.OD2 T0191 128 :PLETV 1pjcA 301 :PGAVP Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 7 residues other bump:1.09307 Ang G1.O and E4.OE1 other bump:2.22568 Ang G1.C and E4.OE1 other bump:2.11216 Ang G1.O and E4.CD other bump:3.1411 Ang G1.C and E4.CD T0191 134 :LKEAKKVNAKTINGLGMLIYQGAVAF 1pjcA 306 :WTATQALNNSTLPYVVKLANQGLKAL Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:2.15954 Ang G17.O and Y21.CD1 other bump:2.61299 Ang N9.O and I13.CD1 Number of specific fragments= 7 total=1424 Number of alignments=274 # Reading fragments from alignment file # T0191 read from T0191-1pjcA-2track-protein-EBGHTL-local-adpstyle1.pw.a2m.gz # 1pjcA read from T0191-1pjcA-2track-protein-EBGHTL-local-adpstyle1.pw.a2m.gz # found chain 1pjcA in template set T0191 25 :NIVIYGAGGAARAVAFELAK 1pjcA 169 :KVVILGGGVVGTEAAKMAVG Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 22 residues other bump:2.70113 Ang I3.CD1 and L19.CD2 other bump:2.51189 Ang I3.CG1 and L19.CD1 other bump:1.10707 Ang I3.CD1 and L19.CD1 other bump:1.96604 Ang I3.CD1 and L19.CG other bump:2.36271 Ang I3.CD1 and L19.CB other bump:2.86011 Ang G7.C and A12.CB other bump:1.86201 Ang G7.O and A12.CB T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLN 1pjcA 190 :GAQVQIFDINVERLSYLETLFGSRVE Fragment has 17 clashes (null) has 17 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:2.82109 Ang I22.CD1 and L26.CD2 other bump:2.87292 Ang I5.CD1 and L26.CD2 other bump:2.54449 Ang I5.CG1 and L26.CD1 other bump:2.47902 Ang I5.CD1 and L26.CD1 other bump:2.67771 Ang I5.CG1 and L26.CG other bump:2.50607 Ang I5.CD1 and L26.CG self-bump: 2.21466 Ang A23.CB and A23.C self-bump: 1.23794 Ang A23.CA and A23.CB other bump:1.89358 Ang V12.CG1 and E16.OE2 other bump:1.30061 Ang V12.O and E16.OE1 other bump:2.01321 Ang V12.C and E16.OE1 other bump:2.34526 Ang E13.CA and E16.OE1 other bump:2.11374 Ang V12.O and E16.CD other bump:2.88633 Ang V12.C and E16.CD other bump:2.89138 Ang V12.CG1 and E16.CD other bump:2.91217 Ang N3.CG and I5.CG2 other bump:1.91995 Ang N3.ND2 and I5.CG2 T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLREDMVVMDLIYNP 1pjcA 216 :LLYSNSAEIETAVAEADLLIGAVLVPGRRAPILVPASLVEQMRTGSVIVDVAVDQ Fragment has 61 clashes (null) has 61 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 57 residues neighbor-bump: 2.31092 Ang P56.N and G57.N other bump:2.47383 Ang A23.C and I53.CD1 other bump:1.70319 Ang T24.N and I53.CD1 other bump:2.48239 Ang A23.N and I53.CD1 other bump:2.62884 Ang A23.CA and I53.CD1 other bump:2.78794 Ang T24.CA and I53.CD1 other bump:2.18911 Ang N22.ND2 and I53.CD1 other bump:2.82658 Ang T24.N and I53.CG1 other bump:3.16951 Ang N22.ND2 and I53.CG1 other bump:2.22384 Ang N22.CB and D51.OD2 other bump:2.12652 Ang N22.CG and D51.OD2 other bump:1.83036 Ang N22.OD1 and D51.OD1 other bump:2.52796 Ang N22.CB and D51.CG other bump:2.57643 Ang N22.CG and D51.CG other bump:2.19514 Ang N22.OD1 and D51.CG other bump:3.15042 Ang N22.CB and D51.CA other bump:3.02336 Ang I20.CG1 and V49.CG1 other bump:3.00794 Ang I20.CD1 and V49.CG1 other bump:0.885492 Ang V17.O and M47.CE other bump:2.06576 Ang V17.C and M47.CE other bump:2.08315 Ang V17.O and M47.SD other bump:2.68608 Ang V17.C and M47.SD other bump:2.74619 Ang D18.CA and M47.SD other bump:2.55118 Ang D18.O and M47.SD other bump:2.46645 Ang D18.C and M47.SD other bump:2.58219 Ang L14.O and L43.CD2 other bump:2.16854 Ang D15.OD1 and K42.O other bump:2.74141 Ang L14.CB and K39.NZ other bump:2.81738 Ang D33.OD1 and E35.C other bump:2.45887 Ang L14.CD1 and E35.OE2 neighbor-bump: 2.83758 Ang Y29.CD2 and P30.C neighbor-bump: 1.7655 Ang Y29.CD2 and P30.O neighbor-bump: 2.40903 Ang Y29.CE2 and P30.O other bump:2.79301 Ang I26.CA and Y29.OH other bump:1.40781 Ang I26.CB and Y29.OH other bump:1.87505 Ang I26.CG1 and Y29.OH other bump:2.11198 Ang I26.CG2 and Y29.OH other bump:1.85864 Ang I26.CD1 and Y29.OH other bump:2.96035 Ang I26.CA and Y29.CZ other bump:1.49795 Ang I26.CB and Y29.CZ other bump:1.76954 Ang I26.CG1 and Y29.CZ other bump:1.25798 Ang I26.CG2 and Y29.CZ other bump:1.81553 Ang I26.CD1 and Y29.CZ other bump:2.46327 Ang I26.CB and Y29.CE2 other bump:3.11928 Ang I26.CG1 and Y29.CE2 other bump:1.2137 Ang I26.CG2 and Y29.CE2 other bump:2.08915 Ang I26.CB and Y29.CE1 other bump:1.35619 Ang I26.CG1 and Y29.CE1 other bump:2.12197 Ang I26.CG2 and Y29.CE1 other bump:1.70083 Ang I26.CD1 and Y29.CE1 other bump:2.06228 Ang I26.CG2 and Y29.CD2 other bump:2.68452 Ang I26.CG1 and Y29.CD1 other bump:2.70559 Ang I26.CG2 and Y29.CD1 other bump:2.71812 Ang I26.CG2 and Y29.CG neighbor-bump: 1.80648 Ang T24.C and P25.CD neighbor-bump: 2.44044 Ang T24.CA and P25.CD neighbor-bump: 2.66854 Ang T24.C and P25.CG other bump:2.68906 Ang V17.CG1 and I20.CG2 other bump:2.87441 Ang V17.CG1 and I19.C other bump:2.61781 Ang V17.CG1 and I19.O other bump:2.83154 Ang F7.CD1 and D11.OD2 Number of specific fragments= 3 total=1427 Number of alignments=275 # Reading fragments from alignment file # T0191 read from T0191-1pjcA-2track-protein-EBGHTL-local-adpstyle5.pw.a2m.gz # 1pjcA read from T0191-1pjcA-2track-protein-EBGHTL-local-adpstyle5.pw.a2m.gz # found chain 1pjcA in template set T0191 18 :IGRVKDKNIVIYGAGGAARAVAFELAK 1pjcA 162 :VPGVKPGKVVILGGGVVGTEAAKMAVG Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 29 residues other bump:2.70113 Ang I10.CD1 and L26.CD2 other bump:2.51188 Ang I10.CG1 and L26.CD1 other bump:1.10707 Ang I10.CD1 and L26.CD1 other bump:1.96604 Ang I10.CD1 and L26.CG other bump:2.36271 Ang I10.CD1 and L26.CB other bump:1.86201 Ang G14.O and A19.CB other bump:2.86011 Ang G14.C and A19.CB T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLN 1pjcA 190 :GAQVQIFDINVERLSYLETLFGSRVE Fragment has 17 clashes (null) has 17 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:2.82109 Ang I22.CD1 and L26.CD2 other bump:2.87292 Ang I5.CD1 and L26.CD2 other bump:2.54449 Ang I5.CG1 and L26.CD1 other bump:2.47902 Ang I5.CD1 and L26.CD1 other bump:2.67771 Ang I5.CG1 and L26.CG other bump:2.50607 Ang I5.CD1 and L26.CG self-bump: 2.21466 Ang A23.CB and A23.C self-bump: 1.23794 Ang A23.CA and A23.CB other bump:1.89358 Ang V12.CG1 and E16.OE2 other bump:1.30061 Ang V12.O and E16.OE1 other bump:2.01321 Ang V12.C and E16.OE1 other bump:2.34526 Ang E13.CA and E16.OE1 other bump:2.11374 Ang V12.O and E16.CD other bump:2.88633 Ang V12.C and E16.CD other bump:2.89138 Ang V12.CG1 and E16.CD other bump:2.91217 Ang N3.CG and I5.CG2 other bump:1.91995 Ang N3.ND2 and I5.CG2 T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLREDMVVMDLIYNP 1pjcA 216 :LLYSNSAEIETAVAEADLLIGAVLVPGRRAPILVPASLVEQMRTGSVIVDVAVDQ Fragment has 61 clashes (null) has 61 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 57 residues neighbor-bump: 2.31092 Ang P56.N and G57.N other bump:2.47383 Ang A23.C and I53.CD1 other bump:1.70319 Ang T24.N and I53.CD1 other bump:2.48239 Ang A23.N and I53.CD1 other bump:2.62884 Ang A23.CA and I53.CD1 other bump:2.78794 Ang T24.CA and I53.CD1 other bump:2.18911 Ang N22.ND2 and I53.CD1 other bump:2.82658 Ang T24.N and I53.CG1 other bump:3.16951 Ang N22.ND2 and I53.CG1 other bump:2.22384 Ang N22.CB and D51.OD2 other bump:2.12652 Ang N22.CG and D51.OD2 other bump:1.83036 Ang N22.OD1 and D51.OD1 other bump:2.52796 Ang N22.CB and D51.CG other bump:2.57643 Ang N22.CG and D51.CG other bump:2.19514 Ang N22.OD1 and D51.CG other bump:3.15042 Ang N22.CB and D51.CA other bump:3.02336 Ang I20.CG1 and V49.CG1 other bump:3.00794 Ang I20.CD1 and V49.CG1 other bump:0.885492 Ang V17.O and M47.CE other bump:2.06576 Ang V17.C and M47.CE other bump:2.08315 Ang V17.O and M47.SD other bump:2.68608 Ang V17.C and M47.SD other bump:2.74619 Ang D18.CA and M47.SD other bump:2.55118 Ang D18.O and M47.SD other bump:2.46645 Ang D18.C and M47.SD other bump:2.58219 Ang L14.O and L43.CD2 other bump:2.16854 Ang D15.OD1 and K42.O other bump:2.74141 Ang L14.CB and K39.NZ other bump:2.81738 Ang D33.OD1 and E35.C other bump:2.45887 Ang L14.CD1 and E35.OE2 neighbor-bump: 2.83758 Ang Y29.CD2 and P30.C neighbor-bump: 1.7655 Ang Y29.CD2 and P30.O neighbor-bump: 2.40903 Ang Y29.CE2 and P30.O other bump:2.79301 Ang I26.CA and Y29.OH other bump:1.40781 Ang I26.CB and Y29.OH other bump:1.87505 Ang I26.CG1 and Y29.OH other bump:2.11198 Ang I26.CG2 and Y29.OH other bump:1.85864 Ang I26.CD1 and Y29.OH other bump:2.96035 Ang I26.CA and Y29.CZ other bump:1.49795 Ang I26.CB and Y29.CZ other bump:1.76954 Ang I26.CG1 and Y29.CZ other bump:1.25798 Ang I26.CG2 and Y29.CZ other bump:1.81553 Ang I26.CD1 and Y29.CZ other bump:2.46327 Ang I26.CB and Y29.CE2 other bump:3.11928 Ang I26.CG1 and Y29.CE2 other bump:1.2137 Ang I26.CG2 and Y29.CE2 other bump:2.08915 Ang I26.CB and Y29.CE1 other bump:1.35619 Ang I26.CG1 and Y29.CE1 other bump:2.12197 Ang I26.CG2 and Y29.CE1 other bump:1.70083 Ang I26.CD1 and Y29.CE1 other bump:2.06228 Ang I26.CG2 and Y29.CD2 other bump:2.68452 Ang I26.CG1 and Y29.CD1 other bump:2.70559 Ang I26.CG2 and Y29.CD1 other bump:2.71812 Ang I26.CG2 and Y29.CG neighbor-bump: 1.80648 Ang T24.C and P25.CD neighbor-bump: 2.44044 Ang T24.CA and P25.CD neighbor-bump: 2.66854 Ang T24.C and P25.CG other bump:2.68906 Ang V17.CG1 and I20.CG2 other bump:2.87441 Ang V17.CG1 and I19.C other bump:2.61781 Ang V17.CG1 and I19.O other bump:2.83154 Ang F7.CD1 and D11.OD2 Number of specific fragments= 3 total=1430 Number of alignments=276 # Reading fragments from alignment file # T0191 read from T0191-1pjcA-2track-protein-STR-global-adpstyle1.pw.a2m.gz # 1pjcA read from T0191-1pjcA-2track-protein-STR-global-adpstyle1.pw.a2m.gz # found chain 1pjcA in template set T0191 3 :YNTDGIGARMALEEEIGR 1pjcA 15 :RVGLSPSSVRTLVEAGHT Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 20 residues neighbor-bump: 2.58907 Ang E16.O and I17.CD1 neighbor-bump: 2.17629 Ang E16.O and I17.CG1 neighbor-bump: 2.67119 Ang E16.C and I17.CG1 neighbor-bump: 1.92435 Ang E16.O and I17.CB neighbor-bump: 2.41844 Ang E16.C and I17.CB T0191 21 :VKDKNIVIYGAGGAARAVAFELAK 1pjcA 165 :VKPGKVVILGGGVVGTEAAKMAVG Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 26 residues other bump:2.70113 Ang I7.CD1 and L23.CD2 other bump:2.51188 Ang I7.CG1 and L23.CD1 other bump:1.10707 Ang I7.CD1 and L23.CD1 other bump:1.96604 Ang I7.CD1 and L23.CG other bump:2.36271 Ang I7.CD1 and L23.CB other bump:1.86201 Ang G11.O and A16.CB other bump:2.86011 Ang G11.C and A16.CB T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLN 1pjcA 190 :GAQVQIFDINVERLSYLETLFGSRVE Fragment has 17 clashes (null) has 17 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:2.82109 Ang I22.CD1 and L26.CD2 other bump:2.87292 Ang I5.CD1 and L26.CD2 other bump:2.54449 Ang I5.CG1 and L26.CD1 other bump:2.47902 Ang I5.CD1 and L26.CD1 other bump:2.67771 Ang I5.CG1 and L26.CG other bump:2.50607 Ang I5.CD1 and L26.CG self-bump: 2.21466 Ang A23.CB and A23.C self-bump: 1.23794 Ang A23.CA and A23.CB other bump:1.89358 Ang V12.CG1 and E16.OE2 other bump:1.30061 Ang V12.O and E16.OE1 other bump:2.01321 Ang V12.C and E16.OE1 other bump:2.34526 Ang E13.CA and E16.OE1 other bump:2.11374 Ang V12.O and E16.CD other bump:2.88633 Ang V12.C and E16.CD other bump:2.89138 Ang V12.CG1 and E16.CD other bump:2.91217 Ang N3.CG and I5.CG2 other bump:1.91995 Ang N3.ND2 and I5.CG2 T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLREDMVVMDLIY 1pjcA 216 :LLYSNSAEIETAVAEADLLIGAVLVPGRRAPILVPASLVEQMRTGSVIVDVAV Fragment has 60 clashes (null) has 60 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 55 residues other bump:2.47383 Ang A23.C and I53.CD1 other bump:1.70319 Ang T24.N and I53.CD1 other bump:2.48239 Ang A23.N and I53.CD1 other bump:2.62884 Ang A23.CA and I53.CD1 other bump:2.78794 Ang T24.CA and I53.CD1 other bump:2.18911 Ang N22.ND2 and I53.CD1 other bump:2.82658 Ang T24.N and I53.CG1 other bump:3.16951 Ang N22.ND2 and I53.CG1 other bump:2.22384 Ang N22.CB and D51.OD2 other bump:2.12652 Ang N22.CG and D51.OD2 other bump:1.83036 Ang N22.OD1 and D51.OD1 other bump:2.52796 Ang N22.CB and D51.CG other bump:2.57643 Ang N22.CG and D51.CG other bump:2.19514 Ang N22.OD1 and D51.CG other bump:3.15042 Ang N22.CB and D51.CA other bump:3.02336 Ang I20.CG1 and V49.CG1 other bump:3.00794 Ang I20.CD1 and V49.CG1 other bump:0.885492 Ang V17.O and M47.CE other bump:2.06576 Ang V17.C and M47.CE other bump:2.08315 Ang V17.O and M47.SD other bump:2.68608 Ang V17.C and M47.SD other bump:2.74619 Ang D18.CA and M47.SD other bump:2.55118 Ang D18.O and M47.SD other bump:2.46645 Ang D18.C and M47.SD other bump:2.58219 Ang L14.O and L43.CD2 other bump:2.16854 Ang D15.OD1 and K42.O other bump:2.74141 Ang L14.CB and K39.NZ other bump:2.81738 Ang D33.OD1 and E35.C other bump:2.45887 Ang L14.CD1 and E35.OE2 neighbor-bump: 2.83758 Ang Y29.CD2 and P30.C neighbor-bump: 1.7655 Ang Y29.CD2 and P30.O neighbor-bump: 2.40903 Ang Y29.CE2 and P30.O other bump:2.79301 Ang I26.CA and Y29.OH other bump:1.40781 Ang I26.CB and Y29.OH other bump:1.87505 Ang I26.CG1 and Y29.OH other bump:2.11198 Ang I26.CG2 and Y29.OH other bump:1.85864 Ang I26.CD1 and Y29.OH other bump:2.96035 Ang I26.CA and Y29.CZ other bump:1.49795 Ang I26.CB and Y29.CZ other bump:1.76954 Ang I26.CG1 and Y29.CZ other bump:1.25798 Ang I26.CG2 and Y29.CZ other bump:1.81553 Ang I26.CD1 and Y29.CZ other bump:2.46327 Ang I26.CB and Y29.CE2 other bump:3.11928 Ang I26.CG1 and Y29.CE2 other bump:1.2137 Ang I26.CG2 and Y29.CE2 other bump:2.08915 Ang I26.CB and Y29.CE1 other bump:1.35619 Ang I26.CG1 and Y29.CE1 other bump:2.12197 Ang I26.CG2 and Y29.CE1 other bump:1.70083 Ang I26.CD1 and Y29.CE1 other bump:2.06228 Ang I26.CG2 and Y29.CD2 other bump:2.68452 Ang I26.CG1 and Y29.CD1 other bump:2.70559 Ang I26.CG2 and Y29.CD1 other bump:2.71812 Ang I26.CG2 and Y29.CG neighbor-bump: 1.80648 Ang T24.C and P25.CD neighbor-bump: 2.44044 Ang T24.CA and P25.CD neighbor-bump: 2.66854 Ang T24.C and P25.CG other bump:2.68906 Ang V17.CG1 and I20.CG2 other bump:2.87441 Ang V17.CG1 and I19.C other bump:2.61781 Ang V17.CG1 and I19.O other bump:2.83154 Ang F7.CD1 and D11.OD2 T0191 127 :NPLE 1pjcA 297 :VPNM Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 6 residues other bump:1.76638 Ang N2.O and E5.OE2 other bump:2.76892 Ang N2.C and E5.OE2 T0191 131 :TVLLKEAKKVNAKTINGLGMLIYQGAVAFK 1pjcA 303 :AVPWTATQALNNSTLPYVVKLANQGLKALE Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 31 residues other bump:2.15954 Ang G20.O and Y24.CD1 other bump:2.61299 Ang N12.O and I16.CD1 Number of specific fragments= 6 total=1436 Number of alignments=277 # Reading fragments from alignment file # T0191 read from T0191-1pjcA-2track-protein-STR-global-adpstyle5.pw.a2m.gz # 1pjcA read from T0191-1pjcA-2track-protein-STR-global-adpstyle5.pw.a2m.gz # found chain 1pjcA in template set T0191 1 :I 1pjcA 1 :M Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 2 residues T0191 3 :YNTDGIGARMALEEEIGR 1pjcA 15 :RVGLSPSSVRTLVEAGHT Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 20 residues neighbor-bump: 2.58907 Ang E16.O and I17.CD1 neighbor-bump: 2.17629 Ang E16.O and I17.CG1 neighbor-bump: 2.67119 Ang E16.C and I17.CG1 neighbor-bump: 1.92435 Ang E16.O and I17.CB neighbor-bump: 2.41844 Ang E16.C and I17.CB T0191 21 :VKDKNIVIYGAGGAARAVAFELAK 1pjcA 165 :VKPGKVVILGGGVVGTEAAKMAVG Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 26 residues other bump:2.70113 Ang I7.CD1 and L23.CD2 other bump:2.51188 Ang I7.CG1 and L23.CD1 other bump:1.10707 Ang I7.CD1 and L23.CD1 other bump:1.96604 Ang I7.CD1 and L23.CG other bump:2.36271 Ang I7.CD1 and L23.CB other bump:1.86201 Ang G11.O and A16.CB other bump:2.86011 Ang G11.C and A16.CB T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLN 1pjcA 190 :GAQVQIFDINVERLSYLETLFGSRVE Fragment has 17 clashes (null) has 17 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:2.82109 Ang I22.CD1 and L26.CD2 other bump:2.87292 Ang I5.CD1 and L26.CD2 other bump:2.54449 Ang I5.CG1 and L26.CD1 other bump:2.47902 Ang I5.CD1 and L26.CD1 other bump:2.67771 Ang I5.CG1 and L26.CG other bump:2.50607 Ang I5.CD1 and L26.CG self-bump: 2.21466 Ang A23.CB and A23.C self-bump: 1.23794 Ang A23.CA and A23.CB other bump:1.89358 Ang V12.CG1 and E16.OE2 other bump:1.30061 Ang V12.O and E16.OE1 other bump:2.01321 Ang V12.C and E16.OE1 other bump:2.34526 Ang E13.CA and E16.OE1 other bump:2.11374 Ang V12.O and E16.CD other bump:2.88633 Ang V12.C and E16.CD other bump:2.89138 Ang V12.CG1 and E16.CD other bump:2.91217 Ang N3.CG and I5.CG2 other bump:1.91995 Ang N3.ND2 and I5.CG2 T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLREDMVVMDLIY 1pjcA 216 :LLYSNSAEIETAVAEADLLIGAVLVPGRRAPILVPASLVEQMRTGSVIVDVAV Fragment has 60 clashes (null) has 60 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 55 residues other bump:2.47383 Ang A23.C and I53.CD1 other bump:1.70319 Ang T24.N and I53.CD1 other bump:2.48239 Ang A23.N and I53.CD1 other bump:2.62884 Ang A23.CA and I53.CD1 other bump:2.78794 Ang T24.CA and I53.CD1 other bump:2.18911 Ang N22.ND2 and I53.CD1 other bump:2.82658 Ang T24.N and I53.CG1 other bump:3.16951 Ang N22.ND2 and I53.CG1 other bump:2.22384 Ang N22.CB and D51.OD2 other bump:2.12652 Ang N22.CG and D51.OD2 other bump:1.83036 Ang N22.OD1 and D51.OD1 other bump:2.52796 Ang N22.CB and D51.CG other bump:2.57643 Ang N22.CG and D51.CG other bump:2.19514 Ang N22.OD1 and D51.CG other bump:3.15042 Ang N22.CB and D51.CA other bump:3.02336 Ang I20.CG1 and V49.CG1 other bump:3.00794 Ang I20.CD1 and V49.CG1 other bump:0.885492 Ang V17.O and M47.CE other bump:2.06576 Ang V17.C and M47.CE other bump:2.08315 Ang V17.O and M47.SD other bump:2.68608 Ang V17.C and M47.SD other bump:2.74619 Ang D18.CA and M47.SD other bump:2.55118 Ang D18.O and M47.SD other bump:2.46645 Ang D18.C and M47.SD other bump:2.58219 Ang L14.O and L43.CD2 other bump:2.16854 Ang D15.OD1 and K42.O other bump:2.74141 Ang L14.CB and K39.NZ other bump:2.81738 Ang D33.OD1 and E35.C other bump:2.45887 Ang L14.CD1 and E35.OE2 neighbor-bump: 2.83758 Ang Y29.CD2 and P30.C neighbor-bump: 1.7655 Ang Y29.CD2 and P30.O neighbor-bump: 2.40903 Ang Y29.CE2 and P30.O other bump:2.79301 Ang I26.CA and Y29.OH other bump:1.40781 Ang I26.CB and Y29.OH other bump:1.87505 Ang I26.CG1 and Y29.OH other bump:2.11198 Ang I26.CG2 and Y29.OH other bump:1.85864 Ang I26.CD1 and Y29.OH other bump:2.96035 Ang I26.CA and Y29.CZ other bump:1.49795 Ang I26.CB and Y29.CZ other bump:1.76954 Ang I26.CG1 and Y29.CZ other bump:1.25798 Ang I26.CG2 and Y29.CZ other bump:1.81553 Ang I26.CD1 and Y29.CZ other bump:2.46327 Ang I26.CB and Y29.CE2 other bump:3.11928 Ang I26.CG1 and Y29.CE2 other bump:1.2137 Ang I26.CG2 and Y29.CE2 other bump:2.08915 Ang I26.CB and Y29.CE1 other bump:1.35619 Ang I26.CG1 and Y29.CE1 other bump:2.12197 Ang I26.CG2 and Y29.CE1 other bump:1.70083 Ang I26.CD1 and Y29.CE1 other bump:2.06228 Ang I26.CG2 and Y29.CD2 other bump:2.68452 Ang I26.CG1 and Y29.CD1 other bump:2.70559 Ang I26.CG2 and Y29.CD1 other bump:2.71812 Ang I26.CG2 and Y29.CG neighbor-bump: 1.80648 Ang T24.C and P25.CD neighbor-bump: 2.44044 Ang T24.CA and P25.CD neighbor-bump: 2.66854 Ang T24.C and P25.CG other bump:2.68906 Ang V17.CG1 and I20.CG2 other bump:2.87441 Ang V17.CG1 and I19.C other bump:2.61781 Ang V17.CG1 and I19.O other bump:2.83154 Ang F7.CD1 and D11.OD2 T0191 127 :NPLETV 1pjcA 300 :MPGAVP Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 8 residues other bump:2.22568 Ang N2.C and E5.OE1 other bump:1.09307 Ang N2.O and E5.OE1 other bump:3.1411 Ang N2.C and E5.CD other bump:2.11216 Ang N2.O and E5.CD T0191 134 :LKEAKKVNAKTINGLGMLIYQGAVAFK 1pjcA 306 :WTATQALNNSTLPYVVKLANQGLKALE Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:2.15954 Ang G17.O and Y21.CD1 other bump:2.61299 Ang N9.O and I13.CD1 Number of specific fragments= 7 total=1443 Number of alignments=278 # Reading fragments from alignment file # T0191 read from T0191-1pjcA-2track-protein-STR-local-adpstyle1.pw.a2m.gz # 1pjcA read from T0191-1pjcA-2track-protein-STR-local-adpstyle1.pw.a2m.gz # found chain 1pjcA in template set T0191 2 :GYNTDGIGARMALEEEIGR 1pjcA 137 :GRLSVQFGARFLERQQGGR Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 21 residues neighbor-bump: 2.62306 Ang E17.O and I18.CD1 neighbor-bump: 2.21345 Ang E17.O and I18.CG1 neighbor-bump: 2.63699 Ang E17.C and I18.CG1 neighbor-bump: 1.9745 Ang E17.O and I18.CB neighbor-bump: 2.43438 Ang E17.C and I18.CB T0191 21 :VKDKNIVIYGAGGAARAVAFELAK 1pjcA 165 :VKPGKVVILGGGVVGTEAAKMAVG Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 26 residues other bump:2.70113 Ang I7.CD1 and L23.CD2 other bump:2.51188 Ang I7.CG1 and L23.CD1 other bump:1.10707 Ang I7.CD1 and L23.CD1 other bump:1.96604 Ang I7.CD1 and L23.CG other bump:2.36271 Ang I7.CD1 and L23.CB other bump:1.86201 Ang G11.O and A16.CB other bump:2.86011 Ang G11.C and A16.CB T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLN 1pjcA 190 :GAQVQIFDINVERLSYLETLFGSRVE Fragment has 17 clashes (null) has 17 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:2.82109 Ang I22.CD1 and L26.CD2 other bump:2.87292 Ang I5.CD1 and L26.CD2 other bump:2.54449 Ang I5.CG1 and L26.CD1 other bump:2.47902 Ang I5.CD1 and L26.CD1 other bump:2.67771 Ang I5.CG1 and L26.CG other bump:2.50607 Ang I5.CD1 and L26.CG self-bump: 2.21466 Ang A23.CB and A23.C self-bump: 1.23794 Ang A23.CA and A23.CB other bump:1.89358 Ang V12.CG1 and E16.OE2 other bump:1.30061 Ang V12.O and E16.OE1 other bump:2.01321 Ang V12.C and E16.OE1 other bump:2.34526 Ang E13.CA and E16.OE1 other bump:2.11374 Ang V12.O and E16.CD other bump:2.88633 Ang V12.C and E16.CD other bump:2.89138 Ang V12.CG1 and E16.CD other bump:2.91217 Ang N3.CG and I5.CG2 other bump:1.91995 Ang N3.ND2 and I5.CG2 T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLREDMVVMDLIY 1pjcA 216 :LLYSNSAEIETAVAEADLLIGAVLVPGRRAPILVPASLVEQMRTGSVIVDVAV Fragment has 60 clashes (null) has 60 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 55 residues other bump:2.47383 Ang A23.C and I53.CD1 other bump:1.70319 Ang T24.N and I53.CD1 other bump:2.48239 Ang A23.N and I53.CD1 other bump:2.62884 Ang A23.CA and I53.CD1 other bump:2.78794 Ang T24.CA and I53.CD1 other bump:2.18911 Ang N22.ND2 and I53.CD1 other bump:2.82658 Ang T24.N and I53.CG1 other bump:3.16951 Ang N22.ND2 and I53.CG1 other bump:2.22384 Ang N22.CB and D51.OD2 other bump:2.12652 Ang N22.CG and D51.OD2 other bump:1.83036 Ang N22.OD1 and D51.OD1 other bump:2.52796 Ang N22.CB and D51.CG other bump:2.57643 Ang N22.CG and D51.CG other bump:2.19514 Ang N22.OD1 and D51.CG other bump:3.15042 Ang N22.CB and D51.CA other bump:3.02336 Ang I20.CG1 and V49.CG1 other bump:3.00794 Ang I20.CD1 and V49.CG1 other bump:0.885492 Ang V17.O and M47.CE other bump:2.06576 Ang V17.C and M47.CE other bump:2.08315 Ang V17.O and M47.SD other bump:2.68608 Ang V17.C and M47.SD other bump:2.74619 Ang D18.CA and M47.SD other bump:2.55118 Ang D18.O and M47.SD other bump:2.46645 Ang D18.C and M47.SD other bump:2.58219 Ang L14.O and L43.CD2 other bump:2.16854 Ang D15.OD1 and K42.O other bump:2.74141 Ang L14.CB and K39.NZ other bump:2.81738 Ang D33.OD1 and E35.C other bump:2.45887 Ang L14.CD1 and E35.OE2 neighbor-bump: 2.83758 Ang Y29.CD2 and P30.C neighbor-bump: 1.7655 Ang Y29.CD2 and P30.O neighbor-bump: 2.40903 Ang Y29.CE2 and P30.O other bump:2.79301 Ang I26.CA and Y29.OH other bump:1.40781 Ang I26.CB and Y29.OH other bump:1.87505 Ang I26.CG1 and Y29.OH other bump:2.11198 Ang I26.CG2 and Y29.OH other bump:1.85864 Ang I26.CD1 and Y29.OH other bump:2.96035 Ang I26.CA and Y29.CZ other bump:1.49795 Ang I26.CB and Y29.CZ other bump:1.76954 Ang I26.CG1 and Y29.CZ other bump:1.25798 Ang I26.CG2 and Y29.CZ other bump:1.81553 Ang I26.CD1 and Y29.CZ other bump:2.46327 Ang I26.CB and Y29.CE2 other bump:3.11928 Ang I26.CG1 and Y29.CE2 other bump:1.2137 Ang I26.CG2 and Y29.CE2 other bump:2.08915 Ang I26.CB and Y29.CE1 other bump:1.35619 Ang I26.CG1 and Y29.CE1 other bump:2.12197 Ang I26.CG2 and Y29.CE1 other bump:1.70083 Ang I26.CD1 and Y29.CE1 other bump:2.06228 Ang I26.CG2 and Y29.CD2 other bump:2.68452 Ang I26.CG1 and Y29.CD1 other bump:2.70559 Ang I26.CG2 and Y29.CD1 other bump:2.71812 Ang I26.CG2 and Y29.CG neighbor-bump: 1.80648 Ang T24.C and P25.CD neighbor-bump: 2.44044 Ang T24.CA and P25.CD neighbor-bump: 2.66854 Ang T24.C and P25.CG other bump:2.68906 Ang V17.CG1 and I20.CG2 other bump:2.87441 Ang V17.CG1 and I19.C other bump:2.61781 Ang V17.CG1 and I19.O other bump:2.83154 Ang F7.CD1 and D11.OD2 Number of specific fragments= 4 total=1447 Number of alignments=279 # Reading fragments from alignment file # T0191 read from T0191-1pjcA-2track-protein-STR-local-adpstyle5.pw.a2m.gz # 1pjcA read from T0191-1pjcA-2track-protein-STR-local-adpstyle5.pw.a2m.gz # found chain 1pjcA in template set T0191 6 :DGIGARMALEEEIGR 1pjcA 141 :VQFGARFLERQQGGR Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 17 residues neighbor-bump: 2.62306 Ang E13.O and I14.CD1 neighbor-bump: 2.21345 Ang E13.O and I14.CG1 neighbor-bump: 2.63699 Ang E13.C and I14.CG1 neighbor-bump: 1.9745 Ang E13.O and I14.CB neighbor-bump: 2.43438 Ang E13.C and I14.CB T0191 21 :VKDKNIVIYGAGGAARAVAFELAK 1pjcA 165 :VKPGKVVILGGGVVGTEAAKMAVG Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 26 residues other bump:2.70113 Ang I7.CD1 and L23.CD2 other bump:2.51188 Ang I7.CG1 and L23.CD1 other bump:1.10707 Ang I7.CD1 and L23.CD1 other bump:1.96604 Ang I7.CD1 and L23.CG other bump:2.36271 Ang I7.CD1 and L23.CB other bump:1.86201 Ang G11.O and A16.CB other bump:2.86011 Ang G11.C and A16.CB T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLN 1pjcA 190 :GAQVQIFDINVERLSYLETLFGSRVE Fragment has 17 clashes (null) has 17 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:2.82109 Ang I22.CD1 and L26.CD2 other bump:2.87292 Ang I5.CD1 and L26.CD2 other bump:2.54449 Ang I5.CG1 and L26.CD1 other bump:2.47902 Ang I5.CD1 and L26.CD1 other bump:2.67771 Ang I5.CG1 and L26.CG other bump:2.50607 Ang I5.CD1 and L26.CG self-bump: 2.21466 Ang A23.CB and A23.C self-bump: 1.23794 Ang A23.CA and A23.CB other bump:1.89358 Ang V12.CG1 and E16.OE2 other bump:1.30061 Ang V12.O and E16.OE1 other bump:2.01321 Ang V12.C and E16.OE1 other bump:2.34526 Ang E13.CA and E16.OE1 other bump:2.11374 Ang V12.O and E16.CD other bump:2.88633 Ang V12.C and E16.CD other bump:2.89138 Ang V12.CG1 and E16.CD other bump:2.91217 Ang N3.CG and I5.CG2 other bump:1.91995 Ang N3.ND2 and I5.CG2 T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLREDMVVMDLIY 1pjcA 216 :LLYSNSAEIETAVAEADLLIGAVLVPGRRAPILVPASLVEQMRTGSVIVDVAV Fragment has 60 clashes (null) has 60 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 55 residues other bump:2.47383 Ang A23.C and I53.CD1 other bump:1.70319 Ang T24.N and I53.CD1 other bump:2.48239 Ang A23.N and I53.CD1 other bump:2.62884 Ang A23.CA and I53.CD1 other bump:2.78794 Ang T24.CA and I53.CD1 other bump:2.18911 Ang N22.ND2 and I53.CD1 other bump:2.82658 Ang T24.N and I53.CG1 other bump:3.16951 Ang N22.ND2 and I53.CG1 other bump:2.22384 Ang N22.CB and D51.OD2 other bump:2.12652 Ang N22.CG and D51.OD2 other bump:1.83036 Ang N22.OD1 and D51.OD1 other bump:2.52796 Ang N22.CB and D51.CG other bump:2.57643 Ang N22.CG and D51.CG other bump:2.19514 Ang N22.OD1 and D51.CG other bump:3.15042 Ang N22.CB and D51.CA other bump:3.02336 Ang I20.CG1 and V49.CG1 other bump:3.00794 Ang I20.CD1 and V49.CG1 other bump:0.885492 Ang V17.O and M47.CE other bump:2.06576 Ang V17.C and M47.CE other bump:2.08315 Ang V17.O and M47.SD other bump:2.68608 Ang V17.C and M47.SD other bump:2.74619 Ang D18.CA and M47.SD other bump:2.55118 Ang D18.O and M47.SD other bump:2.46645 Ang D18.C and M47.SD other bump:2.58219 Ang L14.O and L43.CD2 other bump:2.16854 Ang D15.OD1 and K42.O other bump:2.74141 Ang L14.CB and K39.NZ other bump:2.81738 Ang D33.OD1 and E35.C other bump:2.45887 Ang L14.CD1 and E35.OE2 neighbor-bump: 2.83758 Ang Y29.CD2 and P30.C neighbor-bump: 1.7655 Ang Y29.CD2 and P30.O neighbor-bump: 2.40903 Ang Y29.CE2 and P30.O other bump:2.79301 Ang I26.CA and Y29.OH other bump:1.40781 Ang I26.CB and Y29.OH other bump:1.87505 Ang I26.CG1 and Y29.OH other bump:2.11198 Ang I26.CG2 and Y29.OH other bump:1.85864 Ang I26.CD1 and Y29.OH other bump:2.96035 Ang I26.CA and Y29.CZ other bump:1.49795 Ang I26.CB and Y29.CZ other bump:1.76954 Ang I26.CG1 and Y29.CZ other bump:1.25798 Ang I26.CG2 and Y29.CZ other bump:1.81553 Ang I26.CD1 and Y29.CZ other bump:2.46327 Ang I26.CB and Y29.CE2 other bump:3.11928 Ang I26.CG1 and Y29.CE2 other bump:1.2137 Ang I26.CG2 and Y29.CE2 other bump:2.08915 Ang I26.CB and Y29.CE1 other bump:1.35619 Ang I26.CG1 and Y29.CE1 other bump:2.12197 Ang I26.CG2 and Y29.CE1 other bump:1.70083 Ang I26.CD1 and Y29.CE1 other bump:2.06228 Ang I26.CG2 and Y29.CD2 other bump:2.68452 Ang I26.CG1 and Y29.CD1 other bump:2.70559 Ang I26.CG2 and Y29.CD1 other bump:2.71812 Ang I26.CG2 and Y29.CG neighbor-bump: 1.80648 Ang T24.C and P25.CD neighbor-bump: 2.44044 Ang T24.CA and P25.CD neighbor-bump: 2.66854 Ang T24.C and P25.CG other bump:2.68906 Ang V17.CG1 and I20.CG2 other bump:2.87441 Ang V17.CG1 and I19.C other bump:2.61781 Ang V17.CG1 and I19.O other bump:2.83154 Ang F7.CD1 and D11.OD2 Number of specific fragments= 4 total=1451 Number of alignments=280 # Reading fragments from alignment file # T0191 read from T0191-1pjcA-local-adpstyle1.pw.a2m.gz # 1pjcA read from T0191-1pjcA-local-adpstyle1.pw.a2m.gz # found chain 1pjcA in template set T0191 9 :GARMALEEEIGRVKDKNIVIYGAGGAARAVAFELAK 1pjcA 153 :GGRGVLLGGVPGVKPGKVVILGGGVVGTEAAKMAVG Fragment has 41 clashes (null) has 41 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 38 residues other bump:3.16433 Ang E9.CG and G38.CA other bump:3.15589 Ang E9.CD and G38.CA other bump:2.86877 Ang E9.OE2 and G38.CA other bump:2.70113 Ang I19.CD1 and L35.CD2 other bump:1.10707 Ang I19.CD1 and L35.CD1 other bump:2.51188 Ang I19.CG1 and L35.CD1 other bump:1.96604 Ang I19.CD1 and L35.CG other bump:2.36271 Ang I19.CD1 and L35.CB other bump:1.86201 Ang G23.O and A28.CB other bump:2.86011 Ang G23.C and A28.CB other bump:1.72107 Ang E8.CG and K17.NZ other bump:2.44458 Ang E8.CD and K17.NZ other bump:2.6744 Ang E8.CG and K17.CE other bump:3.26277 Ang L7.C and K17.CG other bump:2.98842 Ang E8.N and K17.CG other bump:2.47836 Ang E8.CA and K17.CG other bump:3.04216 Ang E8.CA and K17.CB other bump:2.32131 Ang E10.OE1 and D16.OD2 other bump:1.91964 Ang E9.O and D16.OD1 other bump:2.66234 Ang E9.C and D16.OD1 other bump:2.21081 Ang E10.OE2 and D16.OD1 other bump:2.14321 Ang E10.CB and D16.OD1 other bump:1.85471 Ang E10.CG and D16.OD1 other bump:1.73073 Ang E10.CD and D16.OD1 other bump:2.52479 Ang E10.OE2 and D16.CG other bump:1.69794 Ang E10.OE1 and D16.CG other bump:2.46152 Ang E10.CG and D16.CG other bump:1.80936 Ang E10.CD and D16.CG other bump:1.56543 Ang E10.OE1 and D16.CB other bump:2.58721 Ang E10.CG and D16.CB other bump:2.26708 Ang E10.CD and D16.CB other bump:2.00932 Ang E10.OE1 and D16.CA other bump:1.87339 Ang E10.CG and D16.CA other bump:2.23758 Ang E10.CD and D16.CA other bump:1.7677 Ang E10.OE1 and D16.N other bump:2.0714 Ang E10.CG and D16.N other bump:1.88704 Ang E10.CD and D16.N other bump:2.55344 Ang E10.CG and K15.C other bump:2.78114 Ang E10.CD and K15.C neighbor-bump: 2.16376 Ang E9.O and E10.CB neighbor-bump: 2.55243 Ang E9.C and E10.CB T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLN 1pjcA 190 :GAQVQIFDINVERLSYLETLFGSRVE Fragment has 17 clashes (null) has 17 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:2.82109 Ang I22.CD1 and L26.CD2 other bump:2.87292 Ang I5.CD1 and L26.CD2 other bump:2.54449 Ang I5.CG1 and L26.CD1 other bump:2.47902 Ang I5.CD1 and L26.CD1 other bump:2.67771 Ang I5.CG1 and L26.CG other bump:2.50607 Ang I5.CD1 and L26.CG self-bump: 2.21466 Ang A23.CB and A23.C self-bump: 1.23794 Ang A23.CA and A23.CB other bump:1.89358 Ang V12.CG1 and E16.OE2 other bump:1.30061 Ang V12.O and E16.OE1 other bump:2.01321 Ang V12.C and E16.OE1 other bump:2.34526 Ang E13.CA and E16.OE1 other bump:2.11374 Ang V12.O and E16.CD other bump:2.88633 Ang V12.C and E16.CD other bump:2.89138 Ang V12.CG1 and E16.CD other bump:2.91217 Ang N3.CG and I5.CG2 other bump:1.91995 Ang N3.ND2 and I5.CG2 T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLREDMVVMDLIY 1pjcA 216 :LLYSNSAEIETAVAEADLLIGAVLVPGRRAPILVPASLVEQMRTGSVIVDVAV Fragment has 60 clashes (null) has 60 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 55 residues other bump:2.47383 Ang A23.C and I53.CD1 other bump:1.70319 Ang T24.N and I53.CD1 other bump:2.48239 Ang A23.N and I53.CD1 other bump:2.62884 Ang A23.CA and I53.CD1 other bump:2.78794 Ang T24.CA and I53.CD1 other bump:2.18911 Ang N22.ND2 and I53.CD1 other bump:2.82658 Ang T24.N and I53.CG1 other bump:3.16951 Ang N22.ND2 and I53.CG1 other bump:2.22384 Ang N22.CB and D51.OD2 other bump:2.12652 Ang N22.CG and D51.OD2 other bump:1.83036 Ang N22.OD1 and D51.OD1 other bump:2.52796 Ang N22.CB and D51.CG other bump:2.57643 Ang N22.CG and D51.CG other bump:2.19514 Ang N22.OD1 and D51.CG other bump:3.15042 Ang N22.CB and D51.CA other bump:3.02336 Ang I20.CG1 and V49.CG1 other bump:3.00794 Ang I20.CD1 and V49.CG1 other bump:0.885492 Ang V17.O and M47.CE other bump:2.06576 Ang V17.C and M47.CE other bump:2.08315 Ang V17.O and M47.SD other bump:2.68608 Ang V17.C and M47.SD other bump:2.74619 Ang D18.CA and M47.SD other bump:2.55118 Ang D18.O and M47.SD other bump:2.46645 Ang D18.C and M47.SD other bump:2.58219 Ang L14.O and L43.CD2 other bump:2.16854 Ang D15.OD1 and K42.O other bump:2.74141 Ang L14.CB and K39.NZ other bump:2.81738 Ang D33.OD1 and E35.C other bump:2.45887 Ang L14.CD1 and E35.OE2 neighbor-bump: 2.83758 Ang Y29.CD2 and P30.C neighbor-bump: 1.7655 Ang Y29.CD2 and P30.O neighbor-bump: 2.40903 Ang Y29.CE2 and P30.O other bump:2.79301 Ang I26.CA and Y29.OH other bump:1.40781 Ang I26.CB and Y29.OH other bump:1.87505 Ang I26.CG1 and Y29.OH other bump:2.11198 Ang I26.CG2 and Y29.OH other bump:1.85864 Ang I26.CD1 and Y29.OH other bump:2.96035 Ang I26.CA and Y29.CZ other bump:1.49795 Ang I26.CB and Y29.CZ other bump:1.76954 Ang I26.CG1 and Y29.CZ other bump:1.25798 Ang I26.CG2 and Y29.CZ other bump:1.81553 Ang I26.CD1 and Y29.CZ other bump:2.46327 Ang I26.CB and Y29.CE2 other bump:3.11928 Ang I26.CG1 and Y29.CE2 other bump:1.2137 Ang I26.CG2 and Y29.CE2 other bump:2.08915 Ang I26.CB and Y29.CE1 other bump:1.35619 Ang I26.CG1 and Y29.CE1 other bump:2.12197 Ang I26.CG2 and Y29.CE1 other bump:1.70083 Ang I26.CD1 and Y29.CE1 other bump:2.06228 Ang I26.CG2 and Y29.CD2 other bump:2.68452 Ang I26.CG1 and Y29.CD1 other bump:2.70559 Ang I26.CG2 and Y29.CD1 other bump:2.71812 Ang I26.CG2 and Y29.CG neighbor-bump: 1.80648 Ang T24.C and P25.CD neighbor-bump: 2.44044 Ang T24.CA and P25.CD neighbor-bump: 2.66854 Ang T24.C and P25.CG other bump:2.68906 Ang V17.CG1 and I20.CG2 other bump:2.87441 Ang V17.CG1 and I19.C other bump:2.61781 Ang V17.CG1 and I19.O other bump:2.83154 Ang F7.CD1 and D11.OD2 Number of specific fragments= 3 total=1454 Number of alignments=281 # Reading fragments from alignment file # T0191 read from T0191-1pjcA-local-adpstyle5.pw.a2m.gz # 1pjcA read from T0191-1pjcA-local-adpstyle5.pw.a2m.gz # found chain 1pjcA in template set T0191 8 :IGARMALEEEIGRVKDKNIVIYGAGGAARAVAFELAK 1pjcA 152 :QGGRGVLLGGVPGVKPGKVVILGGGVVGTEAAKMAVG Fragment has 41 clashes (null) has 41 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 39 residues other bump:3.16433 Ang E10.CG and G39.CA other bump:3.15589 Ang E10.CD and G39.CA other bump:2.86877 Ang E10.OE2 and G39.CA other bump:2.70113 Ang I20.CD1 and L36.CD2 other bump:1.10707 Ang I20.CD1 and L36.CD1 other bump:2.51188 Ang I20.CG1 and L36.CD1 other bump:1.96604 Ang I20.CD1 and L36.CG other bump:2.36271 Ang I20.CD1 and L36.CB other bump:1.86201 Ang G24.O and A29.CB other bump:2.86011 Ang G24.C and A29.CB other bump:1.72107 Ang E9.CG and K18.NZ other bump:2.44458 Ang E9.CD and K18.NZ other bump:2.6744 Ang E9.CG and K18.CE other bump:3.26277 Ang L8.C and K18.CG other bump:2.98842 Ang E9.N and K18.CG other bump:2.47836 Ang E9.CA and K18.CG other bump:3.04216 Ang E9.CA and K18.CB other bump:2.32131 Ang E11.OE1 and D17.OD2 other bump:1.91964 Ang E10.O and D17.OD1 other bump:2.66234 Ang E10.C and D17.OD1 other bump:2.21081 Ang E11.OE2 and D17.OD1 other bump:1.73073 Ang E11.CD and D17.OD1 other bump:2.14321 Ang E11.CB and D17.OD1 other bump:1.85471 Ang E11.CG and D17.OD1 other bump:2.52479 Ang E11.OE2 and D17.CG other bump:1.80936 Ang E11.CD and D17.CG other bump:1.69794 Ang E11.OE1 and D17.CG other bump:2.46152 Ang E11.CG and D17.CG other bump:2.26708 Ang E11.CD and D17.CB other bump:1.56543 Ang E11.OE1 and D17.CB other bump:2.58721 Ang E11.CG and D17.CB other bump:2.23758 Ang E11.CD and D17.CA other bump:2.00932 Ang E11.OE1 and D17.CA other bump:1.87339 Ang E11.CG and D17.CA other bump:1.88704 Ang E11.CD and D17.N other bump:1.7677 Ang E11.OE1 and D17.N other bump:2.0714 Ang E11.CG and D17.N other bump:2.78114 Ang E11.CD and K16.C other bump:2.55344 Ang E11.CG and K16.C neighbor-bump: 2.16376 Ang E10.O and E11.CB neighbor-bump: 2.55243 Ang E10.C and E11.CB T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLN 1pjcA 190 :GAQVQIFDINVERLSYLETLFGSRVE Fragment has 17 clashes (null) has 17 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:2.82109 Ang I22.CD1 and L26.CD2 other bump:2.87292 Ang I5.CD1 and L26.CD2 other bump:2.54449 Ang I5.CG1 and L26.CD1 other bump:2.47902 Ang I5.CD1 and L26.CD1 other bump:2.67771 Ang I5.CG1 and L26.CG other bump:2.50607 Ang I5.CD1 and L26.CG self-bump: 2.21466 Ang A23.CB and A23.C self-bump: 1.23794 Ang A23.CA and A23.CB other bump:1.89358 Ang V12.CG1 and E16.OE2 other bump:1.30061 Ang V12.O and E16.OE1 other bump:2.01321 Ang V12.C and E16.OE1 other bump:2.34526 Ang E13.CA and E16.OE1 other bump:2.11374 Ang V12.O and E16.CD other bump:2.88633 Ang V12.C and E16.CD other bump:2.89138 Ang V12.CG1 and E16.CD other bump:2.91217 Ang N3.CG and I5.CG2 other bump:1.91995 Ang N3.ND2 and I5.CG2 T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLREDMVVMDLIY 1pjcA 216 :LLYSNSAEIETAVAEADLLIGAVLVPGRRAPILVPASLVEQMRTGSVIVDVAV Fragment has 60 clashes (null) has 60 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 55 residues other bump:2.47383 Ang A23.C and I53.CD1 other bump:1.70319 Ang T24.N and I53.CD1 other bump:2.48239 Ang A23.N and I53.CD1 other bump:2.62884 Ang A23.CA and I53.CD1 other bump:2.78794 Ang T24.CA and I53.CD1 other bump:2.18911 Ang N22.ND2 and I53.CD1 other bump:2.82658 Ang T24.N and I53.CG1 other bump:3.16951 Ang N22.ND2 and I53.CG1 other bump:2.22384 Ang N22.CB and D51.OD2 other bump:2.12652 Ang N22.CG and D51.OD2 other bump:1.83036 Ang N22.OD1 and D51.OD1 other bump:2.52796 Ang N22.CB and D51.CG other bump:2.57643 Ang N22.CG and D51.CG other bump:2.19514 Ang N22.OD1 and D51.CG other bump:3.15042 Ang N22.CB and D51.CA other bump:3.02336 Ang I20.CG1 and V49.CG1 other bump:3.00794 Ang I20.CD1 and V49.CG1 other bump:0.885492 Ang V17.O and M47.CE other bump:2.06576 Ang V17.C and M47.CE other bump:2.08315 Ang V17.O and M47.SD other bump:2.68608 Ang V17.C and M47.SD other bump:2.74619 Ang D18.CA and M47.SD other bump:2.55118 Ang D18.O and M47.SD other bump:2.46645 Ang D18.C and M47.SD other bump:2.58219 Ang L14.O and L43.CD2 other bump:2.16854 Ang D15.OD1 and K42.O other bump:2.74141 Ang L14.CB and K39.NZ other bump:2.81738 Ang D33.OD1 and E35.C other bump:2.45887 Ang L14.CD1 and E35.OE2 neighbor-bump: 2.83758 Ang Y29.CD2 and P30.C neighbor-bump: 1.7655 Ang Y29.CD2 and P30.O neighbor-bump: 2.40903 Ang Y29.CE2 and P30.O other bump:2.79301 Ang I26.CA and Y29.OH other bump:1.40781 Ang I26.CB and Y29.OH other bump:1.87505 Ang I26.CG1 and Y29.OH other bump:2.11198 Ang I26.CG2 and Y29.OH other bump:1.85864 Ang I26.CD1 and Y29.OH other bump:2.96035 Ang I26.CA and Y29.CZ other bump:1.49795 Ang I26.CB and Y29.CZ other bump:1.76954 Ang I26.CG1 and Y29.CZ other bump:1.25798 Ang I26.CG2 and Y29.CZ other bump:1.81553 Ang I26.CD1 and Y29.CZ other bump:2.46327 Ang I26.CB and Y29.CE2 other bump:3.11928 Ang I26.CG1 and Y29.CE2 other bump:1.2137 Ang I26.CG2 and Y29.CE2 other bump:2.08915 Ang I26.CB and Y29.CE1 other bump:1.35619 Ang I26.CG1 and Y29.CE1 other bump:2.12197 Ang I26.CG2 and Y29.CE1 other bump:1.70083 Ang I26.CD1 and Y29.CE1 other bump:2.06228 Ang I26.CG2 and Y29.CD2 other bump:2.68452 Ang I26.CG1 and Y29.CD1 other bump:2.70559 Ang I26.CG2 and Y29.CD1 other bump:2.71812 Ang I26.CG2 and Y29.CG neighbor-bump: 1.80648 Ang T24.C and P25.CD neighbor-bump: 2.44044 Ang T24.CA and P25.CD neighbor-bump: 2.66854 Ang T24.C and P25.CG other bump:2.68906 Ang V17.CG1 and I20.CG2 other bump:2.87441 Ang V17.CG1 and I19.C other bump:2.61781 Ang V17.CG1 and I19.O other bump:2.83154 Ang F7.CD1 and D11.OD2 Number of specific fragments= 3 total=1457 Number of alignments=282 # Reading fragments from alignment file # T0191 read from T0191-1pjcA-simpleSW-adpstyle1.pw.a2m.gz # 1pjcA read from T0191-1pjcA-simpleSW-adpstyle1.pw.a2m.gz # found chain 1pjcA in template set T0191 9 :GARMALEEEIGRVKDKNIVIYGAG 1pjcA 153 :GGRGVLLGGVPGVKPGKVVILGGG Fragment has 31 clashes (null) has 31 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 26 residues other bump:1.72107 Ang E8.CG and K17.NZ other bump:2.44458 Ang E8.CD and K17.NZ other bump:2.6744 Ang E8.CG and K17.CE other bump:2.47836 Ang E8.CA and K17.CG other bump:3.26277 Ang L7.C and K17.CG other bump:2.98842 Ang E8.N and K17.CG other bump:3.04216 Ang E8.CA and K17.CB other bump:2.32131 Ang E10.OE1 and D16.OD2 other bump:2.21081 Ang E10.OE2 and D16.OD1 other bump:2.14321 Ang E10.CB and D16.OD1 other bump:1.91964 Ang E9.O and D16.OD1 other bump:2.66234 Ang E9.C and D16.OD1 other bump:1.85471 Ang E10.CG and D16.OD1 other bump:1.73073 Ang E10.CD and D16.OD1 other bump:2.52479 Ang E10.OE2 and D16.CG other bump:1.69794 Ang E10.OE1 and D16.CG other bump:2.46152 Ang E10.CG and D16.CG other bump:1.80936 Ang E10.CD and D16.CG other bump:1.56543 Ang E10.OE1 and D16.CB other bump:2.58721 Ang E10.CG and D16.CB other bump:2.26708 Ang E10.CD and D16.CB other bump:2.00932 Ang E10.OE1 and D16.CA other bump:1.87339 Ang E10.CG and D16.CA other bump:2.23758 Ang E10.CD and D16.CA other bump:1.7677 Ang E10.OE1 and D16.N other bump:2.0714 Ang E10.CG and D16.N other bump:1.88704 Ang E10.CD and D16.N other bump:2.55344 Ang E10.CG and K15.C other bump:2.78114 Ang E10.CD and K15.C neighbor-bump: 2.16376 Ang E9.O and E10.CB neighbor-bump: 2.55243 Ang E9.C and E10.CB Number of specific fragments= 1 total=1458 Number of alignments=283 # Reading fragments from alignment file # T0191 read from T0191-1pjcA-simpleSW-adpstyle5.pw.a2m.gz # 1pjcA read from T0191-1pjcA-simpleSW-adpstyle5.pw.a2m.gz # found chain 1pjcA in template set T0191 8 :IGARMALEEEIGRVKDKNIVIYGAGGAA 1pjcA 152 :QGGRGVLLGGVPGVKPGKVVILGGGVVG Fragment has 33 clashes (null) has 33 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 30 residues other bump:1.86201 Ang G24.O and A29.CB other bump:2.86011 Ang G24.C and A29.CB other bump:1.72107 Ang E9.CG and K18.NZ other bump:2.44458 Ang E9.CD and K18.NZ other bump:2.6744 Ang E9.CG and K18.CE other bump:2.47836 Ang E9.CA and K18.CG other bump:3.26277 Ang L8.C and K18.CG other bump:2.98842 Ang E9.N and K18.CG other bump:3.04216 Ang E9.CA and K18.CB other bump:2.32131 Ang E11.OE1 and D17.OD2 other bump:2.21081 Ang E11.OE2 and D17.OD1 other bump:2.14321 Ang E11.CB and D17.OD1 other bump:1.91964 Ang E10.O and D17.OD1 other bump:2.66234 Ang E10.C and D17.OD1 other bump:1.73073 Ang E11.CD and D17.OD1 other bump:1.85471 Ang E11.CG and D17.OD1 other bump:2.52479 Ang E11.OE2 and D17.CG other bump:1.80936 Ang E11.CD and D17.CG other bump:1.69794 Ang E11.OE1 and D17.CG other bump:2.46152 Ang E11.CG and D17.CG other bump:2.26708 Ang E11.CD and D17.CB other bump:1.56543 Ang E11.OE1 and D17.CB other bump:2.58721 Ang E11.CG and D17.CB other bump:2.23758 Ang E11.CD and D17.CA other bump:2.00932 Ang E11.OE1 and D17.CA other bump:1.87339 Ang E11.CG and D17.CA other bump:1.88704 Ang E11.CD and D17.N other bump:1.7677 Ang E11.OE1 and D17.N other bump:2.0714 Ang E11.CG and D17.N other bump:2.78114 Ang E11.CD and K16.C other bump:2.55344 Ang E11.CG and K16.C neighbor-bump: 2.16376 Ang E10.O and E11.CB neighbor-bump: 2.55243 Ang E10.C and E11.CB T0191 36 :RAVAFELAKDNNIIIANRTVEKAEAL 1pjcA 181 :EAAKMAVGLGAQVQIFDINVERLSYL Fragment has 17 clashes (null) has 17 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:1.89358 Ang V21.CG1 and E25.OE2 other bump:1.30061 Ang V21.O and E25.OE1 other bump:2.01321 Ang V21.C and E25.OE1 other bump:2.34526 Ang E22.CA and E25.OE1 other bump:2.11374 Ang V21.O and E25.CD other bump:2.88633 Ang V21.C and E25.CD other bump:2.89138 Ang V21.CG1 and E25.CD other bump:2.74896 Ang V4.CG2 and I16.CD1 other bump:3.15899 Ang V4.CG2 and I16.CG1 other bump:2.91217 Ang N12.CG and I14.CG2 other bump:1.91995 Ang N12.ND2 and I14.CG2 other bump:1.34401 Ang E7.O and N12.OD1 other bump:1.95217 Ang E7.C and N12.OD1 other bump:2.65779 Ang E7.CA and N12.OD1 other bump:2.59239 Ang E7.CB and N12.ND2 other bump:3.03114 Ang E7.C and N12.CG other bump:3.02953 Ang E7.CB and N12.CG Number of specific fragments= 2 total=1460 Number of alignments=284 # Reading fragments from alignment file # T0191 read from T0191-1pjcA-vit-adpstyle1.pw.a2m.gz # 1pjcA read from T0191-1pjcA-vit-adpstyle1.pw.a2m.gz # found chain 1pjcA in template set T0191 9 :GARMALEEEIGRVKDKNIVIYGAGGAARAVAFELAK 1pjcA 153 :GGRGVLLGGVPGVKPGKVVILGGGVVGTEAAKMAVG Fragment has 41 clashes (null) has 41 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 38 residues other bump:3.16433 Ang E9.CG and G38.CA other bump:3.15589 Ang E9.CD and G38.CA other bump:2.86877 Ang E9.OE2 and G38.CA other bump:2.70113 Ang I19.CD1 and L35.CD2 other bump:1.10707 Ang I19.CD1 and L35.CD1 other bump:2.51188 Ang I19.CG1 and L35.CD1 other bump:1.96604 Ang I19.CD1 and L35.CG other bump:2.36271 Ang I19.CD1 and L35.CB other bump:1.86201 Ang G23.O and A28.CB other bump:2.86011 Ang G23.C and A28.CB other bump:1.72107 Ang E8.CG and K17.NZ other bump:2.44458 Ang E8.CD and K17.NZ other bump:2.6744 Ang E8.CG and K17.CE other bump:3.26277 Ang L7.C and K17.CG other bump:2.98842 Ang E8.N and K17.CG other bump:2.47836 Ang E8.CA and K17.CG other bump:3.04216 Ang E8.CA and K17.CB other bump:2.32131 Ang E10.OE1 and D16.OD2 other bump:1.91964 Ang E9.O and D16.OD1 other bump:2.66234 Ang E9.C and D16.OD1 other bump:2.21081 Ang E10.OE2 and D16.OD1 other bump:2.14321 Ang E10.CB and D16.OD1 other bump:1.85471 Ang E10.CG and D16.OD1 other bump:1.73073 Ang E10.CD and D16.OD1 other bump:2.52479 Ang E10.OE2 and D16.CG other bump:1.69794 Ang E10.OE1 and D16.CG other bump:2.46152 Ang E10.CG and D16.CG other bump:1.80936 Ang E10.CD and D16.CG other bump:1.56543 Ang E10.OE1 and D16.CB other bump:2.58721 Ang E10.CG and D16.CB other bump:2.26708 Ang E10.CD and D16.CB other bump:2.00932 Ang E10.OE1 and D16.CA other bump:1.87339 Ang E10.CG and D16.CA other bump:2.23758 Ang E10.CD and D16.CA other bump:1.7677 Ang E10.OE1 and D16.N other bump:2.0714 Ang E10.CG and D16.N other bump:1.88704 Ang E10.CD and D16.N other bump:2.55344 Ang E10.CG and K15.C other bump:2.78114 Ang E10.CD and K15.C neighbor-bump: 2.16376 Ang E9.O and E10.CB neighbor-bump: 2.55243 Ang E9.C and E10.CB T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLN 1pjcA 190 :GAQVQIFDINVERLSYLETLFGSRVE Fragment has 17 clashes (null) has 17 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:2.82109 Ang I22.CD1 and L26.CD2 other bump:2.87292 Ang I5.CD1 and L26.CD2 other bump:2.54449 Ang I5.CG1 and L26.CD1 other bump:2.47902 Ang I5.CD1 and L26.CD1 other bump:2.67771 Ang I5.CG1 and L26.CG other bump:2.50607 Ang I5.CD1 and L26.CG self-bump: 2.21466 Ang A23.CB and A23.C self-bump: 1.23794 Ang A23.CA and A23.CB other bump:1.89358 Ang V12.CG1 and E16.OE2 other bump:1.30061 Ang V12.O and E16.OE1 other bump:2.01321 Ang V12.C and E16.OE1 other bump:2.34526 Ang E13.CA and E16.OE1 other bump:2.11374 Ang V12.O and E16.CD other bump:2.88633 Ang V12.C and E16.CD other bump:2.89138 Ang V12.CG1 and E16.CD other bump:2.91217 Ang N3.CG and I5.CG2 other bump:1.91995 Ang N3.ND2 and I5.CG2 T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLREDMVVMDLIY 1pjcA 216 :LLYSNSAEIETAVAEADLLIGAVLVPGRRAPILVPASLVEQMRTGSVIVDVAV Fragment has 60 clashes (null) has 60 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 55 residues other bump:2.47383 Ang A23.C and I53.CD1 other bump:1.70319 Ang T24.N and I53.CD1 other bump:2.48239 Ang A23.N and I53.CD1 other bump:2.62884 Ang A23.CA and I53.CD1 other bump:2.78794 Ang T24.CA and I53.CD1 other bump:2.18911 Ang N22.ND2 and I53.CD1 other bump:2.82658 Ang T24.N and I53.CG1 other bump:3.16951 Ang N22.ND2 and I53.CG1 other bump:2.22384 Ang N22.CB and D51.OD2 other bump:2.12652 Ang N22.CG and D51.OD2 other bump:1.83036 Ang N22.OD1 and D51.OD1 other bump:2.52796 Ang N22.CB and D51.CG other bump:2.57643 Ang N22.CG and D51.CG other bump:2.19514 Ang N22.OD1 and D51.CG other bump:3.15042 Ang N22.CB and D51.CA other bump:3.02336 Ang I20.CG1 and V49.CG1 other bump:3.00794 Ang I20.CD1 and V49.CG1 other bump:0.885492 Ang V17.O and M47.CE other bump:2.06576 Ang V17.C and M47.CE other bump:2.08315 Ang V17.O and M47.SD other bump:2.68608 Ang V17.C and M47.SD other bump:2.74619 Ang D18.CA and M47.SD other bump:2.55118 Ang D18.O and M47.SD other bump:2.46645 Ang D18.C and M47.SD other bump:2.58219 Ang L14.O and L43.CD2 other bump:2.16854 Ang D15.OD1 and K42.O other bump:2.74141 Ang L14.CB and K39.NZ other bump:2.81738 Ang D33.OD1 and E35.C other bump:2.45887 Ang L14.CD1 and E35.OE2 neighbor-bump: 2.83758 Ang Y29.CD2 and P30.C neighbor-bump: 1.7655 Ang Y29.CD2 and P30.O neighbor-bump: 2.40903 Ang Y29.CE2 and P30.O other bump:2.79301 Ang I26.CA and Y29.OH other bump:1.40781 Ang I26.CB and Y29.OH other bump:1.87505 Ang I26.CG1 and Y29.OH other bump:2.11198 Ang I26.CG2 and Y29.OH other bump:1.85864 Ang I26.CD1 and Y29.OH other bump:2.96035 Ang I26.CA and Y29.CZ other bump:1.49795 Ang I26.CB and Y29.CZ other bump:1.76954 Ang I26.CG1 and Y29.CZ other bump:1.25798 Ang I26.CG2 and Y29.CZ other bump:1.81553 Ang I26.CD1 and Y29.CZ other bump:2.46327 Ang I26.CB and Y29.CE2 other bump:3.11928 Ang I26.CG1 and Y29.CE2 other bump:1.2137 Ang I26.CG2 and Y29.CE2 other bump:2.08915 Ang I26.CB and Y29.CE1 other bump:1.35619 Ang I26.CG1 and Y29.CE1 other bump:2.12197 Ang I26.CG2 and Y29.CE1 other bump:1.70083 Ang I26.CD1 and Y29.CE1 other bump:2.06228 Ang I26.CG2 and Y29.CD2 other bump:2.68452 Ang I26.CG1 and Y29.CD1 other bump:2.70559 Ang I26.CG2 and Y29.CD1 other bump:2.71812 Ang I26.CG2 and Y29.CG neighbor-bump: 1.80648 Ang T24.C and P25.CD neighbor-bump: 2.44044 Ang T24.CA and P25.CD neighbor-bump: 2.66854 Ang T24.C and P25.CG other bump:2.68906 Ang V17.CG1 and I20.CG2 other bump:2.87441 Ang V17.CG1 and I19.C other bump:2.61781 Ang V17.CG1 and I19.O other bump:2.83154 Ang F7.CD1 and D11.OD2 Number of specific fragments= 3 total=1463 Number of alignments=285 # Reading fragments from alignment file # T0191 read from T0191-1pjcA-vit-adpstyle5.pw.a2m.gz # 1pjcA read from T0191-1pjcA-vit-adpstyle5.pw.a2m.gz # found chain 1pjcA in template set T0191 8 :IGARMALEEEIGRVKDKNIVIYGAGGAARAVAFELAK 1pjcA 152 :QGGRGVLLGGVPGVKPGKVVILGGGVVGTEAAKMAVG Fragment has 41 clashes (null) has 41 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 39 residues other bump:3.16433 Ang E10.CG and G39.CA other bump:3.15589 Ang E10.CD and G39.CA other bump:2.86877 Ang E10.OE2 and G39.CA other bump:2.70113 Ang I20.CD1 and L36.CD2 other bump:1.10707 Ang I20.CD1 and L36.CD1 other bump:2.51188 Ang I20.CG1 and L36.CD1 other bump:1.96604 Ang I20.CD1 and L36.CG other bump:2.36271 Ang I20.CD1 and L36.CB other bump:1.86201 Ang G24.O and A29.CB other bump:2.86011 Ang G24.C and A29.CB other bump:1.72107 Ang E9.CG and K18.NZ other bump:2.44458 Ang E9.CD and K18.NZ other bump:2.6744 Ang E9.CG and K18.CE other bump:3.26277 Ang L8.C and K18.CG other bump:2.98842 Ang E9.N and K18.CG other bump:2.47836 Ang E9.CA and K18.CG other bump:3.04216 Ang E9.CA and K18.CB other bump:2.32131 Ang E11.OE1 and D17.OD2 other bump:1.91964 Ang E10.O and D17.OD1 other bump:2.66234 Ang E10.C and D17.OD1 other bump:2.21081 Ang E11.OE2 and D17.OD1 other bump:1.73073 Ang E11.CD and D17.OD1 other bump:2.14321 Ang E11.CB and D17.OD1 other bump:1.85471 Ang E11.CG and D17.OD1 other bump:2.52479 Ang E11.OE2 and D17.CG other bump:1.80936 Ang E11.CD and D17.CG other bump:1.69794 Ang E11.OE1 and D17.CG other bump:2.46152 Ang E11.CG and D17.CG other bump:2.26708 Ang E11.CD and D17.CB other bump:1.56543 Ang E11.OE1 and D17.CB other bump:2.58721 Ang E11.CG and D17.CB other bump:2.23758 Ang E11.CD and D17.CA other bump:2.00932 Ang E11.OE1 and D17.CA other bump:1.87339 Ang E11.CG and D17.CA other bump:1.88704 Ang E11.CD and D17.N other bump:1.7677 Ang E11.OE1 and D17.N other bump:2.0714 Ang E11.CG and D17.N other bump:2.78114 Ang E11.CD and K16.C other bump:2.55344 Ang E11.CG and K16.C neighbor-bump: 2.16376 Ang E10.O and E11.CB neighbor-bump: 2.55243 Ang E10.C and E11.CB T0191 45 :DNNIIIANRTVEKAEALAKEIAEKLN 1pjcA 190 :GAQVQIFDINVERLSYLETLFGSRVE Fragment has 17 clashes (null) has 17 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:2.82109 Ang I22.CD1 and L26.CD2 other bump:2.87292 Ang I5.CD1 and L26.CD2 other bump:2.54449 Ang I5.CG1 and L26.CD1 other bump:2.47902 Ang I5.CD1 and L26.CD1 other bump:2.67771 Ang I5.CG1 and L26.CG other bump:2.50607 Ang I5.CD1 and L26.CG self-bump: 2.21466 Ang A23.CB and A23.C self-bump: 1.23794 Ang A23.CA and A23.CB other bump:1.89358 Ang V12.CG1 and E16.OE2 other bump:1.30061 Ang V12.O and E16.OE1 other bump:2.01321 Ang V12.C and E16.OE1 other bump:2.34526 Ang E13.CA and E16.OE1 other bump:2.11374 Ang V12.O and E16.CD other bump:2.88633 Ang V12.C and E16.CD other bump:2.89138 Ang V12.CG1 and E16.CD other bump:2.91217 Ang N3.CG and I5.CG2 other bump:1.91995 Ang N3.ND2 and I5.CG2 T0191 74 :GEEVKFSGLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLREDMVVMDLIY 1pjcA 216 :LLYSNSAEIETAVAEADLLIGAVLVPGRRAPILVPASLVEQMRTGSVIVDVAV Fragment has 60 clashes (null) has 60 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 55 residues other bump:2.47383 Ang A23.C and I53.CD1 other bump:1.70319 Ang T24.N and I53.CD1 other bump:2.48239 Ang A23.N and I53.CD1 other bump:2.62884 Ang A23.CA and I53.CD1 other bump:2.78794 Ang T24.CA and I53.CD1 other bump:2.18911 Ang N22.ND2 and I53.CD1 other bump:2.82658 Ang T24.N and I53.CG1 other bump:3.16951 Ang N22.ND2 and I53.CG1 other bump:2.22384 Ang N22.CB and D51.OD2 other bump:2.12652 Ang N22.CG and D51.OD2 other bump:1.83036 Ang N22.OD1 and D51.OD1 other bump:2.52796 Ang N22.CB and D51.CG other bump:2.57643 Ang N22.CG and D51.CG other bump:2.19514 Ang N22.OD1 and D51.CG other bump:3.15042 Ang N22.CB and D51.CA other bump:3.02336 Ang I20.CG1 and V49.CG1 other bump:3.00794 Ang I20.CD1 and V49.CG1 other bump:0.885492 Ang V17.O and M47.CE other bump:2.06576 Ang V17.C and M47.CE other bump:2.08315 Ang V17.O and M47.SD other bump:2.68608 Ang V17.C and M47.SD other bump:2.74619 Ang D18.CA and M47.SD other bump:2.55118 Ang D18.O and M47.SD other bump:2.46645 Ang D18.C and M47.SD other bump:2.58219 Ang L14.O and L43.CD2 other bump:2.16854 Ang D15.OD1 and K42.O other bump:2.74141 Ang L14.CB and K39.NZ other bump:2.81738 Ang D33.OD1 and E35.C other bump:2.45887 Ang L14.CD1 and E35.OE2 neighbor-bump: 2.83758 Ang Y29.CD2 and P30.C neighbor-bump: 1.7655 Ang Y29.CD2 and P30.O neighbor-bump: 2.40903 Ang Y29.CE2 and P30.O other bump:2.79301 Ang I26.CA and Y29.OH other bump:1.40781 Ang I26.CB and Y29.OH other bump:1.87505 Ang I26.CG1 and Y29.OH other bump:2.11198 Ang I26.CG2 and Y29.OH other bump:1.85864 Ang I26.CD1 and Y29.OH other bump:2.96035 Ang I26.CA and Y29.CZ other bump:1.49795 Ang I26.CB and Y29.CZ other bump:1.76954 Ang I26.CG1 and Y29.CZ other bump:1.25798 Ang I26.CG2 and Y29.CZ other bump:1.81553 Ang I26.CD1 and Y29.CZ other bump:2.46327 Ang I26.CB and Y29.CE2 other bump:3.11928 Ang I26.CG1 and Y29.CE2 other bump:1.2137 Ang I26.CG2 and Y29.CE2 other bump:2.08915 Ang I26.CB and Y29.CE1 other bump:1.35619 Ang I26.CG1 and Y29.CE1 other bump:2.12197 Ang I26.CG2 and Y29.CE1 other bump:1.70083 Ang I26.CD1 and Y29.CE1 other bump:2.06228 Ang I26.CG2 and Y29.CD2 other bump:2.68452 Ang I26.CG1 and Y29.CD1 other bump:2.70559 Ang I26.CG2 and Y29.CD1 other bump:2.71812 Ang I26.CG2 and Y29.CG neighbor-bump: 1.80648 Ang T24.C and P25.CD neighbor-bump: 2.44044 Ang T24.CA and P25.CD neighbor-bump: 2.66854 Ang T24.C and P25.CG other bump:2.68906 Ang V17.CG1 and I20.CG2 other bump:2.87441 Ang V17.CG1 and I19.C other bump:2.61781 Ang V17.CG1 and I19.O other bump:2.83154 Ang F7.CD1 and D11.OD2 Number of specific fragments= 3 total=1466 Number of alignments=286 # command:# Prefix for input files set to # command:# Prefix for input files set to decoys/ # command:# Reading conformation from PDB file T0191-start.pdb # command:# naming current conformation T0191.try1-start # command:# Prefix for input files set to # command:CPU_time= 107650 msec, elapsed time= 110107 msec) # command:# Will now start reporting costs to decoys/undertaker-try1.rdb # command: # TryAllAlign to optimize cost = # ( 0.2 * gen6.5(6.5) + 1 * wet6.5(6.5, /log(length)) + 3 * dry5(5) + 11 * dry6.5(6.5) + 4 * dry8(8) + 1 * dry12(12) + 0.5 * phobic_fit + 0.2 * sidechain + 1.5 * clashes + -0.2 * sidechain_clashes + 0.5 * backbone_clashes + 10 * break + 1 * pred_alpha2 + 0.1 * constraints + 1 * contact_order ) # Will try all 286 alignments, # shrinking each end by up to 0.4*length and merging fragments shorter than 5 # Each alignment is added to initial conformation # best score in alignment pool out of 287: T0191.try1-start 69.6655 cost/residue, 152 clashes 0.315372 breaks # command: # TryAllAlign to optimize cost = # ( 0.2 * gen6.5(6.5) + 1 * wet6.5(6.5, /log(length)) + 3 * dry5(5) + 11 * dry6.5(6.5) + 4 * dry8(8) + 1 * dry12(12) + 0.5 * phobic_fit + 0.2 * sidechain + 1.5 * clashes + -0.2 * sidechain_clashes + 0.5 * backbone_clashes + 10 * break + 1 * pred_alpha2 + 0.1 * constraints + 1 * contact_order ) # Will try all 286 alignments, # shrinking each end by up to 0.4*length and merging fragments shorter than 5 # Each alignment is added to result of previous insertion # best score in alignment pool out of 287: T0191.try1-start 69.6655 cost/residue, 152 clashes 0.315372 breaks # command:# naming current conformation T0191.try1-al2 # command:# command: # TryAllAlign to optimize cost = # ( 0.2 * gen6.5(6.5) + 1 * wet6.5(6.5, /log(length)) + 3 * dry5(5) + 11 * dry6.5(6.5) + 4 * dry8(8) + 1 * dry12(12) + 0.5 * phobic_fit + 0.2 * sidechain + 1.5 * clashes + -0.2 * sidechain_clashes + 0.5 * backbone_clashes + 10 * break + 1 * pred_alpha2 + 0.1 * constraints + 1 * contact_order ) # Will try all 286 alignments, # shrinking each end by up to 0*length and merging fragments shorter than 1 # Each alignment is added to initial conformation # best score in alignment pool out of 287: T0191.try1-al2 69.6655 cost/residue, 152 clashes 0.315372 breaks # command: # TryAllAlign to optimize cost = # ( 0.2 * gen6.5(6.5) + 1 * wet6.5(6.5, /log(length)) + 3 * dry5(5) + 11 * dry6.5(6.5) + 4 * dry8(8) + 1 * dry12(12) + 0.5 * phobic_fit + 0.2 * sidechain + 1.5 * clashes + -0.2 * sidechain_clashes + 0.5 * backbone_clashes + 10 * break + 1 * pred_alpha2 + 0.1 * constraints + 1 * contact_order ) # Will try all 286 alignments, # shrinking each end by up to 0*length and merging fragments shorter than 1 # Each alignment is added to result of previous insertion # best score in alignment pool out of 287: T0191.try1-al2 69.6655 cost/residue, 152 clashes 0.315372 breaks # command:# naming current conformation T0191.try1-al4 # command:# command: # TryAllAlign to optimize cost = # ( 0.2 * gen6.5(6.5) + 1 * wet6.5(6.5, /log(length)) + 3 * dry5(5) + 11 * dry6.5(6.5) + 4 * dry8(8) + 1 * dry12(12) + 0.5 * phobic_fit + 0.2 * sidechain + 1.5 * clashes + -0.2 * sidechain_clashes + 0.5 * backbone_clashes + 10 * break + 1 * pred_alpha2 + 0.1 * constraints + 1 * contact_order ) # Will try all 286 alignments, # shrinking each end by up to 0.3*length and merging fragments shorter than 4 # Each alignment is added to initial conformation # best score in alignment pool out of 287: T0191.try1-al4 69.6655 cost/residue, 152 clashes 0.315372 breaks # command: # TryAllAlign to optimize cost = # ( 0.2 * gen6.5(6.5) + 1 * wet6.5(6.5, /log(length)) + 3 * dry5(5) + 11 * dry6.5(6.5) + 4 * dry8(8) + 1 * dry12(12) + 0.5 * phobic_fit + 0.2 * sidechain + 1.5 * clashes + -0.2 * sidechain_clashes + 0.5 * backbone_clashes + 10 * break + 1 * pred_alpha2 + 0.1 * constraints + 1 * contact_order ) # Will try all 286 alignments, # shrinking each end by up to 0.3*length and merging fragments shorter than 4 # Each alignment is added to result of previous insertion # best score in alignment pool out of 287: T0191.try1-al4 69.6655 cost/residue, 152 clashes 0.315372 breaks # command:# naming current conformation T0191.try1-al6 # command:# command: # TryAllAlign to optimize cost = # ( 0.2 * gen6.5(6.5) + 1 * wet6.5(6.5, /log(length)) + 3 * dry5(5) + 11 * dry6.5(6.5) + 4 * dry8(8) + 1 * dry12(12) + 0.5 * phobic_fit + 0.2 * sidechain + 1.5 * clashes + -0.2 * sidechain_clashes + 0.5 * backbone_clashes + 10 * break + 1 * pred_alpha2 + 0.1 * constraints + 1 * contact_order ) # Will try all 286 alignments, # shrinking each end by up to 0.1*length and merging fragments shorter than 2 # Each alignment is added to initial conformation # best score in alignment pool out of 287: T0191.try1-al6 69.6655 cost/residue, 152 clashes 0.315372 breaks # command: # TryAllAlign to optimize cost = # ( 0.2 * gen6.5(6.5) + 1 * wet6.5(6.5, /log(length)) + 3 * dry5(5) + 11 * dry6.5(6.5) + 4 * dry8(8) + 1 * dry12(12) + 0.5 * phobic_fit + 0.2 * sidechain + 1.5 * clashes + -0.2 * sidechain_clashes + 0.5 * backbone_clashes + 10 * break + 1 * pred_alpha2 + 0.1 * constraints + 1 * contact_order ) # Will try all 286 alignments, # shrinking each end by up to 0.1*length and merging fragments shorter than 2 # Each alignment is added to result of previous insertion # best score in alignment pool out of 287: T0191.try1-al6 69.6655 cost/residue, 152 clashes 0.315372 breaks # command:# naming current conformation T0191.try1-al8 # command:# command: # TryAllAlign to optimize cost = # ( 0.2 * gen6.5(6.5) + 1 * wet6.5(6.5, /log(length)) + 3 * dry5(5) + 11 * dry6.5(6.5) + 4 * dry8(8) + 1 * dry12(12) + 0.5 * phobic_fit + 0.2 * sidechain + 1.5 * clashes + -0.2 * sidechain_clashes + 0.5 * backbone_clashes + 10 * break + 1 * pred_alpha2 + 0.1 * constraints + 1 * contact_order ) # Will try all 286 alignments, # shrinking each end by up to 0.2*length and merging fragments shorter than 3 # Each alignment is added to initial conformation # best score in alignment pool out of 287: T0191.try1-al8 69.6655 cost/residue, 152 clashes 0.315372 breaks # command: # TryAllAlign to optimize cost = # ( 0.2 * gen6.5(6.5) + 1 * wet6.5(6.5, /log(length)) + 3 * dry5(5) + 11 * dry6.5(6.5) + 4 * dry8(8) + 1 * dry12(12) + 0.5 * phobic_fit + 0.2 * sidechain + 1.5 * clashes + -0.2 * sidechain_clashes + 0.5 * backbone_clashes + 10 * break + 1 * pred_alpha2 + 0.1 * constraints + 1 * contact_order ) # Will try all 286 alignments, # shrinking each end by up to 0.2*length and merging fragments shorter than 3 # Each alignment is added to result of previous insertion # best score in alignment pool out of 287: T0191.try1-al8 69.6655 cost/residue, 152 clashes 0.315372 breaks # command:# naming current conformation T0191.try1-al10 # command:# command: # TryAllAlign to optimize cost = # ( 0.2 * gen6.5(6.5) + 1 * wet6.5(6.5, /log(length)) + 3 * dry5(5) + 11 * dry6.5(6.5) + 4 * dry8(8) + 1 * dry12(12) + 0.5 * phobic_fit + 0.2 * sidechain + 1.5 * clashes + -0.2 * sidechain_clashes + 0.5 * backbone_clashes + 10 * break + 1 * pred_alpha2 + 0.1 * constraints + 1 * contact_order ) # Will try all 286 alignments, # shrinking each end by up to 0*length and merging fragments shorter than 1 # Each alignment is added to initial conformation # best score in alignment pool out of 287: T0191.try1-al10 69.6655 cost/residue, 152 clashes 0.315372 breaks # command: # TryAllAlign to optimize cost = # ( 0.2 * gen6.5(6.5) + 1 * wet6.5(6.5, /log(length)) + 3 * dry5(5) + 11 * dry6.5(6.5) + 4 * dry8(8) + 1 * dry12(12) + 0.5 * phobic_fit + 0.2 * sidechain + 1.5 * clashes + -0.2 * sidechain_clashes + 0.5 * backbone_clashes + 10 * break + 1 * pred_alpha2 + 0.1 * constraints + 1 * contact_order ) # Will try all 286 alignments, # shrinking each end by up to 0*length and merging fragments shorter than 1 # Each alignment is added to result of previous insertion # best score in alignment pool out of 287: T0191.try1-al10 69.6655 cost/residue, 152 clashes 0.315372 breaks # command:# naming current conformation T0191.try1-al12 # command:# command:# CostConform T0191.try1-al12 costs 69.6655 T0191.try1-al10 costs 69.6655 T0191.try1-al10 costs 69.6655 T0191.try1-al8 costs 69.6655 T0191.try1-al8 costs 69.6655 T0191.try1-al6 costs 69.6655 T0191.try1-al6 costs 69.6655 T0191.try1-al4 costs 69.6655 T0191.try1-al4 costs 69.6655 T0191.try1-al2 costs 69.6655 T0191.try1-al2 costs 69.6655 T0191.try1-start costs 69.6655 T0191.try1-start costs 69.6655 T0191.rand costs 114.365 # command:CPU_time= 473840 msec, elapsed time= 476392 msec) # command:# Prefix for input files set to # command:# Reading fragments from alignment file # T0191 read from T0191.t2k.frag # 1bia.1.1 read from T0191.t2k.frag # adding 1bia to template set 1bia:# found chain 1bia in template set T0191 1 :IGYNTDGIG 1bia 2 :KDNTVPLKL Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 10 residues other bump:2.9137 Ang I1.CD1 and Y3.OH other bump:3.11923 Ang I1.CB and Y3.CE1 Number of specific fragments= 1 total=1467 # 1bia.1.0 read from T0191.t2k.frag # found chain 1bia in template set T0191 1 :IGYNTDGIG 1bia 1 :MKDNTVPLK Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 10 residues other bump:2.7126 Ang Y3.CD2 and T5.OG1 other bump:1.99816 Ang Y3.CE2 and T5.OG1 other bump:2.00864 Ang Y3.CZ and T5.OG1 other bump:2.49511 Ang Y3.OH and T5.OG1 other bump:2.75766 Ang Y3.CE2 and T5.CB Number of specific fragments= 1 total=1468 # 1bib.1.1 read from T0191.t2k.frag # adding 1bib to template set 1bib:# found chain 1bib in template set T0191 1 :IGYNTDGIG 1bib 2 :KDNTVPLKL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 10 residues Number of specific fragments= 1 total=1469 # 1cfe.1.1 read from T0191.t2k.frag # adding 1cfe to template set 1cfe:# found chain 1cfe in template set T0191 1 :IGYNTDGIG 1cfe 2 :NSPQDYLAV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 10 residues Number of specific fragments= 1 total=1470 # 1bib.1.0 read from T0191.t2k.frag # found chain 1bib in template set T0191 3 :YNTDGIG 1bib 3 :DNTVPLK Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 9 residues other bump:2.9038 Ang Y2.CE2 and T4.OG1 other bump:2.45088 Ang Y2.CZ and T4.OG1 other bump:2.8693 Ang Y2.CE2 and T4.CB other bump:2.8423 Ang Y2.CZ and T4.CB other bump:2.88628 Ang Y2.OH and T4.CB Number of specific fragments= 1 total=1471 # 1cfe.1.0 read from T0191.t2k.frag # found chain 1cfe in template set T0191 1 :IGYNTDGIG 1cfe 1 :QNSPQDYLA Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 10 residues other bump:3.10665 Ang I1.N and D6.CG other bump:3.14985 Ang I1.CA and D6.CG neighbor-bump: 2.34624 Ang N4.ND2 and T5.N self-bump: 1.33039 Ang N4.CA and N4.CB Number of specific fragments= 1 total=1472 # 1bia.2.2 read from T0191.t2k.frag # found chain 1bia in template set T0191 2 :GYNTDGIGA 1bia 3 :DNTVPLKLI Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1473 # 1cfe.2.2 read from T0191.t2k.frag # found chain 1cfe in template set T0191 2 :GYNTDGIGA 1cfe 3 :SPQDYLAVH Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1474 # 1bia.2.1 read from T0191.t2k.frag # found chain 1bia in template set T0191 2 :GYNTDGIGA 1bia 2 :KDNTVPLKL Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.7126 Ang Y3.CD2 and T5.OG1 other bump:1.99816 Ang Y3.CE2 and T5.OG1 other bump:2.00864 Ang Y3.CZ and T5.OG1 other bump:2.49511 Ang Y3.OH and T5.OG1 other bump:2.75766 Ang Y3.CE2 and T5.CB Number of specific fragments= 1 total=1475 # 1qpbA.2.2 read from T0191.t2k.frag # adding 1qpbA to template set 1qpbA:# found chain 1qpbA in template set T0191 2 :GYNTDGIGA 1qpbA 3 :EITLGKYLF Fragment has 16 clashes (null) has 16 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.31937 Ang Y3.CD2 and I8.CG2 other bump:2.91804 Ang Y3.CE2 and I8.CG2 other bump:3.15826 Ang Y3.CD2 and I8.CA other bump:2.47709 Ang Y3.CE2 and I8.CA other bump:2.87719 Ang Y3.CD2 and I8.N other bump:1.95754 Ang Y3.CE2 and I8.N other bump:2.84473 Ang Y3.CZ and I8.N other bump:2.17365 Ang Y3.CE2 and G7.C other bump:2.33895 Ang Y3.CZ and G7.C other bump:2.01663 Ang Y3.OH and G7.C other bump:2.70103 Ang Y3.CE2 and G7.O other bump:2.57676 Ang Y3.CZ and G7.O other bump:1.75334 Ang Y3.OH and G7.O other bump:2.97353 Ang Y3.CE2 and G7.CA other bump:2.70206 Ang Y3.CZ and G7.CA other bump:2.35795 Ang Y3.OH and G7.CA Number of specific fragments= 1 total=1476 # 1bib.2.2 read from T0191.t2k.frag # found chain 1bib in template set T0191 2 :GYNTDGIGA 1bib 3 :DNTVPLKLI Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1477 # 1an7A.2.2 read from T0191.t2k.frag # adding 1an7A to template set 1an7A:# found chain 1an7A in template set T0191 2 :GYNTDGIGA 1an7A 5 :PIADMLTRI Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1478 # 1cfe.3.3 read from T0191.t2k.frag # found chain 1cfe in template set T0191 3 :YNTDGIGAR 1cfe 4 :PQDYLAVHN Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1479 # 1bia.3.3 read from T0191.t2k.frag # found chain 1bia in template set T0191 3 :YNTDGIGAR 1bia 4 :NTVPLKLIA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1480 # 1qpbA.3.3 read from T0191.t2k.frag # found chain 1qpbA in template set T0191 3 :YNTDGIGAR 1qpbA 4 :ITLGKYLFE Fragment has 16 clashes (null) has 16 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.31937 Ang Y2.CD2 and I7.CG2 other bump:2.91803 Ang Y2.CE2 and I7.CG2 other bump:3.15827 Ang Y2.CD2 and I7.CA other bump:2.47708 Ang Y2.CE2 and I7.CA other bump:2.8772 Ang Y2.CD2 and I7.N other bump:1.95753 Ang Y2.CE2 and I7.N other bump:2.84473 Ang Y2.CZ and I7.N other bump:2.17366 Ang Y2.CE2 and G6.C other bump:2.33896 Ang Y2.CZ and G6.C other bump:2.01662 Ang Y2.OH and G6.C other bump:2.70104 Ang Y2.CE2 and G6.O other bump:2.57676 Ang Y2.CZ and G6.O other bump:1.75332 Ang Y2.OH and G6.O other bump:2.97354 Ang Y2.CE2 and G6.CA other bump:2.70208 Ang Y2.CZ and G6.CA other bump:2.35795 Ang Y2.OH and G6.CA Number of specific fragments= 1 total=1481 # 1an7A.3.3 read from T0191.t2k.frag # found chain 1an7A in template set T0191 3 :YNTDGIGAR 1an7A 6 :IADMLTRIR Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:3.04916 Ang I7.CG1 and R10.NH1 Number of specific fragments= 1 total=1482 # 1b77A.3.3 read from T0191.t2k.frag # adding 1b77A to template set 1b77A:# found chain 1b77A in template set T0191 3 :YNTDGIGAR 1b77A 4 :SKDTIAILK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1483 # 1ds9A.3.3 read from T0191.t2k.frag # adding 1ds9A to template set 1ds9A:# found chain 1ds9A in template set T0191 3 :YNTDGIGAR 1ds9A 4 :ATTIKDAIR Fragment has 12 clashes (null) has 12 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:3.04811 Ang N3.CG and G8.N other bump:2.528 Ang N3.ND2 and I7.C other bump:2.67856 Ang N3.CG and I7.CG2 other bump:1.48929 Ang N3.ND2 and I7.CG2 other bump:2.74727 Ang N3.CG and I7.CB other bump:1.92253 Ang N3.ND2 and I7.CB other bump:2.67787 Ang N3.ND2 and I7.CA neighbor-bump: 2.53943 Ang N3.OD1 and T4.C neighbor-bump: 1.88668 Ang N3.OD1 and T4.O neighbor-bump: 2.67486 Ang N3.OD1 and T4.CA neighbor-bump: 2.42204 Ang N3.CG and T4.N neighbor-bump: 1.91884 Ang N3.OD1 and T4.N Number of specific fragments= 1 total=1484 # 1cfe.4.4 read from T0191.t2k.frag # found chain 1cfe in template set T0191 4 :NTDGIGARM 1cfe 5 :QDYLAVHND Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1485 # 1b77A.4.4 read from T0191.t2k.frag # found chain 1b77A in template set T0191 4 :NTDGIGARM 1b77A 5 :KDTIAILKN Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1486 # 1an7A.4.4 read from T0191.t2k.frag # found chain 1an7A in template set T0191 4 :NTDGIGARM 1an7A 7 :ADMLTRIRN Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:3.04916 Ang I6.CG1 and R9.NH1 Number of specific fragments= 1 total=1487 # 1qpbA.4.4 read from T0191.t2k.frag # found chain 1qpbA in template set T0191 4 :NTDGIGARM 1qpbA 5 :TLGKYLFER Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1488 # 1bia.4.4 read from T0191.t2k.frag # found chain 1bia in template set T0191 4 :NTDGIGARM 1bia 5 :TVPLKLIAL Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.5231 Ang N2.ND2 and I6.CD1 Number of specific fragments= 1 total=1489 # 1cfe.4.5 read from T0191.t2k.frag # found chain 1cfe in template set T0191 4 :NTDGIGARM 1cfe 6 :DYLAVHNDA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1490 # 1cfe.5.5 read from T0191.t2k.frag # found chain 1cfe in template set T0191 5 :TDGIGARMA 1cfe 6 :DYLAVHNDA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1491 # 1b77A.5.5 read from T0191.t2k.frag # found chain 1b77A in template set T0191 5 :TDGIGARMA 1b77A 6 :DTIAILKNF Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1492 # 1an7A.5.5 read from T0191.t2k.frag # found chain 1an7A in template set T0191 5 :TDGIGARMA 1an7A 8 :DMLTRIRNA Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:3.04916 Ang I5.CG1 and R8.NH1 Number of specific fragments= 1 total=1493 # 1cfe.5.6 read from T0191.t2k.frag # found chain 1cfe in template set T0191 5 :TDGIGARMA 1cfe 7 :YLAVHNDAR Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1494 # 1qpbA.5.5 read from T0191.t2k.frag # found chain 1qpbA in template set T0191 5 :TDGIGARMA 1qpbA 6 :LGKYLFERL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1495 # 1bia.5.5 read from T0191.t2k.frag # found chain 1bia in template set T0191 5 :TDGIGARMA 1bia 6 :VPLKLIALL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1496 # 1cfe.6.6 read from T0191.t2k.frag # found chain 1cfe in template set T0191 6 :DGIGARMAL 1cfe 7 :YLAVHNDAR Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1497 # 1cfe.6.7 read from T0191.t2k.frag # found chain 1cfe in template set T0191 6 :DGIGARMAL 1cfe 8 :LAVHNDARA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1498 # 1b77A.6.6 read from T0191.t2k.frag # found chain 1b77A in template set T0191 6 :DGIGARMAL 1b77A 7 :TIAILKNFA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1499 # 1an7A.6.6 read from T0191.t2k.frag # found chain 1an7A in template set T0191 6 :DGIGARMAL 1an7A 9 :MLTRIRNAT Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:3.04916 Ang I4.CG1 and R7.NH1 Number of specific fragments= 1 total=1500 # 1qpbA.6.6 read from T0191.t2k.frag # found chain 1qpbA in template set T0191 6 :DGIGARMAL 1qpbA 7 :GKYLFERLK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1501 # 1bia.6.6 read from T0191.t2k.frag # found chain 1bia in template set T0191 6 :DGIGARMAL 1bia 7 :PLKLIALLA Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.79192 Ang R7.CA and L10.CD1 Number of specific fragments= 1 total=1502 # 1cfe.7.7 read from T0191.t2k.frag # found chain 1cfe in template set T0191 7 :GIGARMALE 1cfe 8 :LAVHNDARA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1503 # 1cfe.7.8 read from T0191.t2k.frag # found chain 1cfe in template set T0191 7 :GIGARMALE 1cfe 9 :AVHNDARAQ Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1504 # 1an7A.7.7 read from T0191.t2k.frag # found chain 1an7A in template set T0191 7 :GIGARMALE 1an7A 10 :LTRIRNATR Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:3.04916 Ang I3.CG1 and R6.NH1 Number of specific fragments= 1 total=1505 # 1b77A.7.7 read from T0191.t2k.frag # found chain 1b77A in template set T0191 7 :GIGARMALE 1b77A 8 :IAILKNFAS Fragment has 16 clashes (null) has 16 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.64342 Ang M7.CB and E10.OE2 other bump:2.24455 Ang M7.CG and E10.OE2 other bump:2.33978 Ang M7.C and E10.OE2 other bump:2.26838 Ang M7.CA and E10.OE2 other bump:1.76451 Ang M7.SD and E10.OE2 other bump:1.92197 Ang M7.O and E10.OE2 other bump:1.98785 Ang R6.O and E10.OE1 other bump:2.7521 Ang R6.C and E10.OE1 other bump:2.122 Ang M7.C and E10.OE1 other bump:2.21449 Ang M7.CA and E10.OE1 other bump:1.96207 Ang M7.O and E10.OE1 other bump:2.30988 Ang M7.C and E10.CD other bump:2.51701 Ang M7.CA and E10.CD other bump:2.91346 Ang M7.SD and E10.CD other bump:1.65102 Ang M7.O and E10.CD other bump:2.54636 Ang M7.O and E10.CG Number of specific fragments= 1 total=1506 # 1qpbA.7.7 read from T0191.t2k.frag # found chain 1qpbA in template set T0191 7 :GIGARMALE 1qpbA 8 :KYLFERLKQ Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1507 # 1bia.7.7 read from T0191.t2k.frag # found chain 1bia in template set T0191 7 :GIGARMALE 1bia 8 :LKLIALLAN Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.92634 Ang M7.O and E10.OE1 other bump:2.50614 Ang M7.O and E10.CD other bump:2.04905 Ang A5.O and L9.CD1 other bump:2.77793 Ang A5.C and L9.CD1 Number of specific fragments= 1 total=1508 # 1cfe.8.8 read from T0191.t2k.frag # found chain 1cfe in template set T0191 8 :IGARMALEE 1cfe 9 :AVHNDARAQ Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1509 # 1cfe.8.9 read from T0191.t2k.frag # found chain 1cfe in template set T0191 8 :IGARMALEE 1cfe 10 :VHNDARAQV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1510 # 1an7A.8.8 read from T0191.t2k.frag # found chain 1an7A in template set T0191 8 :IGARMALEE 1an7A 11 :TRIRNATRV Fragment has 9 clashes (null) has 9 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.48472 Ang R5.CG and E9.OE2 other bump:2.67556 Ang R5.C and E9.OE2 other bump:2.23355 Ang R5.O and E9.OE2 other bump:1.80924 Ang R5.C and E9.OE1 other bump:2.48375 Ang M6.CA and E9.OE1 other bump:0.879544 Ang R5.O and E9.OE1 other bump:2.54343 Ang R5.C and E9.CD other bump:1.73426 Ang R5.O and E9.CD other bump:3.04915 Ang I2.CG1 and R5.NH1 Number of specific fragments= 1 total=1511 # 1qpbA.8.8 read from T0191.t2k.frag # found chain 1qpbA in template set T0191 8 :IGARMALEE 1qpbA 9 :YLFERLKQV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1512 # 1b77A.8.8 read from T0191.t2k.frag # found chain 1b77A in template set T0191 8 :IGARMALEE 1b77A 9 :AILKNFASI Fragment has 16 clashes (null) has 16 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.26839 Ang M6.CA and E9.OE2 other bump:2.64343 Ang M6.CB and E9.OE2 other bump:2.24455 Ang M6.CG and E9.OE2 other bump:1.76451 Ang M6.SD and E9.OE2 other bump:2.33979 Ang M6.C and E9.OE2 other bump:1.92198 Ang M6.O and E9.OE2 other bump:2.7521 Ang R5.C and E9.OE1 other bump:2.21449 Ang M6.CA and E9.OE1 other bump:1.98785 Ang R5.O and E9.OE1 other bump:2.12199 Ang M6.C and E9.OE1 other bump:1.96207 Ang M6.O and E9.OE1 other bump:2.51701 Ang M6.CA and E9.CD other bump:2.91346 Ang M6.SD and E9.CD other bump:2.30988 Ang M6.C and E9.CD other bump:1.65102 Ang M6.O and E9.CD other bump:2.54637 Ang M6.O and E9.CG Number of specific fragments= 1 total=1513 # 1bia.8.8 read from T0191.t2k.frag # found chain 1bia in template set T0191 8 :IGARMALEE 1bia 9 :KLIALLANG Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.92633 Ang M6.O and E9.OE1 other bump:2.50613 Ang M6.O and E9.CD other bump:2.04905 Ang A4.O and L8.CD1 other bump:2.77793 Ang A4.C and L8.CD1 Number of specific fragments= 1 total=1514 # 1cfe.9.9 read from T0191.t2k.frag # found chain 1cfe in template set T0191 9 :GARMALEEE 1cfe 10 :VHNDARAQV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1515 # 1cfe.9.10 read from T0191.t2k.frag # found chain 1cfe in template set T0191 9 :GARMALEEE 1cfe 11 :HNDARAQVG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1516 # 1an7A.9.9 read from T0191.t2k.frag # found chain 1an7A in template set T0191 9 :GARMALEEE 1an7A 12 :RIRNATRVY Fragment has 8 clashes (null) has 8 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.48472 Ang R4.CG and E8.OE2 other bump:2.23355 Ang R4.O and E8.OE2 other bump:2.67556 Ang R4.C and E8.OE2 other bump:0.879544 Ang R4.O and E8.OE1 other bump:1.80924 Ang R4.C and E8.OE1 other bump:2.48375 Ang M5.CA and E8.OE1 other bump:1.73426 Ang R4.O and E8.CD other bump:2.54343 Ang R4.C and E8.CD Number of specific fragments= 1 total=1517 # 1qpbA.9.9 read from T0191.t2k.frag # found chain 1qpbA in template set T0191 9 :GARMALEEE 1qpbA 10 :LFERLKQVN Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1518 # 1bia.9.9 read from T0191.t2k.frag # found chain 1bia in template set T0191 9 :GARMALEEE 1bia 10 :LIALLANGE Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.97781 Ang E8.CG and E10.CG other bump:1.92633 Ang M5.O and E8.OE1 other bump:2.50613 Ang M5.O and E8.CD other bump:2.04905 Ang A3.O and L7.CD1 other bump:2.77793 Ang A3.C and L7.CD1 Number of specific fragments= 1 total=1519 # 1b77A.9.9 read from T0191.t2k.frag # found chain 1b77A in template set T0191 9 :GARMALEEE 1b77A 10 :ILKNFASIN Fragment has 16 clashes (null) has 16 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.64343 Ang M5.CB and E8.OE2 other bump:2.24455 Ang M5.CG and E8.OE2 other bump:1.76451 Ang M5.SD and E8.OE2 other bump:2.26839 Ang M5.CA and E8.OE2 other bump:2.33979 Ang M5.C and E8.OE2 other bump:1.92198 Ang M5.O and E8.OE2 other bump:1.98785 Ang R4.O and E8.OE1 other bump:2.7521 Ang R4.C and E8.OE1 other bump:2.21449 Ang M5.CA and E8.OE1 other bump:2.12199 Ang M5.C and E8.OE1 other bump:1.96207 Ang M5.O and E8.OE1 other bump:2.91346 Ang M5.SD and E8.CD other bump:2.51701 Ang M5.CA and E8.CD other bump:2.30988 Ang M5.C and E8.CD other bump:1.65102 Ang M5.O and E8.CD other bump:2.54637 Ang M5.O and E8.CG Number of specific fragments= 1 total=1520 # 1cfe.10.10 read from T0191.t2k.frag # found chain 1cfe in template set T0191 10 :ARMALEEEI 1cfe 11 :HNDARAQVG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1521 # 1cfe.10.11 read from T0191.t2k.frag # found chain 1cfe in template set T0191 10 :ARMALEEEI 1cfe 12 :NDARAQVGV Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:3.0114 Ang A5.CA and I10.CG1 other bump:2.80508 Ang A5.CB and I10.CG1 Number of specific fragments= 1 total=1522 # 1an7A.10.10 read from T0191.t2k.frag # found chain 1an7A in template set T0191 10 :ARMALEEEI 1an7A 13 :IRNATRVYK Fragment has 8 clashes (null) has 8 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.48472 Ang R3.CG and E7.OE2 other bump:2.23355 Ang R3.O and E7.OE2 other bump:2.67556 Ang R3.C and E7.OE2 other bump:0.879544 Ang R3.O and E7.OE1 other bump:1.80924 Ang R3.C and E7.OE1 other bump:2.48375 Ang M4.CA and E7.OE1 other bump:1.73426 Ang R3.O and E7.CD other bump:2.54343 Ang R3.C and E7.CD Number of specific fragments= 1 total=1523 # 1qpbA.10.10 read from T0191.t2k.frag # found chain 1qpbA in template set T0191 10 :ARMALEEEI 1qpbA 11 :FERLKQVNV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1524 # 1b77A.10.10 read from T0191.t2k.frag # found chain 1b77A in template set T0191 10 :ARMALEEEI 1b77A 11 :LKNFASINS Fragment has 16 clashes (null) has 16 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.26839 Ang M4.CA and E7.OE2 other bump:2.33979 Ang M4.C and E7.OE2 other bump:2.64343 Ang M4.CB and E7.OE2 other bump:2.24455 Ang M4.CG and E7.OE2 other bump:1.76451 Ang M4.SD and E7.OE2 other bump:1.92198 Ang M4.O and E7.OE2 other bump:1.98785 Ang R3.O and E7.OE1 other bump:2.7521 Ang R3.C and E7.OE1 other bump:2.21449 Ang M4.CA and E7.OE1 other bump:2.12199 Ang M4.C and E7.OE1 other bump:1.96207 Ang M4.O and E7.OE1 other bump:2.51701 Ang M4.CA and E7.CD other bump:2.30988 Ang M4.C and E7.CD other bump:2.91346 Ang M4.SD and E7.CD other bump:1.65102 Ang M4.O and E7.CD other bump:2.54637 Ang M4.O and E7.CG Number of specific fragments= 1 total=1525 # 1bia.10.10 read from T0191.t2k.frag # found chain 1bia in template set T0191 10 :ARMALEEEI 1bia 11 :IALLANGEF Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.97781 Ang E7.CG and E9.CG other bump:1.92633 Ang M4.O and E7.OE1 other bump:2.50613 Ang M4.O and E7.CD other bump:2.04905 Ang A2.O and L6.CD1 other bump:2.77793 Ang A2.C and L6.CD1 Number of specific fragments= 1 total=1526 # 1cfe.11.12 read from T0191.t2k.frag # found chain 1cfe in template set T0191 11 :RMALEEEIG 1cfe 13 :DARAQVGVG Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.94939 Ang A4.CA and I9.CG1 other bump:2.9153 Ang A4.CB and I9.CG1 Number of specific fragments= 1 total=1527 # 1cfe.11.11 read from T0191.t2k.frag # found chain 1cfe in template set T0191 11 :RMALEEEIG 1cfe 12 :NDARAQVGV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1528 # 1qpbA.11.11 read from T0191.t2k.frag # found chain 1qpbA in template set T0191 11 :RMALEEEIG 1qpbA 12 :ERLKQVNVN Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues self-bump: 1.33364 Ang I9.CA and I9.CB Number of specific fragments= 1 total=1529 # 1an7A.11.11 read from T0191.t2k.frag # found chain 1an7A in template set T0191 11 :RMALEEEIG 1an7A 14 :RNATRVYKE Fragment has 8 clashes (null) has 8 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.48472 Ang R2.CG and E6.OE2 other bump:2.23355 Ang R2.O and E6.OE2 other bump:2.67556 Ang R2.C and E6.OE2 other bump:0.879544 Ang R2.O and E6.OE1 other bump:1.80924 Ang R2.C and E6.OE1 other bump:2.48375 Ang M3.CA and E6.OE1 other bump:1.73426 Ang R2.O and E6.CD other bump:2.54343 Ang R2.C and E6.CD Number of specific fragments= 1 total=1530 # 1bia.11.11 read from T0191.t2k.frag # found chain 1bia in template set T0191 11 :RMALEEEIG 1bia 12 :ALLANGEFH Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.97781 Ang E6.CG and E8.CG other bump:1.92633 Ang M3.O and E6.OE1 other bump:2.50613 Ang M3.O and E6.CD other bump:2.04905 Ang G1.O and L5.CD1 other bump:2.77793 Ang G1.C and L5.CD1 Number of specific fragments= 1 total=1531 # 1ds9A.11.12 read from T0191.t2k.frag # found chain 1ds9A in template set T0191 11 :RMALEEEIG 1ds9A 13 :IFEERKSVV Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.44345 Ang I9.CG2 and G10.N self-bump: 1.34636 Ang E6.CA and E6.CB Number of specific fragments= 1 total=1532 # 1cfe.12.13 read from T0191.t2k.frag # found chain 1cfe in template set T0191 12 :MALEEEIGR 1cfe 14 :ARAQVGVGP Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.94939 Ang A3.CA and I8.CG1 other bump:2.9153 Ang A3.CB and I8.CG1 Number of specific fragments= 1 total=1533 # 1cfe.12.12 read from T0191.t2k.frag # found chain 1cfe in template set T0191 12 :MALEEEIGR 1cfe 13 :DARAQVGVG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1534 # 1qpbA.12.12 read from T0191.t2k.frag # found chain 1qpbA in template set T0191 12 :MALEEEIGR 1qpbA 13 :RLKQVNVNT Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues self-bump: 1.33364 Ang I8.CA and I8.CB Number of specific fragments= 1 total=1535 # 1an7A.12.12 read from T0191.t2k.frag # found chain 1an7A in template set T0191 12 :MALEEEIGR 1an7A 15 :NATRVYKES Fragment has 8 clashes (null) has 8 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.50451 Ang I8.CG2 and R10.O other bump:2.23355 Ang G1.O and E5.OE2 other bump:2.67556 Ang G1.C and E5.OE2 other bump:0.879544 Ang G1.O and E5.OE1 other bump:1.80924 Ang G1.C and E5.OE1 other bump:2.48375 Ang M2.CA and E5.OE1 other bump:1.73426 Ang G1.O and E5.CD other bump:2.54343 Ang G1.C and E5.CD Number of specific fragments= 1 total=1536 # 1bia.12.12 read from T0191.t2k.frag # found chain 1bia in template set T0191 12 :MALEEEIGR 1bia 13 :LLANGEFHS Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.97781 Ang E5.CG and E7.CG other bump:1.92633 Ang M2.O and E5.OE1 other bump:2.50613 Ang M2.O and E5.CD Number of specific fragments= 1 total=1537 # 1ds9A.12.13 read from T0191.t2k.frag # found chain 1ds9A in template set T0191 12 :MALEEEIGR 1ds9A 14 :FEERKSVVA Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues self-bump: 1.33238 Ang R10.CA and R10.CB neighbor-bump: 2.44345 Ang I8.CG2 and G9.N other bump:2.81323 Ang M2.CE and I8.CG1 other bump:2.90261 Ang M2.CE and E6.CG other bump:2.86054 Ang M2.CE and E6.CB self-bump: 1.34636 Ang E5.CA and E5.CB Number of specific fragments= 1 total=1538 # 1cfe.13.13 read from T0191.t2k.frag # found chain 1cfe in template set T0191 13 :ALEEEIGRV 1cfe 14 :ARAQVGVGP Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1539 # 1cfe.13.14 read from T0191.t2k.frag # found chain 1cfe in template set T0191 13 :ALEEEIGRV 1cfe 15 :RAQVGVGPM Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.94939 Ang A2.CA and I7.CG1 other bump:2.9153 Ang A2.CB and I7.CG1 Number of specific fragments= 1 total=1540 # 1qpbA.13.13 read from T0191.t2k.frag # found chain 1qpbA in template set T0191 13 :ALEEEIGRV 1qpbA 14 :LKQVNVNTV Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues self-bump: 1.33364 Ang I7.CA and I7.CB Number of specific fragments= 1 total=1541 # 1an7A.13.13 read from T0191.t2k.frag # found chain 1an7A in template set T0191 13 :ALEEEIGRV 1an7A 16 :ATRVYKEST Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.87475 Ang A2.CB and V10.CG1 other bump:2.50451 Ang I7.CG2 and R9.O Number of specific fragments= 1 total=1542 # 1ds9A.13.14 read from T0191.t2k.frag # found chain 1ds9A in template set T0191 13 :ALEEEIGRV 1ds9A 15 :EERKSVVAT Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues self-bump: 1.33238 Ang R9.CA and R9.CB neighbor-bump: 2.44345 Ang I7.CG2 and G8.N self-bump: 1.34636 Ang E4.CA and E4.CB Number of specific fragments= 1 total=1543 # 1bia.13.13 read from T0191.t2k.frag # found chain 1bia in template set T0191 13 :ALEEEIGRV 1bia 14 :LANGEFHSG Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:3.15301 Ang R9.CG and G11.N other bump:2.97781 Ang E4.CG and E6.CG other bump:1.92633 Ang G1.O and E4.OE1 other bump:2.50613 Ang G1.O and E4.CD Number of specific fragments= 1 total=1544 # 1cfe.14.14 read from T0191.t2k.frag # found chain 1cfe in template set T0191 14 :LEEEIGRVK 1cfe 15 :RAQVGVGPM Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.96454 Ang V9.CG1 and K10.C neighbor-bump: 2.44744 Ang V9.CG1 and K10.O neighbor-bump: 3.02895 Ang V9.CG1 and K10.CA neighbor-bump: 2.20434 Ang V9.CG1 and K10.N Number of specific fragments= 1 total=1545 # 1cfe.14.15 read from T0191.t2k.frag # found chain 1cfe in template set T0191 14 :LEEEIGRVK 1cfe 16 :AQVGVGPMS Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:3.25459 Ang R8.NE and K10.NZ other bump:2.82699 Ang R8.CZ and K10.NZ other bump:2.54499 Ang R8.NH2 and K10.NZ Number of specific fragments= 1 total=1546 # 1ds9A.14.15 read from T0191.t2k.frag # found chain 1ds9A in template set T0191 14 :LEEEIGRVK 1ds9A 16 :ERKSVVATE Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues self-bump: 1.33238 Ang R8.CA and R8.CB neighbor-bump: 2.44345 Ang I6.CG2 and G7.N self-bump: 1.34636 Ang E3.CA and E3.CB Number of specific fragments= 1 total=1547 # 1an7A.14.14 read from T0191.t2k.frag # found chain 1an7A in template set T0191 14 :LEEEIGRVK 1an7A 17 :TRVYKESTD Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 3.07487 Ang R8.C and V9.CG1 other bump:2.50451 Ang I6.CG2 and R8.O Number of specific fragments= 1 total=1548 # 1qpbA.14.14 read from T0191.t2k.frag # found chain 1qpbA in template set T0191 14 :LEEEIGRVK 1qpbA 15 :KQVNVNTVF Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:3.44563 Ang R8.NE and K10.NZ self-bump: 1.33364 Ang I6.CA and I6.CB Number of specific fragments= 1 total=1549 # 1cfe.14.16 read from T0191.t2k.frag # found chain 1cfe in template set T0191 14 :LEEEIGRVK 1cfe 17 :QVGVGPMSW Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1550 # 1cfe.15.15 read from T0191.t2k.frag # found chain 1cfe in template set T0191 15 :EEEIGRVKD 1cfe 16 :AQVGVGPMS Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.96454 Ang V8.CG1 and K9.C neighbor-bump: 2.44744 Ang V8.CG1 and K9.O neighbor-bump: 3.02895 Ang V8.CG1 and K9.CA neighbor-bump: 2.20434 Ang V8.CG1 and K9.N Number of specific fragments= 1 total=1551 # 1ds9A.15.16 read from T0191.t2k.frag # found chain 1ds9A in template set T0191 15 :EEEIGRVKD 1ds9A 17 :RKSVVATEA Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.15011 Ang G6.O and D10.OD2 other bump:2.41849 Ang R7.O and D10.CG self-bump: 1.33238 Ang R7.CA and R7.CB neighbor-bump: 2.44345 Ang I5.CG2 and G6.N self-bump: 1.34636 Ang E2.CA and E2.CB Number of specific fragments= 1 total=1552 # 1cfe.15.16 read from T0191.t2k.frag # found chain 1cfe in template set T0191 15 :EEEIGRVKD 1cfe 17 :QVGVGPMSW Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1553 # 1cseE.15.16 read from T0191.t2k.frag # adding 1cseE to template set 1cseE:# found chain 1cseE in template set T0191 15 :EEEIGRVKD 1cseE 17 :QAQGFKGAN Fragment has 9 clashes (null) has 9 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.85455 Ang R7.NH2 and K9.CE neighbor-bump: 2.78536 Ang R7.C and V8.CG2 neighbor-bump: 1.97266 Ang R7.O and V8.CB neighbor-bump: 2.31926 Ang R7.C and V8.CB neighbor-bump: 2.41654 Ang E4.O and I5.CD1 neighbor-bump: 2.51372 Ang E4.C and I5.CG1 neighbor-bump: 1.93964 Ang E4.O and I5.CG1 neighbor-bump: 2.27819 Ang E4.C and I5.CB neighbor-bump: 1.63678 Ang E4.O and I5.CB Number of specific fragments= 1 total=1554 # 1qhhA.15.16 read from T0191.t2k.frag # adding 1qhhA to template set 1qhhA:# found chain 1qhhA in template set T0191 15 :EEEIGRVKD 1qhhA 17 :QEAVRTTEG Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.71669 Ang E3.OE2 and R7.NH2 other bump:2.18992 Ang E3.OE2 and R7.CZ Number of specific fragments= 1 total=1555 # 1pjr.15.16 read from T0191.t2k.frag # adding 1pjr to template set 1pjr:# found chain 1pjr in template set T0191 15 :EEEIGRVKD 1pjr 17 :QEAVRTTEG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1556 # 1ds9A.16.17 read from T0191.t2k.frag # found chain 1ds9A in template set T0191 16 :EEIGRVKDK 1ds9A 18 :KSVVATEAE Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.15011 Ang G5.O and D9.OD2 other bump:2.41849 Ang R6.O and D9.CG self-bump: 1.33238 Ang R6.CA and R6.CB neighbor-bump: 2.44345 Ang I4.CG2 and G5.N Number of specific fragments= 1 total=1557 # 1cfe.16.16 read from T0191.t2k.frag # found chain 1cfe in template set T0191 16 :EEIGRVKDK 1cfe 17 :QVGVGPMSW Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.96454 Ang V7.CG1 and K8.C neighbor-bump: 2.44744 Ang V7.CG1 and K8.O neighbor-bump: 3.02895 Ang V7.CG1 and K8.CA neighbor-bump: 2.20434 Ang V7.CG1 and K8.N Number of specific fragments= 1 total=1558 # 1qhhA.16.17 read from T0191.t2k.frag # found chain 1qhhA in template set T0191 16 :EEIGRVKDK 1qhhA 18 :EAVRTTEGP Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.71669 Ang E2.OE2 and R6.NH2 other bump:2.18992 Ang E2.OE2 and R6.CZ Number of specific fragments= 1 total=1559 # 1pjr.16.17 read from T0191.t2k.frag # found chain 1pjr in template set T0191 16 :EEIGRVKDK 1pjr 18 :EAVRTTEGP Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1560 # 1cseE.16.17 read from T0191.t2k.frag # found chain 1cseE in template set T0191 16 :EEIGRVKDK 1cseE 18 :AQGFKGANV Fragment has 9 clashes (null) has 9 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.85455 Ang R6.NH2 and K8.CE neighbor-bump: 2.78536 Ang R6.C and V7.CG2 neighbor-bump: 1.97266 Ang R6.O and V7.CB neighbor-bump: 2.31926 Ang R6.C and V7.CB neighbor-bump: 2.41654 Ang E3.O and I4.CD1 neighbor-bump: 2.51372 Ang E3.C and I4.CG1 neighbor-bump: 1.93963 Ang E3.O and I4.CG1 neighbor-bump: 2.27819 Ang E3.C and I4.CB neighbor-bump: 1.63678 Ang E3.O and I4.CB Number of specific fragments= 1 total=1561 # 1cfe.16.17 read from T0191.t2k.frag # found chain 1cfe in template set T0191 16 :EEIGRVKDK 1cfe 18 :VGVGPMSWD Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1562 # 1ds9A.17.18 read from T0191.t2k.frag # found chain 1ds9A in template set T0191 17 :EIGRVKDKN 1ds9A 19 :SVVATEAEK Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.15011 Ang G4.O and D8.OD2 other bump:2.41849 Ang R5.O and D8.CG self-bump: 1.33238 Ang R5.CA and R5.CB neighbor-bump: 2.44345 Ang I3.CG2 and G4.N Number of specific fragments= 1 total=1563 # 1qhhA.17.18 read from T0191.t2k.frag # found chain 1qhhA in template set T0191 17 :EIGRVKDKN 1qhhA 19 :AVRTTEGPL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1564 # 1pjr.17.18 read from T0191.t2k.frag # found chain 1pjr in template set T0191 17 :EIGRVKDKN 1pjr 19 :AVRTTEGPL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1565 # 1cfe.17.17 read from T0191.t2k.frag # found chain 1cfe in template set T0191 17 :EIGRVKDKN 1cfe 18 :VGVGPMSWD Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.96454 Ang V6.CG1 and K7.C neighbor-bump: 2.44744 Ang V6.CG1 and K7.O neighbor-bump: 3.02895 Ang V6.CG1 and K7.CA neighbor-bump: 2.20434 Ang V6.CG1 and K7.N Number of specific fragments= 1 total=1566 # 1cseE.17.18 read from T0191.t2k.frag # found chain 1cseE in template set T0191 17 :EIGRVKDKN 1cseE 19 :QGFKGANVK Fragment has 9 clashes (null) has 9 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.85455 Ang R5.NH2 and K7.CE neighbor-bump: 2.78536 Ang R5.C and V6.CG2 neighbor-bump: 1.97266 Ang R5.O and V6.CB neighbor-bump: 2.31926 Ang R5.C and V6.CB neighbor-bump: 2.41654 Ang E2.O and I3.CD1 neighbor-bump: 2.51372 Ang E2.C and I3.CG1 neighbor-bump: 1.93963 Ang E2.O and I3.CG1 neighbor-bump: 2.27819 Ang E2.C and I3.CB neighbor-bump: 1.63678 Ang E2.O and I3.CB Number of specific fragments= 1 total=1567 # 1gci.17.19 read from T0191.t2k.frag # found chain 1gci in training set T0191 17 :EIGRVKDKN 1gci 20 :GLTGSGVKV Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.92305 Ang V6.CG1 and K7.CA neighbor-bump: 2.46251 Ang V6.CB and K7.N neighbor-bump: 1.80581 Ang V6.CG1 and K7.N self-bump: 2.21967 Ang V6.CB and V6.C self-bump: 2.33431 Ang V6.CG1 and V6.C self-bump: 1.30395 Ang V6.CA and V6.CB Number of specific fragments= 1 total=1568 # 1ds9A.18.19 read from T0191.t2k.frag # found chain 1ds9A in template set T0191 18 :IGRVKDKNI 1ds9A 20 :VVATEAEKV Fragment has 19 clashes (null) has 19 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.34465 Ang R4.CD and I10.CD1 other bump:2.40533 Ang R4.NE and I10.CD1 other bump:2.11665 Ang R4.CZ and I10.CD1 other bump:1.55316 Ang R4.NH1 and I10.CD1 other bump:2.67665 Ang R4.CB and I10.CD1 other bump:2.864 Ang R4.NE and I10.CG2 other bump:1.78451 Ang R4.CZ and I10.CG2 other bump:2.26963 Ang R4.NH1 and I10.CG2 other bump:1.0104 Ang R4.NH2 and I10.CG2 other bump:2.6163 Ang R4.CZ and I10.CG1 other bump:2.17451 Ang R4.NH1 and I10.CG1 other bump:3.12295 Ang R4.NH2 and I10.CG1 other bump:2.31962 Ang R4.CZ and I10.CB other bump:2.61445 Ang R4.NH1 and I10.CB other bump:2.20319 Ang R4.NH2 and I10.CB other bump:2.15011 Ang G3.O and D7.OD2 other bump:2.41849 Ang R4.O and D7.CG self-bump: 1.33238 Ang R4.CA and R4.CB neighbor-bump: 2.42482 Ang I2.CG2 and G3.N Number of specific fragments= 1 total=1569 # 1qhhA.18.19 read from T0191.t2k.frag # found chain 1qhhA in template set T0191 18 :IGRVKDKNI 1qhhA 20 :VRTTEGPLL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1570 # 1pjr.18.19 read from T0191.t2k.frag # found chain 1pjr in template set T0191 18 :IGRVKDKNI 1pjr 20 :VRTTEGPLL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1571 # 1cseE.18.19 read from T0191.t2k.frag # found chain 1cseE in template set T0191 18 :IGRVKDKNI 1cseE 20 :GFKGANVKV Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.85455 Ang R4.NH2 and K6.CE neighbor-bump: 2.78536 Ang R4.C and V5.CG2 neighbor-bump: 1.97266 Ang R4.O and V5.CB neighbor-bump: 2.31926 Ang R4.C and V5.CB neighbor-bump: 2.73223 Ang G1.C and I2.CG1 Number of specific fragments= 1 total=1572 # 1s01.18.19 read from T0191.t2k.frag # adding 1s01 to template set 1s01:Skipped atom 1415, because occupancy 0.5 <= existing 0.500001 Skipped atom 1732, because occupancy 0.5 <= existing 0.500001 # found chain 1s01 in template set T0191 18 :IGRVKDKNI 1s01 20 :GYTGSNVKV Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:3.11841 Ang R4.NH2 and K6.CE neighbor-bump: 2.84396 Ang R4.C and V5.CG2 neighbor-bump: 2.04319 Ang R4.O and V5.CB neighbor-bump: 2.38304 Ang R4.C and V5.CB Number of specific fragments= 1 total=1573 # 1jw9B.18.25 read from T0191.t2k.frag # adding 1jw9B to template set 1jw9B:# found chain 1jw9B in template set T0191 18 :IGRVKDKNI 1jw9B 26 :QEALKDSRV Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.61748 Ang K8.CD and I10.CG2 other bump:1.26382 Ang K8.NZ and I10.CG2 other bump:1.81986 Ang K8.CE and I10.CG2 other bump:2.68679 Ang K8.NZ and I10.CB Number of specific fragments= 1 total=1574 # 1qhhA.19.20 read from T0191.t2k.frag # found chain 1qhhA in template set T0191 19 :GRVKDKNIV 1qhhA 21 :RTTEGPLLI Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1575 # 1pjr.19.20 read from T0191.t2k.frag # found chain 1pjr in template set T0191 19 :GRVKDKNIV 1pjr 21 :RTTEGPLLI Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1576 # 1ds9A.19.20 read from T0191.t2k.frag # found chain 1ds9A in template set T0191 19 :GRVKDKNIV 1ds9A 21 :VATEAEKVE Fragment has 18 clashes (null) has 18 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.66239 Ang R3.CD and I9.CD1 other bump:1.85243 Ang R3.NE and I9.CD1 other bump:0.735621 Ang R3.CZ and I9.CD1 other bump:0.595073 Ang R3.NH1 and I9.CD1 other bump:1.74317 Ang R3.NH2 and I9.CD1 other bump:2.88986 Ang R3.CG and I9.CG2 other bump:2.62743 Ang R3.NE and I9.CG2 other bump:2.76974 Ang R3.CZ and I9.CG2 other bump:2.82735 Ang R3.NH2 and I9.CG2 other bump:2.61675 Ang R3.NE and I9.CG1 other bump:1.55393 Ang R3.CZ and I9.CG1 other bump:1.89506 Ang R3.NH1 and I9.CG1 other bump:1.26068 Ang R3.NH2 and I9.CG1 other bump:2.50951 Ang R3.CZ and I9.CB other bump:2.51158 Ang R3.NH2 and I9.CB other bump:2.15011 Ang G2.O and D6.OD2 other bump:2.41849 Ang R3.O and D6.CG self-bump: 1.33238 Ang R3.CA and R3.CB Number of specific fragments= 1 total=1577 # 1jw9B.19.26 read from T0191.t2k.frag # found chain 1jw9B in template set T0191 19 :GRVKDKNIV 1jw9B 27 :EALKDSRVL Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.72867 Ang K7.NZ and I9.CG2 other bump:1.9614 Ang K7.CE and I9.CG2 other bump:2.45348 Ang K7.CD and I9.CG2 other bump:2.79519 Ang K7.NZ and I9.CB Number of specific fragments= 1 total=1578 # 1cseE.19.20 read from T0191.t2k.frag # found chain 1cseE in template set T0191 19 :GRVKDKNIV 1cseE 21 :FKGANVKVA Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.85455 Ang R3.NH2 and K5.CE neighbor-bump: 2.78536 Ang R3.C and V4.CG2 neighbor-bump: 1.97266 Ang R3.O and V4.CB neighbor-bump: 2.31926 Ang R3.C and V4.CB Number of specific fragments= 1 total=1579 # 1s01.19.20 read from T0191.t2k.frag # found chain 1s01 in template set T0191 19 :GRVKDKNIV 1s01 21 :YTGSNVKVA Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:3.11841 Ang R3.NH2 and K5.CE neighbor-bump: 2.84396 Ang R3.C and V4.CG2 neighbor-bump: 2.04319 Ang R3.O and V4.CB neighbor-bump: 2.38304 Ang R3.C and V4.CB Number of specific fragments= 1 total=1580 # 1jw9B.20.27 read from T0191.t2k.frag # found chain 1jw9B in template set T0191 20 :RVKDKNIVI 1jw9B 28 :ALKDSRVLI Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.9614 Ang K6.CE and I8.CG2 other bump:1.72867 Ang K6.NZ and I8.CG2 other bump:2.45348 Ang K6.CD and I8.CG2 other bump:2.79519 Ang K6.NZ and I8.CB Number of specific fragments= 1 total=1581 # 1qhhA.20.21 read from T0191.t2k.frag # found chain 1qhhA in template set T0191 20 :RVKDKNIVI 1qhhA 22 :TTEGPLLIM Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1582 # 1pjr.20.21 read from T0191.t2k.frag # found chain 1pjr in template set T0191 20 :RVKDKNIVI 1pjr 22 :TTEGPLLIM Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1583 # 1ds9A.20.21 read from T0191.t2k.frag # found chain 1ds9A in template set T0191 20 :RVKDKNIVI 1ds9A 22 :ATEAEKVEL Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.53291 Ang I10.CG2 and G11.N other bump:2.38893 Ang R2.CD and I8.CD1 other bump:2.15011 Ang G1.O and D5.OD2 other bump:2.41849 Ang R2.O and D5.CG self-bump: 1.38973 Ang R2.CA and R2.CB Number of specific fragments= 1 total=1584 # 1s01.20.21 read from T0191.t2k.frag # found chain 1s01 in template set T0191 20 :RVKDKNIVI 1s01 22 :TGSNVKVAV Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.84396 Ang R2.C and V3.CG2 neighbor-bump: 2.04319 Ang R2.O and V3.CB neighbor-bump: 2.38304 Ang R2.C and V3.CB Number of specific fragments= 1 total=1585 # 1ybvA.20.25 read from T0191.t2k.frag # found chain 1ybvA in template set T0191 20 :RVKDKNIVI 1ybvA 26 :SLEGKVALV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1586 # 1jw9B.21.28 read from T0191.t2k.frag # found chain 1jw9B in template set T0191 21 :VKDKNIVIY 1jw9B 29 :LKDSRVLIV Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.72867 Ang K5.NZ and I7.CG2 other bump:2.45348 Ang K5.CD and I7.CG2 other bump:1.9614 Ang K5.CE and I7.CG2 other bump:2.79519 Ang K5.NZ and I7.CB Number of specific fragments= 1 total=1587 # 1qhhA.21.22 read from T0191.t2k.frag # found chain 1qhhA in template set T0191 21 :VKDKNIVIY 1qhhA 23 :TEGPLLIMA Fragment has 8 clashes (null) has 8 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.18414 Ang V8.CG2 and Y10.OH other bump:1.61745 Ang V8.CG2 and Y10.CZ other bump:2.85279 Ang V8.CG2 and Y10.CE2 other bump:3.10062 Ang V8.CA and Y10.CE1 other bump:2.10718 Ang V8.CB and Y10.CE1 other bump:0.889171 Ang V8.CG2 and Y10.CE1 other bump:3.02839 Ang V8.CB and Y10.CD1 other bump:2.11417 Ang V8.CG2 and Y10.CD1 Number of specific fragments= 1 total=1588 # 1pjr.21.22 read from T0191.t2k.frag # found chain 1pjr in template set T0191 21 :VKDKNIVIY 1pjr 23 :TEGPLLIMA Fragment has 14 clashes (null) has 14 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.86064 Ang V8.CB and Y10.OH other bump:2.7363 Ang V8.CG1 and Y10.OH other bump:2.07172 Ang V8.CG2 and Y10.OH other bump:2.73678 Ang V8.CB and Y10.CZ other bump:1.4477 Ang V8.CG2 and Y10.CZ other bump:2.59374 Ang V8.CG2 and Y10.CE2 other bump:3.02401 Ang V8.CA and Y10.CE1 other bump:1.96703 Ang V8.CB and Y10.CE1 other bump:3.14333 Ang V8.C and Y10.CE1 other bump:1.04885 Ang V8.CG2 and Y10.CE1 other bump:3.00283 Ang V8.CB and Y10.CD1 other bump:2.6634 Ang V8.O and Y10.CD1 other bump:2.17325 Ang V8.CG2 and Y10.CD1 other bump:3.03429 Ang V8.CG2 and Y10.CG Number of specific fragments= 1 total=1589 # 1ds9A.21.22 read from T0191.t2k.frag # found chain 1ds9A in template set T0191 21 :VKDKNIVIY 1ds9A 23 :TEAEKVELH Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.63659 Ang I9.CG2 and Y10.N other bump:2.41849 Ang G1.O and D4.CG Number of specific fragments= 1 total=1590 # 1pbn.21.22 read from T0191.t2k.frag # adding 1pbn to template set 1pbn:# found chain 1pbn in template set T0191 21 :VKDKNIVIY 1pbn 23 :QRPQVAVIC Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.81554 Ang V8.CG1 and Y10.OH other bump:2.39803 Ang V8.CG1 and Y10.CZ other bump:2.75272 Ang V8.CB and Y10.CE1 other bump:1.85513 Ang V8.CG1 and Y10.CE1 other bump:2.66011 Ang V8.CG1 and Y10.CD1 Number of specific fragments= 1 total=1591 # 1s01.21.22 read from T0191.t2k.frag # found chain 1s01 in template set T0191 21 :VKDKNIVIY 1s01 23 :GSNVKVAVI Fragment has 9 clashes (null) has 9 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.43765 Ang V8.CG1 and Y10.OH other bump:2.56682 Ang V8.CG2 and Y10.OH other bump:2.66704 Ang V8.CB and Y10.OH other bump:1.99908 Ang V8.CG1 and Y10.CZ other bump:2.71646 Ang V8.CB and Y10.CZ other bump:2.52294 Ang V8.CG1 and Y10.CE2 other bump:2.28313 Ang V8.CG1 and Y10.CE1 other bump:2.57384 Ang V8.CB and Y10.CE1 other bump:3.05362 Ang V2.CG1 and K5.CD Number of specific fragments= 1 total=1592 # 1jw9B.22.29 read from T0191.t2k.frag # found chain 1jw9B in template set T0191 22 :KDKNIVIYG 1jw9B 30 :KDSRVLIVG Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.45348 Ang K4.CD and I6.CG2 other bump:1.9614 Ang K4.CE and I6.CG2 other bump:1.72867 Ang K4.NZ and I6.CG2 other bump:2.79519 Ang K4.NZ and I6.CB Number of specific fragments= 1 total=1593 # 1qhhA.22.23 read from T0191.t2k.frag # found chain 1qhhA in template set T0191 22 :KDKNIVIYG 1qhhA 24 :EGPLLIMAG Fragment has 12 clashes (null) has 12 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.70745 Ang V7.CG1 and Y9.OH other bump:2.01281 Ang V7.CG2 and Y9.OH other bump:2.78544 Ang V7.CB and Y9.CZ other bump:1.39932 Ang V7.CG2 and Y9.CZ other bump:3.14206 Ang V7.CG1 and Y9.CE2 other bump:3.23085 Ang V7.CA and Y9.CE2 other bump:2.12303 Ang V7.CB and Y9.CE2 other bump:1.13125 Ang V7.CG2 and Y9.CE2 other bump:2.5279 Ang V7.CG2 and Y9.CE1 other bump:3.13707 Ang V7.CB and Y9.CD2 other bump:2.25258 Ang V7.CG2 and Y9.CD2 other bump:3.10051 Ang V7.CG2 and Y9.CG Number of specific fragments= 1 total=1594 # 1pjr.22.23 read from T0191.t2k.frag # found chain 1pjr in template set T0191 22 :KDKNIVIYG 1pjr 24 :EGPLLIMAG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1595 # 1ds9A.22.23 read from T0191.t2k.frag # found chain 1ds9A in template set T0191 22 :KDKNIVIYG 1ds9A 24 :EAEKVELHG Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.63659 Ang I8.CG2 and Y9.N Number of specific fragments= 1 total=1596 # 1iciA.22.22 read from T0191.t2k.frag # adding 1iciA to template set 1iciA:# found chain 1iciA in template set T0191 22 :KDKNIVIYG 1iciA 12 :SKYLVALTG Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.74713 Ang V7.CB and Y9.CE1 other bump:2.43309 Ang V7.CG2 and Y9.CE1 neighbor-bump: 2.67327 Ang I6.CG2 and V7.N Number of specific fragments= 1 total=1597 # 1pbn.22.23 read from T0191.t2k.frag # found chain 1pbn in template set T0191 22 :KDKNIVIYG 1pbn 24 :RPQVAVICG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1598 # 1jw9B.23.30 read from T0191.t2k.frag # found chain 1jw9B in template set T0191 23 :DKNIVIYGA 1jw9B 31 :DSRVLIVGL Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.45348 Ang K3.CD and I5.CG2 other bump:1.9614 Ang K3.CE and I5.CG2 other bump:1.72867 Ang K3.NZ and I5.CG2 other bump:2.79519 Ang K3.NZ and I5.CB Number of specific fragments= 1 total=1599 # 1qhhA.23.24 read from T0191.t2k.frag # found chain 1qhhA in template set T0191 23 :DKNIVIYGA 1qhhA 25 :GPLLIMAGA Fragment has 15 clashes (null) has 15 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.70745 Ang V6.CG1 and Y8.OH other bump:2.01281 Ang V6.CG2 and Y8.OH other bump:2.78544 Ang V6.CB and Y8.CZ other bump:1.39932 Ang V6.CG2 and Y8.CZ other bump:3.23085 Ang V6.CA and Y8.CE2 other bump:2.12303 Ang V6.CB and Y8.CE2 other bump:3.14206 Ang V6.CG1 and Y8.CE2 other bump:1.13125 Ang V6.CG2 and Y8.CE2 other bump:2.5279 Ang V6.CG2 and Y8.CE1 other bump:3.13707 Ang V6.CB and Y8.CD2 other bump:2.25258 Ang V6.CG2 and Y8.CD2 other bump:3.10051 Ang V6.CG2 and Y8.CG neighbor-bump: 2.3711 Ang D2.CB and K3.N self-bump: 2.15066 Ang D2.CB and D2.C self-bump: 1.28355 Ang D2.CA and D2.CB Number of specific fragments= 1 total=1600 # 1pjr.23.24 read from T0191.t2k.frag # found chain 1pjr in template set T0191 23 :DKNIVIYGA 1pjr 25 :GPLLIMAGA Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.37834 Ang D2.CB and K3.N self-bump: 2.1465 Ang D2.CB and D2.C self-bump: 1.2747 Ang D2.CA and D2.CB Number of specific fragments= 1 total=1601 # 1ds9A.23.24 read from T0191.t2k.frag # found chain 1ds9A in template set T0191 23 :DKNIVIYGA 1ds9A 25 :AEKVELHGM Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.63659 Ang I7.CG2 and Y8.N Number of specific fragments= 1 total=1602 # 1iciA.23.23 read from T0191.t2k.frag # found chain 1iciA in template set T0191 23 :DKNIVIYGA 1iciA 13 :KYLVALTGA Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.74713 Ang V6.CB and Y8.CE1 other bump:2.43309 Ang V6.CG2 and Y8.CE1 neighbor-bump: 2.67327 Ang I5.CG2 and V6.N Number of specific fragments= 1 total=1603 # 1s01.23.24 read from T0191.t2k.frag # found chain 1s01 in template set T0191 23 :DKNIVIYGA 1s01 25 :NVKVAVIDS Fragment has 8 clashes (null) has 8 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.66704 Ang V6.CB and Y8.OH other bump:2.43765 Ang V6.CG1 and Y8.OH other bump:2.56682 Ang V6.CG2 and Y8.OH other bump:2.71646 Ang V6.CB and Y8.CZ other bump:1.99908 Ang V6.CG1 and Y8.CZ other bump:2.52294 Ang V6.CG1 and Y8.CE2 other bump:2.57383 Ang V6.CB and Y8.CE1 other bump:2.28313 Ang V6.CG1 and Y8.CE1 Number of specific fragments= 1 total=1604 # 1jw9B.24.31 read from T0191.t2k.frag # found chain 1jw9B in template set T0191 24 :KNIVIYGAG 1jw9B 32 :SRVLIVGLG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1605 # 1qhhA.24.25 read from T0191.t2k.frag # found chain 1qhhA in template set T0191 24 :KNIVIYGAG 1qhhA 26 :PLLIMAGAG Fragment has 12 clashes (null) has 12 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.70745 Ang V5.CG1 and Y7.OH other bump:2.01281 Ang V5.CG2 and Y7.OH other bump:2.78544 Ang V5.CB and Y7.CZ other bump:1.39932 Ang V5.CG2 and Y7.CZ other bump:3.23085 Ang V5.CA and Y7.CE2 other bump:2.12303 Ang V5.CB and Y7.CE2 other bump:3.14206 Ang V5.CG1 and Y7.CE2 other bump:1.13125 Ang V5.CG2 and Y7.CE2 other bump:2.5279 Ang V5.CG2 and Y7.CE1 other bump:3.13707 Ang V5.CB and Y7.CD2 other bump:2.25258 Ang V5.CG2 and Y7.CD2 other bump:3.10051 Ang V5.CG2 and Y7.CG Number of specific fragments= 1 total=1606 # 1pjr.24.25 read from T0191.t2k.frag # found chain 1pjr in template set T0191 24 :KNIVIYGAG 1pjr 26 :PLLIMAGAG Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.3279 Ang Y7.CE1 and G11.CA other bump:2.48119 Ang Y7.CZ and G11.CA other bump:2.12442 Ang Y7.OH and G11.CA other bump:2.56099 Ang Y7.CZ and G11.N other bump:2.0882 Ang Y7.OH and G11.N Number of specific fragments= 1 total=1607 # 1iciA.24.24 read from T0191.t2k.frag # found chain 1iciA in template set T0191 24 :KNIVIYGAG 1iciA 14 :YLVALTGAG Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.43309 Ang V5.CG2 and Y7.CE1 other bump:2.74713 Ang V5.CB and Y7.CE1 neighbor-bump: 2.67327 Ang I4.CG2 and V5.N neighbor-bump: 2.33179 Ang G1.O and K2.CG Number of specific fragments= 1 total=1608 # 1s01.24.25 read from T0191.t2k.frag # found chain 1s01 in template set T0191 24 :KNIVIYGAG 1s01 26 :VKVAVIDSG Fragment has 8 clashes (null) has 8 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.66703 Ang V5.CB and Y7.OH other bump:2.43765 Ang V5.CG1 and Y7.OH other bump:2.56681 Ang V5.CG2 and Y7.OH other bump:2.71645 Ang V5.CB and Y7.CZ other bump:1.99909 Ang V5.CG1 and Y7.CZ other bump:2.52294 Ang V5.CG1 and Y7.CE2 other bump:2.57383 Ang V5.CB and Y7.CE1 other bump:2.28314 Ang V5.CG1 and Y7.CE1 Number of specific fragments= 1 total=1609 # 1ea7A.24.27 read from T0191.t2k.frag # adding 1ea7A to template set 1ea7A:Skipped atom 41, because occupancy 0.46 <= existing 0.540001 Skipped atom 278, because occupancy 0.24 <= existing 0.760001 Skipped atom 322, because occupancy 0.35 <= existing 0.650001 Skipped atom 326, because occupancy 0.35 <= existing 0.650001 Skipped atom 328, because occupancy 0.35 <= existing 0.650001 Skipped atom 376, because occupancy 0.43 <= existing 0.570001 Skipped atom 523, because occupancy 0.49 <= existing 0.510001 Skipped atom 525, because occupancy 0.49 <= existing 0.510001 Skipped atom 546, because occupancy 0.5 <= existing 0.500001 Skipped atom 548, because occupancy 0.5 <= existing 0.500001 Skipped atom 550, because occupancy 0.5 <= existing 0.500001 Skipped atom 552, because occupancy 0.5 <= existing 0.500001 Skipped atom 554, because occupancy 0.5 <= existing 0.500001 Skipped atom 556, because occupancy 0.5 <= existing 0.500001 Skipped atom 558, because occupancy 0.5 <= existing 0.500001 Skipped atom 596, because occupancy 0.5 <= existing 0.500001 Skipped atom 701, because occupancy 0.23 <= existing 0.770001 Skipped atom 703, because occupancy 0.23 <= existing 0.770001 Skipped atom 705, because occupancy 0.23 <= existing 0.770001 Skipped atom 707, because occupancy 0.23 <= existing 0.770001 Skipped atom 709, because occupancy 0.23 <= existing 0.770001 Skipped atom 748, because occupancy 0.36 <= existing 0.640001 Skipped atom 927, because occupancy 0.25 <= existing 0.750001 Skipped atom 934, because occupancy 0.38 <= existing 0.620001 Skipped atom 938, because occupancy 0.38 <= existing 0.620001 Skipped atom 940, because occupancy 0.38 <= existing 0.620001 Skipped atom 942, because occupancy 0.38 <= existing 0.620001 Skipped atom 1232, because occupancy 0.44 <= existing 0.560001 Skipped atom 1234, because occupancy 0.44 <= existing 0.560001 Skipped atom 1236, because occupancy 0.44 <= existing 0.560001 Skipped atom 1341, because occupancy 0.23 <= existing 0.770001 Skipped atom 1343, because occupancy 0.23 <= existing 0.770001 Skipped atom 1345, because occupancy 0.23 <= existing 0.770001 Skipped atom 1347, because occupancy 0.23 <= existing 0.770001 Skipped atom 1534, because occupancy 0.42 <= existing 0.580001 Skipped atom 1815, because occupancy 0.44 <= existing 0.560001 Skipped atom 1834, because occupancy 0.46 <= existing 0.540001 Skipped atom 1968, because occupancy 0.49 <= existing 0.510001 Skipped atom 2075, because occupancy 0.41 <= existing 0.590001 Skipped atom 2086, because occupancy 0.44 <= existing 0.560001 Skipped atom 2198, because occupancy 0.49 <= existing 0.510001 Skipped atom 2200, because occupancy 0.49 <= existing 0.510001 Skipped atom 2202, because occupancy 0.49 <= existing 0.510001 Skipped atom 2350, because occupancy 0.49 <= existing 0.510001 Skipped atom 2388, because occupancy 0.47 <= existing 0.530001 Skipped atom 2717, because occupancy 0.46 <= existing 0.540001 Skipped atom 2719, because occupancy 0.46 <= existing 0.540001 Skipped atom 2721, because occupancy 0.46 <= existing 0.540001 Skipped atom 2960, because occupancy 0.32 <= existing 0.680001 Skipped atom 3155, because occupancy 0.46 <= existing 0.540001 Skipped atom 3221, because occupancy 0.49 <= existing 0.510001 Skipped atom 3330, because occupancy 0.49 <= existing 0.510001 Skipped atom 3332, because occupancy 0.49 <= existing 0.510001 Skipped atom 3334, because occupancy 0.49 <= existing 0.510001 Skipped atom 3336, because occupancy 0.49 <= existing 0.510001 Skipped atom 3338, because occupancy 0.49 <= existing 0.510001 Skipped atom 3340, because occupancy 0.49 <= existing 0.510001 Skipped atom 3342, because occupancy 0.49 <= existing 0.510001 Skipped atom 3344, because occupancy 0.49 <= existing 0.510001 Skipped atom 3351, because occupancy 0.49 <= existing 0.510001 Skipped atom 3353, because occupancy 0.49 <= existing 0.510001 Skipped atom 3355, because occupancy 0.49 <= existing 0.510001 Skipped atom 3357, because occupancy 0.49 <= existing 0.510001 Skipped atom 3363, because occupancy 0.49 <= existing 0.510001 Skipped atom 3569, because occupancy 0.49 <= existing 0.510001 Skipped atom 3702, because occupancy 0.48 <= existing 0.520001 Skipped atom 3704, because occupancy 0.48 <= existing 0.520001 Skipped atom 3706, because occupancy 0.48 <= existing 0.520001 Skipped atom 3873, because occupancy 0.46 <= existing 0.540001 Skipped atom 3883, because occupancy 0.41 <= existing 0.590001 Skipped atom 3885, because occupancy 0.41 <= existing 0.590001 Skipped atom 3887, because occupancy 0.41 <= existing 0.590001 Skipped atom 3889, because occupancy 0.41 <= existing 0.590001 Skipped atom 3951, because occupancy 0.05 <= existing 0.950001 Skipped atom 3953, because occupancy 0.05 <= existing 0.950001 Skipped atom 3955, because occupancy 0.05 <= existing 0.950001 Skipped atom 3957, because occupancy 0.05 <= existing 0.950001 Skipped atom 3959, because occupancy 0.05 <= existing 0.950001 Skipped atom 3961, because occupancy 0.05 <= existing 0.950001 Skipped atom 4011, because occupancy 0.37 <= existing 0.630001 Skipped atom 4201, because occupancy 0.48 <= existing 0.520001 Skipped atom 4203, because occupancy 0.48 <= existing 0.520001 Skipped atom 4205, because occupancy 0.48 <= existing 0.520001 Skipped atom 4207, because occupancy 0.48 <= existing 0.520001 Skipped atom 4209, because occupancy 0.48 <= existing 0.520001 Skipped atom 4211, because occupancy 0.48 <= existing 0.520001 Skipped atom 4213, because occupancy 0.48 <= existing 0.520001 Skipped atom 4215, because occupancy 0.48 <= existing 0.520001 Skipped atom 4317, because occupancy 0.42 <= existing 0.580001 Skipped atom 4319, because occupancy 0.42 <= existing 0.580001 Skipped atom 4321, because occupancy 0.42 <= existing 0.580001 Skipped atom 4323, because occupancy 0.42 <= existing 0.580001 Skipped atom 4325, because occupancy 0.42 <= existing 0.580001 # found chain 1ea7A in template set T0191 24 :KNIVIYGAG 1ea7A 28 :INIAVLDTG Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.69779 Ang V5.CG1 and Y7.OH other bump:2.52547 Ang V5.CG1 and Y7.CZ other bump:2.90739 Ang V5.CB and Y7.CE1 other bump:2.19885 Ang V5.CG1 and Y7.CE1 Number of specific fragments= 1 total=1610 # 1jw9B.25.32 read from T0191.t2k.frag # found chain 1jw9B in template set T0191 25 :NIVIYGAGG 1jw9B 33 :RVLIVGLGG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1611 # 1qhhA.25.26 read from T0191.t2k.frag # found chain 1qhhA in template set T0191 25 :NIVIYGAGG 1qhhA 27 :LLIMAGAGS Fragment has 12 clashes (null) has 12 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.70745 Ang V4.CG1 and Y6.OH other bump:2.01281 Ang V4.CG2 and Y6.OH other bump:2.78544 Ang V4.CB and Y6.CZ other bump:1.39932 Ang V4.CG2 and Y6.CZ other bump:3.23085 Ang V4.CA and Y6.CE2 other bump:3.14206 Ang V4.CG1 and Y6.CE2 other bump:2.12303 Ang V4.CB and Y6.CE2 other bump:1.13125 Ang V4.CG2 and Y6.CE2 other bump:2.5279 Ang V4.CG2 and Y6.CE1 other bump:3.13707 Ang V4.CB and Y6.CD2 other bump:2.25258 Ang V4.CG2 and Y6.CD2 other bump:3.10051 Ang V4.CG2 and Y6.CG Number of specific fragments= 1 total=1612 # 1pjr.25.26 read from T0191.t2k.frag # found chain 1pjr in template set T0191 25 :NIVIYGAGG 1pjr 27 :LLIMAGAGS Fragment has 14 clashes (null) has 14 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.99671 Ang Y6.CZ and G11.CA other bump:2.33487 Ang Y6.OH and G11.CA other bump:2.72755 Ang Y6.CE1 and G11.N other bump:3.07202 Ang Y6.CE2 and G11.N other bump:2.01621 Ang Y6.CZ and G11.N other bump:1.0183 Ang Y6.OH and G11.N other bump:2.10472 Ang Y6.CE1 and G10.C other bump:2.12223 Ang Y6.CZ and G10.C other bump:1.62553 Ang Y6.OH and G10.C other bump:2.3279 Ang Y6.CE1 and G10.CA other bump:2.48119 Ang Y6.CZ and G10.CA other bump:2.12442 Ang Y6.OH and G10.CA other bump:2.56099 Ang Y6.CZ and G10.N other bump:2.0882 Ang Y6.OH and G10.N Number of specific fragments= 1 total=1613 # 1iciA.25.25 read from T0191.t2k.frag # found chain 1iciA in template set T0191 25 :NIVIYGAGG 1iciA 15 :LVALTGAGV Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.74713 Ang V4.CB and Y6.CE1 other bump:2.43309 Ang V4.CG2 and Y6.CE1 neighbor-bump: 2.67327 Ang I3.CG2 and V4.N Number of specific fragments= 1 total=1614 # 1pbn.25.26 read from T0191.t2k.frag # found chain 1pbn in template set T0191 25 :NIVIYGAGG 1pbn 27 :VAVICGSGL Fragment has 22 clashes (null) has 22 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:3.01465 Ang Y6.CE2 and G10.C other bump:2.27426 Ang Y6.CE2 and G10.CA other bump:2.44983 Ang Y6.CZ and G10.CA other bump:2.48176 Ang Y6.OH and G10.CA other bump:2.90473 Ang Y6.CD2 and G10.N other bump:1.60727 Ang Y6.CE2 and G10.N other bump:2.00999 Ang Y6.CZ and G10.N other bump:1.99609 Ang Y6.OH and G10.N other bump:2.69001 Ang Y6.CE2 and G9.C other bump:2.7031 Ang Y6.CZ and G9.C other bump:2.02277 Ang Y6.OH and G9.C other bump:3.16332 Ang Y6.CZ and G9.N other bump:2.89771 Ang Y6.CE1 and A8.C other bump:2.80094 Ang Y6.CE2 and A8.C other bump:2.30732 Ang Y6.CZ and A8.C other bump:2.32619 Ang Y6.OH and A8.C other bump:2.52207 Ang Y6.CD2 and A8.O other bump:2.71439 Ang Y6.CD1 and A8.O other bump:1.97557 Ang Y6.CE1 and A8.O other bump:1.67464 Ang Y6.CE2 and A8.O other bump:1.25087 Ang Y6.CZ and A8.O other bump:1.91814 Ang Y6.OH and A8.O Number of specific fragments= 1 total=1615 # 1jx2B.25.25 read from T0191.t2k.frag # adding 1jx2B to template set 1jx2B:# found chain 1jx2B in template set T0191 25 :NIVIYGAGG 1jx2B 27 :QIVVVGSQS Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1616 # 1jw9B.26.33 read from T0191.t2k.frag # found chain 1jw9B in template set T0191 26 :IVIYGAGGA 1jw9B 34 :VLIVGLGGL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1617 # 1qhhA.26.27 read from T0191.t2k.frag # found chain 1qhhA in template set T0191 26 :IVIYGAGGA 1qhhA 28 :LIMAGAGSG Fragment has 12 clashes (null) has 12 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.70745 Ang V3.CG1 and Y5.OH other bump:2.01281 Ang V3.CG2 and Y5.OH other bump:2.78544 Ang V3.CB and Y5.CZ other bump:1.39932 Ang V3.CG2 and Y5.CZ other bump:2.12303 Ang V3.CB and Y5.CE2 other bump:3.14206 Ang V3.CG1 and Y5.CE2 other bump:3.23085 Ang V3.CA and Y5.CE2 other bump:1.13125 Ang V3.CG2 and Y5.CE2 other bump:2.5279 Ang V3.CG2 and Y5.CE1 other bump:3.13707 Ang V3.CB and Y5.CD2 other bump:2.25258 Ang V3.CG2 and Y5.CD2 other bump:3.10051 Ang V3.CG2 and Y5.CG Number of specific fragments= 1 total=1618 # 1pjr.26.27 read from T0191.t2k.frag # found chain 1pjr in template set T0191 26 :IVIYGAGGA 1pjr 28 :LIMAGAGSG Fragment has 17 clashes (null) has 17 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.54833 Ang Y5.CE2 and G11.N other bump:2.70969 Ang Y5.CZ and G11.N other bump:3.10383 Ang Y5.CZ and A10.C other bump:2.33487 Ang Y5.OH and A10.CA other bump:2.99671 Ang Y5.CZ and A10.CA other bump:2.72755 Ang Y5.CE1 and A10.N other bump:1.0183 Ang Y5.OH and A10.N other bump:3.07202 Ang Y5.CE2 and A10.N other bump:2.01621 Ang Y5.CZ and A10.N other bump:2.10472 Ang Y5.CE1 and G9.C other bump:1.62553 Ang Y5.OH and G9.C other bump:2.12223 Ang Y5.CZ and G9.C other bump:2.3279 Ang Y5.CE1 and G9.CA other bump:2.12442 Ang Y5.OH and G9.CA other bump:2.48119 Ang Y5.CZ and G9.CA other bump:2.0882 Ang Y5.OH and G9.N other bump:2.56099 Ang Y5.CZ and G9.N Number of specific fragments= 1 total=1619 # 1iciA.26.26 read from T0191.t2k.frag # found chain 1iciA in template set T0191 26 :IVIYGAGGA 1iciA 16 :VALTGAGVS Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.74713 Ang V3.CB and Y5.CE1 other bump:2.43309 Ang V3.CG2 and Y5.CE1 neighbor-bump: 2.67326 Ang I2.CG2 and V3.N Number of specific fragments= 1 total=1620 # 1eonA.26.29 read from T0191.t2k.frag # adding 1eonA to template set 1eonA:Skipped atom 167, because occupancy 0.5 <= existing 0.500001 Skipped atom 169, because occupancy 0.5 <= existing 0.500001 Skipped atom 171, because occupancy 0.5 <= existing 0.500001 Skipped atom 173, because occupancy 0.5 <= existing 0.500001 Skipped atom 366, because occupancy 0.5 <= existing 0.500001 Skipped atom 368, because occupancy 0.5 <= existing 0.500001 Skipped atom 370, because occupancy 0.5 <= existing 0.500001 Skipped atom 372, because occupancy 0.5 <= existing 0.500001 Skipped atom 374, because occupancy 0.5 <= existing 0.500001 Skipped atom 376, because occupancy 0.5 <= existing 0.500001 Skipped atom 378, because occupancy 0.5 <= existing 0.500001 # found chain 1eonA in template set T0191 26 :IVIYGAGGA 1eonA 30 :IYPLGSDTK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1621 # 1gpeA.26.26 read from T0191.t2k.frag # adding 1gpeA to template set 1gpeA:# found chain 1gpeA in template set T0191 26 :IVIYGAGGA 1gpeA 27 :YIIAGGGLT Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1622 # 1jw9B.27.34 read from T0191.t2k.frag # found chain 1jw9B in template set T0191 27 :VIYGAGGAA 1jw9B 35 :LIVGLGGLG Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.85388 Ang G5.O and A10.CB other bump:2.83436 Ang G5.C and A10.CB other bump:2.87286 Ang A6.CA and A10.CB Number of specific fragments= 1 total=1623 # 1eonA.27.30 read from T0191.t2k.frag # found chain 1eonA in template set T0191 27 :VIYGAGGAA 1eonA 31 :YPLGSDTKV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1624 # 1gpeA.27.27 read from T0191.t2k.frag # found chain 1gpeA in template set T0191 27 :VIYGAGGAA 1gpeA 28 :IIAGGGLTG Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.94442 Ang G5.O and A10.CB other bump:3.05705 Ang G5.C and A10.CB Number of specific fragments= 1 total=1625 # 1qhhA.27.28 read from T0191.t2k.frag # found chain 1qhhA in template set T0191 27 :VIYGAGGAA 1qhhA 29 :IMAGAGSGK Fragment has 13 clashes (null) has 13 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.5355 Ang G8.C and A9.CB other bump:2.70745 Ang V2.CG1 and Y4.OH other bump:2.01281 Ang V2.CG2 and Y4.OH other bump:2.78544 Ang V2.CB and Y4.CZ other bump:1.39932 Ang V2.CG2 and Y4.CZ other bump:3.23085 Ang V2.CA and Y4.CE2 other bump:3.14206 Ang V2.CG1 and Y4.CE2 other bump:2.12303 Ang V2.CB and Y4.CE2 other bump:1.13125 Ang V2.CG2 and Y4.CE2 other bump:2.5279 Ang V2.CG2 and Y4.CE1 other bump:3.13707 Ang V2.CB and Y4.CD2 other bump:2.25258 Ang V2.CG2 and Y4.CD2 other bump:3.10051 Ang V2.CG2 and Y4.CG Number of specific fragments= 1 total=1626 # 1pjr.27.28 read from T0191.t2k.frag # found chain 1pjr in template set T0191 27 :VIYGAGGAA 1pjr 29 :IMAGAGSGK Fragment has 21 clashes (null) has 21 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.49806 Ang Y4.CD2 and A10.CB other bump:3.02492 Ang Y4.CE2 and A10.CB other bump:2.54833 Ang Y4.CE2 and A10.N other bump:2.70969 Ang Y4.CZ and A10.N other bump:3.10383 Ang Y4.CZ and A9.C neighbor-bump: 2.31518 Ang G8.O and A9.CB neighbor-bump: 2.51573 Ang G8.C and A9.CB other bump:2.33487 Ang Y4.OH and A9.CA other bump:2.99671 Ang Y4.CZ and A9.CA other bump:2.72755 Ang Y4.CE1 and A9.N other bump:1.0183 Ang Y4.OH and A9.N other bump:3.07202 Ang Y4.CE2 and A9.N other bump:2.01621 Ang Y4.CZ and A9.N other bump:2.10472 Ang Y4.CE1 and G8.C other bump:1.62553 Ang Y4.OH and G8.C other bump:2.12223 Ang Y4.CZ and G8.C other bump:2.3279 Ang Y4.CE1 and G8.CA other bump:2.12442 Ang Y4.OH and G8.CA other bump:2.48119 Ang Y4.CZ and G8.CA other bump:2.0882 Ang Y4.OH and G8.N other bump:2.56099 Ang Y4.CZ and G8.N Number of specific fragments= 1 total=1627 # 1kc6A.27.27 read from T0191.t2k.frag # adding 1kc6A to template set 1kc6A:# found chain 1kc6A in template set T0191 31 :AGGAA 1kc6A 33 :AGEPF Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 7 residues Number of specific fragments= 1 total=1628 # 1jw9B.28.35 read from T0191.t2k.frag # found chain 1jw9B in template set T0191 28 :IYGAGGAAR 1jw9B 36 :IVGLGGLGC Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.85388 Ang G4.O and A9.CB other bump:2.83436 Ang G4.C and A9.CB other bump:2.87286 Ang A5.CA and A9.CB Number of specific fragments= 1 total=1629 # 1eonA.28.31 read from T0191.t2k.frag # found chain 1eonA in template set T0191 28 :IYGAGGAAR 1eonA 32 :PLGSDTKVL Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.69615 Ang G4.C and R10.NH1 other bump:1.56768 Ang G4.O and R10.NH1 other bump:3.25781 Ang G4.C and R10.CZ other bump:2.17751 Ang G4.O and R10.CZ Number of specific fragments= 1 total=1630 # 1gpeA.28.28 read from T0191.t2k.frag # found chain 1gpeA in template set T0191 28 :IYGAGGAAR 1gpeA 29 :IAGGGLTGL Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.76586 Ang A5.O and R10.NH1 other bump:2.97692 Ang A5.C and R10.NH1 other bump:2.42414 Ang A5.O and R10.CZ other bump:1.94442 Ang G4.O and A9.CB other bump:3.05705 Ang G4.C and A9.CB Number of specific fragments= 1 total=1631 # 1kc6A.28.28 read from T0191.t2k.frag # found chain 1kc6A in template set T0191 31 :AGGAAR 1kc6A 33 :AGEPFE Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 8 residues Number of specific fragments= 1 total=1632 # 1qhhA.28.29 read from T0191.t2k.frag # found chain 1qhhA in template set T0191 28 :IYGAGGAAR 1qhhA 30 :MAGAGSGKT Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.5355 Ang G7.C and A8.CB Number of specific fragments= 1 total=1633 # 1pjr.28.29 read from T0191.t2k.frag # found chain 1pjr in template set T0191 28 :IYGAGGAAR 1pjr 30 :MAGAGSGKT Fragment has 21 clashes (null) has 21 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.49806 Ang Y3.CD2 and A9.CB other bump:3.02492 Ang Y3.CE2 and A9.CB other bump:2.54833 Ang Y3.CE2 and A9.N other bump:2.70969 Ang Y3.CZ and A9.N other bump:3.10383 Ang Y3.CZ and A8.C neighbor-bump: 2.31518 Ang G7.O and A8.CB neighbor-bump: 2.51573 Ang G7.C and A8.CB other bump:2.99671 Ang Y3.CZ and A8.CA other bump:2.33488 Ang Y3.OH and A8.CA other bump:2.72755 Ang Y3.CE1 and A8.N other bump:3.07204 Ang Y3.CE2 and A8.N other bump:2.01621 Ang Y3.CZ and A8.N other bump:1.01832 Ang Y3.OH and A8.N other bump:2.10473 Ang Y3.CE1 and G7.C other bump:2.12224 Ang Y3.CZ and G7.C other bump:1.62556 Ang Y3.OH and G7.C other bump:2.3279 Ang Y3.CE1 and G7.CA other bump:2.4812 Ang Y3.CZ and G7.CA other bump:2.12444 Ang Y3.OH and G7.CA other bump:2.56099 Ang Y3.CZ and G7.N other bump:2.0882 Ang Y3.OH and G7.N Number of specific fragments= 1 total=1634 # 1jw9B.29.36 read from T0191.t2k.frag # found chain 1jw9B in template set T0191 29 :YGAGGAARA 1jw9B 37 :VGLGGLGCA Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.83436 Ang G3.C and A8.CB other bump:1.85388 Ang G3.O and A8.CB other bump:2.87286 Ang A4.CA and A8.CB Number of specific fragments= 1 total=1635 # 1eonA.29.32 read from T0191.t2k.frag # found chain 1eonA in template set T0191 29 :YGAGGAARA 1eonA 33 :LGSDTKVLS Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.69614 Ang G3.C and R9.NH1 other bump:1.56768 Ang G3.O and R9.NH1 other bump:3.2578 Ang G3.C and R9.CZ other bump:2.1775 Ang G3.O and R9.CZ Number of specific fragments= 1 total=1636 # 1gpeA.29.29 read from T0191.t2k.frag # found chain 1gpeA in template set T0191 29 :YGAGGAARA 1gpeA 30 :AGGGLTGLT Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.76586 Ang A4.O and R9.NH1 other bump:2.97692 Ang A4.C and R9.NH1 other bump:2.42414 Ang A4.O and R9.CZ other bump:1.94442 Ang G3.O and A8.CB other bump:3.05705 Ang G3.C and A8.CB Number of specific fragments= 1 total=1637 # 1kc6A.29.29 read from T0191.t2k.frag # found chain 1kc6A in template set T0191 31 :AGGAARA 1kc6A 33 :AGEPFEK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 9 residues Number of specific fragments= 1 total=1638 # 1ej0A.29.30 read from T0191.t2k.frag # found chain 1ej0A in training set T0191 29 :YGAGGAARA 1ej0A 60 :AAPGGWSQY Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1639 # 1qhhA.29.30 read from T0191.t2k.frag # found chain 1qhhA in template set T0191 29 :YGAGGAARA 1qhhA 31 :AGAGSGKTR Fragment has 23 clashes (null) has 23 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.94172 Ang Y2.CD2 and A8.CB other bump:2.84776 Ang Y2.CE2 and A8.N neighbor-bump: 2.5355 Ang G6.C and A7.CB other bump:3.1578 Ang Y2.CZ and A7.CA other bump:2.81732 Ang Y2.OH and A7.CA other bump:2.76858 Ang Y2.CE1 and A7.N other bump:2.77519 Ang Y2.CE2 and A7.N other bump:1.95893 Ang Y2.CZ and A7.N other bump:1.37415 Ang Y2.OH and A7.N other bump:2.03679 Ang Y2.CE1 and G6.C other bump:3.17191 Ang Y2.CE2 and G6.C other bump:1.90636 Ang Y2.CZ and G6.C other bump:1.53622 Ang Y2.OH and G6.C other bump:2.39646 Ang Y2.CE1 and G6.O other bump:2.80734 Ang Y2.CZ and G6.O other bump:2.00926 Ang Y2.CE1 and G6.CA other bump:2.00453 Ang Y2.CZ and G6.CA other bump:1.58542 Ang Y2.OH and G6.CA other bump:2.73917 Ang Y2.CE1 and G6.N other bump:3.03859 Ang Y2.CE2 and G6.N other bump:2.10407 Ang Y2.CZ and G6.N other bump:1.49205 Ang Y2.OH and G6.N other bump:2.36974 Ang Y2.OH and G5.C Number of specific fragments= 1 total=1640 # 1jw9B.30.37 read from T0191.t2k.frag # found chain 1jw9B in template set T0191 30 :GAGGAARAV 1jw9B 38 :GLGGLGCAA Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.85388 Ang G2.O and A7.CB other bump:2.83436 Ang G2.C and A7.CB other bump:2.87286 Ang A3.CA and A7.CB Number of specific fragments= 1 total=1641 # 1kc6A.30.30 read from T0191.t2k.frag # found chain 1kc6A in template set T0191 31 :AGGAARAV 1kc6A 33 :AGEPFEKL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 10 residues Number of specific fragments= 1 total=1642 # 1gpeA.30.30 read from T0191.t2k.frag # found chain 1gpeA in template set T0191 30 :GAGGAARAV 1gpeA 31 :GGGLTGLTV Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.97692 Ang A3.C and R8.NH1 other bump:1.76586 Ang A3.O and R8.NH1 other bump:2.42414 Ang A3.O and R8.CZ other bump:1.94442 Ang G2.O and A7.CB other bump:3.05705 Ang G2.C and A7.CB Number of specific fragments= 1 total=1643 # 1eonA.30.33 read from T0191.t2k.frag # found chain 1eonA in template set T0191 30 :GAGGAARAV 1eonA 34 :GSDTKVLST Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.56768 Ang G2.O and R8.NH1 other bump:2.69614 Ang G2.C and R8.NH1 other bump:2.1775 Ang G2.O and R8.CZ other bump:3.2578 Ang G2.C and R8.CZ Number of specific fragments= 1 total=1644 # 1ej0A.30.31 read from T0191.t2k.frag # found chain 1ej0A in training set T0191 30 :GAGGAARAV 1ej0A 61 :APGGWSQYV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1645 # 1bia.30.30 read from T0191.t2k.frag # found chain 1bia in template set T0191 30 :GAGGAARAV 1bia 31 :MSRAAINKH Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:3.2553 Ang A6.C and A9.N Number of specific fragments= 1 total=1646 # 1jw9B.31.38 read from T0191.t2k.frag # found chain 1jw9B in template set T0191 31 :AGGAARAVA 1jw9B 39 :LGGLGCAAS Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.87286 Ang A2.CA and A6.CB other bump:1.85388 Ang G1.O and A6.CB other bump:2.83436 Ang G1.C and A6.CB Number of specific fragments= 1 total=1647 # 1ej0A.31.32 read from T0191.t2k.frag # found chain 1ej0A in training set T0191 31 :AGGAARAVA 1ej0A 62 :PGGWSQYVV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1648 # 1kc6A.31.31 read from T0191.t2k.frag # found chain 1kc6A in template set T0191 31 :AGGAARAVA 1kc6A 33 :AGEPFEKLV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1649 # 1bia.31.31 read from T0191.t2k.frag # found chain 1bia in template set T0191 31 :AGGAARAVA 1bia 32 :SRAAINKHI Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:3.2553 Ang A5.C and A8.N Number of specific fragments= 1 total=1650 # 1gpeA.31.31 read from T0191.t2k.frag # found chain 1gpeA in template set T0191 31 :AGGAARAVA 1gpeA 32 :GGLTGLTVA Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.97692 Ang A2.C and R7.NH1 other bump:1.76586 Ang A2.O and R7.NH1 other bump:2.42414 Ang A2.O and R7.CZ other bump:1.94442 Ang G1.O and A6.CB other bump:3.05705 Ang G1.C and A6.CB Number of specific fragments= 1 total=1651 # 1eonA.31.34 read from T0191.t2k.frag # found chain 1eonA in template set T0191 31 :AGGAARAVA 1eonA 35 :SDTKVLSTI Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.56768 Ang G1.O and R7.NH1 other bump:2.69614 Ang G1.C and R7.NH1 other bump:2.1775 Ang G1.O and R7.CZ other bump:3.2578 Ang G1.C and R7.CZ Number of specific fragments= 1 total=1652 # 1jw9B.32.39 read from T0191.t2k.frag # found chain 1jw9B in template set T0191 32 :GGAARAVAF 1jw9B 40 :GGLGCAASQ Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1653 # 1ej0A.32.33 read from T0191.t2k.frag # found chain 1ej0A in training set T0191 32 :GGAARAVAF 1ej0A 63 :GGWSQYVVT Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.95942 Ang R6.CG and F10.CE2 other bump:2.89422 Ang R6.C and F10.CE2 other bump:2.16307 Ang R6.O and F10.CE2 other bump:3.14305 Ang R6.C and F10.CD2 other bump:2.14428 Ang R6.O and F10.CD2 Number of specific fragments= 1 total=1654 # 1kc6A.32.32 read from T0191.t2k.frag # found chain 1kc6A in template set T0191 32 :GGAARAVAF 1kc6A 34 :GEPFEKLVY Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1655 # 1bia.32.32 read from T0191.t2k.frag # found chain 1bia in template set T0191 32 :GGAARAVAF 1bia 33 :RAAINKHIQ Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:3.2553 Ang A4.C and A7.N Number of specific fragments= 1 total=1656 # 1gpeA.32.32 read from T0191.t2k.frag # found chain 1gpeA in template set T0191 32 :GGAARAVAF 1gpeA 33 :GLTGLTVAA Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.97692 Ang G1.C and R6.NH1 other bump:1.76586 Ang G1.O and R6.NH1 other bump:2.42414 Ang G1.O and R6.CZ Number of specific fragments= 1 total=1657 # 1hruA.32.38 read from T0191.t2k.frag # adding 1hruA to template set 1hruA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # found chain 1hruA in template set T0191 32 :GGAARAVAF 1hruA 39 :SETAVMRLL Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.90423 Ang R6.NH2 and F10.CZ other bump:2.68969 Ang R6.NH2 and F10.CE2 Number of specific fragments= 1 total=1658 # 1jw9B.33.40 read from T0191.t2k.frag # found chain 1jw9B in template set T0191 33 :GAARAVAFE 1jw9B 41 :GLGCAASQY Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.5622 Ang F9.CD2 and E10.OE2 neighbor-bump: 2.64089 Ang F9.CE2 and E10.OE2 Number of specific fragments= 1 total=1659 # 1ej0A.33.34 read from T0191.t2k.frag # found chain 1ej0A in training set T0191 33 :GAARAVAFE 1ej0A 64 :GWSQYVVTQ Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1660 # 1kc6A.33.33 read from T0191.t2k.frag # found chain 1kc6A in template set T0191 33 :GAARAVAFE 1kc6A 35 :EPFEKLVYK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1661 # 1bia.33.33 read from T0191.t2k.frag # found chain 1bia in template set T0191 33 :GAARAVAFE 1bia 34 :AAINKHIQT Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:3.2553 Ang A3.C and A6.N Number of specific fragments= 1 total=1662 # 1gpeA.33.33 read from T0191.t2k.frag # found chain 1gpeA in template set T0191 33 :GAARAVAFE 1gpeA 34 :LTGLTVAAK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1663 # 1bib.33.33 read from T0191.t2k.frag # found chain 1bib in template set T0191 33 :GAARAVAFE 1bib 34 :AAINKHIQT Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.15373 Ang A4.O and R5.C neighbor-bump: 2.57278 Ang A4.C and R5.C Number of specific fragments= 1 total=1664 # 1jw9B.34.41 read from T0191.t2k.frag # found chain 1jw9B in template set T0191 34 :AARAVAFEL 1jw9B 42 :LGCAASQYL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1665 # 1ej0A.34.35 read from T0191.t2k.frag # found chain 1ej0A in training set T0191 34 :AARAVAFEL 1ej0A 65 :WSQYVVTQI Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1666 # 1bia.34.34 read from T0191.t2k.frag # found chain 1bia in template set T0191 34 :AARAVAFEL 1bia 35 :AINKHIQTL Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:3.2553 Ang A2.C and A5.N Number of specific fragments= 1 total=1667 # 1kc6A.34.34 read from T0191.t2k.frag # found chain 1kc6A in template set T0191 34 :AARAVAFEL 1kc6A 36 :PFEKLVYKF Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1668 # 1gpeA.34.34 read from T0191.t2k.frag # found chain 1gpeA in template set T0191 34 :AARAVAFEL 1gpeA 35 :TGLTVAAKL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1669 # 1hruA.34.40 read from T0191.t2k.frag # found chain 1hruA in template set T0191 34 :AARAVAFEL 1hruA 41 :TAVMRLLEL Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.90424 Ang R4.NH2 and F8.CZ other bump:2.6897 Ang R4.NH2 and F8.CE2 Number of specific fragments= 1 total=1670 # 1jw9B.35.42 read from T0191.t2k.frag # found chain 1jw9B in template set T0191 35 :ARAVAFELA 1jw9B 43 :GCAASQYLA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1671 # 1bia.35.35 read from T0191.t2k.frag # found chain 1bia in template set T0191 35 :ARAVAFELA 1bia 36 :INKHIQTLR Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.28899 Ang E8.O and G11.N other bump:3.14547 Ang E8.C and G11.N other bump:3.2553 Ang G1.C and A4.N Number of specific fragments= 1 total=1672 # 1ej0A.35.36 read from T0191.t2k.frag # found chain 1ej0A in training set T0191 35 :ARAVAFELA 1ej0A 66 :SQYVVTQIG Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.34792 Ang A10.CB and G11.N self-bump: 2.15678 Ang A10.CB and A10.C self-bump: 1.27263 Ang A10.CA and A10.CB other bump:2.76638 Ang V5.CG1 and L9.CD1 Number of specific fragments= 1 total=1673 # 1kc6A.35.35 read from T0191.t2k.frag # found chain 1kc6A in template set T0191 35 :ARAVAFELA 1kc6A 37 :FEKLVYKFL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1674 # 1bib.35.35 read from T0191.t2k.frag # found chain 1bib in template set T0191 35 :ARAVAFELA 1bib 36 :INKHIQTLR Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.29706 Ang E8.O and G11.N other bump:3.09252 Ang E8.C and G11.N neighbor-bump: 2.15373 Ang A2.O and R3.C neighbor-bump: 2.57278 Ang A2.C and R3.C Number of specific fragments= 1 total=1675 # 1hruA.35.41 read from T0191.t2k.frag # found chain 1hruA in template set T0191 35 :ARAVAFELA 1hruA 42 :AVMRLLELK Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.90424 Ang R3.NH2 and F7.CZ other bump:2.6897 Ang R3.NH2 and F7.CE2 Number of specific fragments= 1 total=1676 # 1jw9B.36.43 read from T0191.t2k.frag # found chain 1jw9B in template set T0191 36 :RAVAFELAK 1jw9B 44 :CAASQYLAS Fragment has 8 clashes (null) has 8 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.57644 Ang F6.CE1 and K10.NZ other bump:2.31157 Ang F6.CE2 and K10.NZ other bump:1.45488 Ang F6.CZ and K10.NZ other bump:2.09663 Ang F6.CE1 and K10.CE other bump:2.58423 Ang F6.CE2 and K10.CE other bump:1.65269 Ang F6.CZ and K10.CE other bump:2.99198 Ang F6.CE2 and K10.CD other bump:2.74187 Ang F6.CZ and K10.CD Number of specific fragments= 1 total=1677 # 1bia.36.36 read from T0191.t2k.frag # found chain 1bia in template set T0191 36 :RAVAFELAK 1bia 37 :NKHIQTLRD Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.28899 Ang E7.O and K10.N other bump:3.14547 Ang E7.C and K10.N Number of specific fragments= 1 total=1678 # 1hruA.36.42 read from T0191.t2k.frag # found chain 1hruA in template set T0191 36 :RAVAFELAK 1hruA 43 :VMRLLELKQ Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.90425 Ang R2.NH2 and F6.CZ other bump:2.68971 Ang R2.NH2 and F6.CE2 Number of specific fragments= 1 total=1679 # 1ej0A.36.37 read from T0191.t2k.frag # found chain 1ej0A in training set T0191 36 :RAVAFELAK 1ej0A 67 :QYVVTQIGG Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.34791 Ang A9.CB and K10.N self-bump: 2.15678 Ang A9.CB and A9.C self-bump: 1.27263 Ang A9.CA and A9.CB other bump:2.76638 Ang V4.CG1 and L8.CD1 Number of specific fragments= 1 total=1680 # 1bib.36.36 read from T0191.t2k.frag # found chain 1bib in template set T0191 36 :RAVAFELAK 1bib 37 :NKHIQTLRD Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.76634 Ang F6.CD2 and K10.CE other bump:2.32982 Ang F6.CE2 and K10.CE other bump:2.29706 Ang E7.O and K10.N other bump:3.09252 Ang E7.C and K10.N neighbor-bump: 2.15373 Ang G1.O and R2.C neighbor-bump: 2.57278 Ang G1.C and R2.C Number of specific fragments= 1 total=1681 # 1kc6A.36.36 read from T0191.t2k.frag # found chain 1kc6A in template set T0191 36 :RAVAFELAK 1kc6A 38 :EKLVYKFLK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1682 # 1jw9B.37.44 read from T0191.t2k.frag # found chain 1jw9B in template set T0191 37 :AVAFELAKD 1jw9B 45 :AASQYLASA Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.76198 Ang F5.CD1 and K9.NZ other bump:1.61895 Ang F5.CE1 and K9.NZ other bump:2.75874 Ang F5.CE2 and K9.NZ other bump:1.6202 Ang F5.CZ and K9.NZ other bump:2.97888 Ang F5.CE1 and K9.CE other bump:2.35596 Ang F5.CZ and K9.CE other bump:3.11961 Ang F5.CZ and K9.CD Number of specific fragments= 1 total=1683 # 1bia.37.37 read from T0191.t2k.frag # found chain 1bia in template set T0191 37 :AVAFELAKD 1bia 38 :KHIQTLRDW Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.91473 Ang F5.CE2 and K9.NZ other bump:2.00548 Ang F5.CD2 and K9.NZ other bump:2.71057 Ang E6.O and K9.CB other bump:2.28899 Ang E6.O and K9.N other bump:3.14547 Ang E6.C and K9.N Number of specific fragments= 1 total=1684 # 1hruA.37.43 read from T0191.t2k.frag # found chain 1hruA in template set T0191 37 :AVAFELAKD 1hruA 44 :MRLLELKQR Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1685 # 1ej0A.37.38 read from T0191.t2k.frag # found chain 1ej0A in training set T0191 37 :AVAFELAKD 1ej0A 68 :YVVTQIGGK Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.34791 Ang A8.CB and K9.N self-bump: 2.15678 Ang A8.CB and A8.C self-bump: 1.27263 Ang A8.CA and A8.CB other bump:2.76638 Ang V3.CG1 and L7.CD1 Number of specific fragments= 1 total=1686 # 1bib.37.37 read from T0191.t2k.frag # found chain 1bib in template set T0191 37 :AVAFELAKD 1bib 38 :KHIQTLRDW Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.76634 Ang F5.CD2 and K9.CE other bump:2.32982 Ang F5.CE2 and K9.CE other bump:2.29706 Ang E6.O and K9.N other bump:3.09252 Ang E6.C and K9.N Number of specific fragments= 1 total=1687 # 1fkmA.37.39 read from T0191.t2k.frag # adding 1fkmA to template set 1fkmA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 1883, because occupancy 0.5 <= existing 0.500001 Skipped atom 1885, because occupancy 0.5 <= existing 0.500001 Skipped atom 1887, because occupancy 0.5 <= existing 0.500001 Skipped atom 1889, because occupancy 0.5 <= existing 0.500001 Skipped atom 1891, because occupancy 0.5 <= existing 0.500001 Skipped atom 1893, because occupancy 0.5 <= existing 0.500001 Skipped atom 1895, because occupancy 0.5 <= existing 0.500001 Skipped atom 1897, because occupancy 0.5 <= existing 0.500001 Skipped atom 1899, because occupancy 0.5 <= existing 0.500001 Skipped atom 1901, because occupancy 0.5 <= existing 0.500001 Skipped atom 1974, because occupancy 0.5 <= existing 0.500001 Skipped atom 1976, because occupancy 0.5 <= existing 0.500001 Skipped atom 1978, because occupancy 0.5 <= existing 0.500001 Skipped atom 1980, because occupancy 0.5 <= existing 0.500001 Skipped atom 1982, because occupancy 0.5 <= existing 0.500001 Skipped atom 1984, because occupancy 0.5 <= existing 0.500001 Skipped atom 1986, because occupancy 0.5 <= existing 0.500001 Skipped atom 1988, because occupancy 0.5 <= existing 0.500001 Skipped atom 1990, because occupancy 0.5 <= existing 0.500001 Skipped atom 1992, because occupancy 0.5 <= existing 0.500001 Skipped atom 1994, because occupancy 0.5 <= existing 0.500001 Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 2603, because occupancy 0.5 <= existing 0.500001 Skipped atom 2605, because occupancy 0.5 <= existing 0.500001 Skipped atom 2607, because occupancy 0.5 <= existing 0.500001 Skipped atom 2609, because occupancy 0.5 <= existing 0.500001 Skipped atom 2611, because occupancy 0.5 <= existing 0.500001 Skipped atom 2613, because occupancy 0.5 <= existing 0.500001 Skipped atom 2615, because occupancy 0.5 <= existing 0.500001 Skipped atom 2617, because occupancy 0.5 <= existing 0.500001 Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 2652, because occupancy 0.5 <= existing 0.500001 Skipped atom 2654, because occupancy 0.5 <= existing 0.500001 Skipped atom 2656, because occupancy 0.5 <= existing 0.500001 Skipped atom 2658, because occupancy 0.5 <= existing 0.500001 Skipped atom 2660, because occupancy 0.5 <= existing 0.500001 Skipped atom 2662, because occupancy 0.5 <= existing 0.500001 Skipped atom 2720, because occupancy 0.5 <= existing 0.500001 Skipped atom 2722, because occupancy 0.5 <= existing 0.500001 Skipped atom 2724, because occupancy 0.5 <= existing 0.500001 Skipped atom 2726, because occupancy 0.5 <= existing 0.500001 Skipped atom 2728, because occupancy 0.5 <= existing 0.500001 Skipped atom 2730, because occupancy 0.5 <= existing 0.500001 # found chain 1fkmA in template set T0191 37 :AVAFELAKD 1fkmA 287 :PVVWKLLIG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1688 # 1hruA.38.44 read from T0191.t2k.frag # found chain 1hruA in template set T0191 38 :VAFELAKDN 1hruA 45 :RLLELKQRP Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1689 # 1bia.38.38 read from T0191.t2k.frag # found chain 1bia in template set T0191 38 :VAFELAKDN 1bia 39 :HIQTLRDWG Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.91473 Ang F4.CE2 and K8.NZ other bump:2.00548 Ang F4.CD2 and K8.NZ other bump:2.71057 Ang E5.O and K8.CB other bump:2.28899 Ang E5.O and K8.N other bump:3.14547 Ang E5.C and K8.N Number of specific fragments= 1 total=1690 # 1ej0A.38.39 read from T0191.t2k.frag # found chain 1ej0A in training set T0191 38 :VAFELAKDN 1ej0A 69 :VVTQIGGKG Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.46981 Ang L6.CD1 and N10.ND2 other bump:2.21768 Ang L6.CB and N10.ND2 other bump:2.11852 Ang L6.CG and N10.ND2 other bump:1.82205 Ang L6.CD2 and N10.ND2 other bump:2.8917 Ang L6.CB and N10.CG other bump:2.90441 Ang L6.CB and N10.CB neighbor-bump: 2.34791 Ang A7.CB and K8.N self-bump: 2.15678 Ang A7.CB and A7.C self-bump: 1.27263 Ang A7.CA and A7.CB other bump:2.76638 Ang V2.CG1 and L6.CD1 Number of specific fragments= 1 total=1691 # 1jw9B.38.45 read from T0191.t2k.frag # found chain 1jw9B in template set T0191 38 :VAFELAKDN 1jw9B 46 :ASQYLASAG Fragment has 8 clashes (null) has 8 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.09657 Ang L6.O and D9.OD1 other bump:2.76198 Ang F4.CD1 and K8.NZ other bump:1.61895 Ang F4.CE1 and K8.NZ other bump:2.75874 Ang F4.CE2 and K8.NZ other bump:1.6202 Ang F4.CZ and K8.NZ other bump:2.97888 Ang F4.CE1 and K8.CE other bump:2.35596 Ang F4.CZ and K8.CE other bump:3.11961 Ang F4.CZ and K8.CD Number of specific fragments= 1 total=1692 # 1fkmA.38.40 read from T0191.t2k.frag # found chain 1fkmA in template set T0191 38 :VAFELAKDN 1fkmA 288 :VVWKLLIGY Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1693 # 1bib.38.38 read from T0191.t2k.frag # found chain 1bib in template set T0191 38 :VAFELAKDN 1bib 39 :HIQTLRDWG Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.73213 Ang L6.O and D9.OD1 other bump:2.66417 Ang L6.C and D9.OD1 other bump:2.76634 Ang F4.CD2 and K8.CE other bump:2.32982 Ang F4.CE2 and K8.CE other bump:2.29706 Ang E5.O and K8.N other bump:3.09252 Ang E5.C and K8.N Number of specific fragments= 1 total=1694 # 1bia.39.39 read from T0191.t2k.frag # found chain 1bia in template set T0191 39 :AFELAKDNN 1bia 40 :IQTLRDWGV Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.91473 Ang F3.CE2 and K7.NZ other bump:2.00548 Ang F3.CD2 and K7.NZ other bump:2.71057 Ang E4.O and K7.CB other bump:2.28899 Ang E4.O and K7.N other bump:3.14547 Ang E4.C and K7.N Number of specific fragments= 1 total=1695 # 1hruA.39.45 read from T0191.t2k.frag # found chain 1hruA in template set T0191 39 :AFELAKDNN 1hruA 46 :LLELKQRPV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1696 # 1fkmA.39.41 read from T0191.t2k.frag # found chain 1fkmA in template set T0191 39 :AFELAKDNN 1fkmA 289 :VWKLLIGYL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1697 # 1ej0A.39.40 read from T0191.t2k.frag # found chain 1ej0A in training set T0191 39 :AFELAKDNN 1ej0A 70 :VTQIGGKGR Fragment has 9 clashes (null) has 9 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.21769 Ang L5.CB and N9.ND2 other bump:2.46981 Ang L5.CD1 and N9.ND2 other bump:2.11852 Ang L5.CG and N9.ND2 other bump:1.82205 Ang L5.CD2 and N9.ND2 other bump:2.8917 Ang L5.CB and N9.CG other bump:2.90441 Ang L5.CB and N9.CB neighbor-bump: 2.34791 Ang A6.CB and K7.N self-bump: 2.15678 Ang A6.CB and A6.C self-bump: 1.27263 Ang A6.CA and A6.CB Number of specific fragments= 1 total=1698 # 1h6pA.39.40 read from T0191.t2k.frag # adding 1h6pA to template set 1h6pA:# found chain 1h6pA in template set T0191 39 :AFELAKDNN 1h6pA 83 :MQALLVRPL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1699 # 1bib.39.39 read from T0191.t2k.frag # found chain 1bib in template set T0191 39 :AFELAKDNN 1bib 40 :IQTLRDWGV Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.66417 Ang L5.C and D8.OD1 other bump:1.73213 Ang L5.O and D8.OD1 other bump:2.76634 Ang F3.CD2 and K7.CE other bump:2.32982 Ang F3.CE2 and K7.CE other bump:2.29706 Ang E4.O and K7.N other bump:3.09252 Ang E4.C and K7.N Number of specific fragments= 1 total=1700 # 1bia.40.41 read from T0191.t2k.frag # found chain 1bia in template set T0191 40 :FELAKDNNI 1bia 42 :TLRDWGVDV Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.73166 Ang F2.CZ and K6.CD other bump:2.9703 Ang F2.CD2 and K6.CD other bump:2.29049 Ang F2.CE2 and K6.CD other bump:2.28899 Ang F2.O and A5.N other bump:3.14547 Ang F2.C and A5.N Number of specific fragments= 1 total=1701 # 1bib.40.41 read from T0191.t2k.frag # found chain 1bib in template set T0191 40 :FELAKDNNI 1bib 42 :TLRDWGVDV Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.02456 Ang N8.OD1 and I10.CD1 other bump:2.05638 Ang N8.OD1 and I10.CG1 other bump:2.97128 Ang F2.CD2 and K6.CD other bump:2.27846 Ang F2.CE2 and K6.CD other bump:2.75613 Ang F2.CZ and K6.CD other bump:2.29706 Ang F2.O and A5.N other bump:3.09252 Ang F2.C and A5.N Number of specific fragments= 1 total=1702 # 1fkmA.40.42 read from T0191.t2k.frag # found chain 1fkmA in template set T0191 40 :FELAKDNNI 1fkmA 290 :WKLLIGYLP Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1703 # 1bia.40.40 read from T0191.t2k.frag # found chain 1bia in template set T0191 40 :FELAKDNNI 1bia 41 :QTLRDWGVD Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.00546 Ang F2.CD2 and K6.NZ other bump:1.9147 Ang F2.CE2 and K6.NZ other bump:2.71057 Ang E3.O and K6.CB other bump:2.28899 Ang E3.O and K6.N other bump:3.14547 Ang E3.C and K6.N Number of specific fragments= 1 total=1704 # 1h6pA.40.41 read from T0191.t2k.frag # found chain 1h6pA in template set T0191 40 :FELAKDNN 1h6pA 84 :QALLVRPL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 10 residues Number of specific fragments= 1 total=1705 # 3pgm.40.40 read from T0191.t2k.frag # adding 3pgm to template set 3pgm:Bad short name: S for alphabet: pdb_atoms Bad short name: OS1 for alphabet: pdb_atoms Bad short name: OS2 for alphabet: pdb_atoms Bad short name: OS3 for alphabet: pdb_atoms Bad short name: OS4 for alphabet: pdb_atoms Bad short name: S for alphabet: pdb_atoms Bad short name: OS1 for alphabet: pdb_atoms Bad short name: OS2 for alphabet: pdb_atoms Bad short name: OS3 for alphabet: pdb_atoms Bad short name: OS4 for alphabet: pdb_atoms Bad short name: O1 for alphabet: pdb_atoms Bad short name: C1 for alphabet: pdb_atoms Bad short name: O2 for alphabet: pdb_atoms Bad short name: C2 for alphabet: pdb_atoms Bad short name: C3 for alphabet: pdb_atoms Bad short name: OPC for alphabet: pdb_atoms Bad short name: PC for alphabet: pdb_atoms Bad short name: OC1 for alphabet: pdb_atoms Bad short name: OC2 for alphabet: pdb_atoms Bad short name: OC3 for alphabet: pdb_atoms # found chain 3pgm in template set T0191 40 :FELAKDNNI 3pgm 41 :LLKEKGVNV Fragment has 15 clashes (null) has 15 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.24919 Ang N9.O and I10.CG2 neighbor-bump: 2.81985 Ang N9.C and I10.CG2 other bump:2.65028 Ang L4.CD1 and N9.OD1 neighbor-bump: 2.54384 Ang D7.C and N8.O neighbor-bump: 1.90693 Ang D7.O and N8.O neighbor-bump: 2.70309 Ang D7.CB and N8.OD1 other bump:2.20513 Ang E3.O and N8.OD1 neighbor-bump: 2.39251 Ang D7.CB and N8.N other bump:2.71197 Ang E3.O and D7.C other bump:1.78179 Ang E3.O and D7.O other bump:2.79508 Ang E3.C and D7.O neighbor-bump: 2.63563 Ang A5.C and K6.C neighbor-bump: 2.38289 Ang A5.O and K6.C neighbor-bump: 2.20579 Ang A5.O and K6.O other bump:2.69133 Ang G1.O and A5.CB Number of specific fragments= 1 total=1706 # 1bia.41.42 read from T0191.t2k.frag # found chain 1bia in template set T0191 41 :ELAKDNNII 1bia 43 :LRDWGVDVF Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.28899 Ang G1.O and A4.N other bump:3.14547 Ang G1.C and A4.N Number of specific fragments= 1 total=1707 # 1bib.41.42 read from T0191.t2k.frag # found chain 1bib in template set T0191 41 :ELAKDNNII 1bib 43 :LRDWGVDVF Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.15235 Ang N7.OD1 and I9.CD1 other bump:2.13625 Ang N7.OD1 and I9.CG1 other bump:2.29706 Ang G1.O and A4.N other bump:3.09252 Ang G1.C and A4.N Number of specific fragments= 1 total=1708 # 3pgm.41.41 read from T0191.t2k.frag # found chain 3pgm in template set T0191 41 :ELAKDNNII 3pgm 42 :LKEKGVNVL Fragment has 14 clashes (null) has 14 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.24919 Ang N8.O and I9.CG2 neighbor-bump: 2.81986 Ang N8.C and I9.CG2 other bump:2.65028 Ang L3.CD1 and N8.OD1 neighbor-bump: 2.54384 Ang D6.C and N7.O neighbor-bump: 1.90693 Ang D6.O and N7.O neighbor-bump: 2.70309 Ang D6.CB and N7.OD1 other bump:2.20513 Ang E2.O and N7.OD1 neighbor-bump: 2.39251 Ang D6.CB and N7.N other bump:2.71197 Ang E2.O and D6.C other bump:1.78179 Ang E2.O and D6.O other bump:2.79508 Ang E2.C and D6.O neighbor-bump: 2.38289 Ang A4.O and K5.C neighbor-bump: 2.63563 Ang A4.C and K5.C neighbor-bump: 2.20579 Ang A4.O and K5.O Number of specific fragments= 1 total=1709 # 1bia.41.41 read from T0191.t2k.frag # found chain 1bia in template set T0191 41 :ELAKDNNII 1bia 42 :TLRDWGVDV Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.74293 Ang L3.CD1 and I10.CD1 other bump:2.71057 Ang E2.O and K5.CB other bump:2.28899 Ang E2.O and K5.N other bump:3.14547 Ang E2.C and K5.N Number of specific fragments= 1 total=1710 # 1ej0A.41.42 read from T0191.t2k.frag # found chain 1ej0A in training set T0191 41 :ELAKDNNII 1ej0A 72 :QIGGKGRII Fragment has 9 clashes (null) has 9 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.4698 Ang L3.CD1 and N7.ND2 other bump:2.21768 Ang L3.CB and N7.ND2 other bump:2.11852 Ang L3.CG and N7.ND2 other bump:1.82206 Ang L3.CD2 and N7.ND2 other bump:2.8917 Ang L3.CB and N7.CG other bump:2.90441 Ang L3.CB and N7.CB neighbor-bump: 2.34792 Ang A4.CB and K5.N self-bump: 2.15678 Ang A4.CB and A4.C self-bump: 1.27263 Ang A4.CA and A4.CB Number of specific fragments= 1 total=1711 # 1ln4A.41.41 read from T0191.t2k.frag # adding 1ln4A to template set 1ln4A:Skipped atom 639, because occupancy 0.5 <= existing 0.500001 Skipped atom 641, because occupancy 0.5 <= existing 0.500001 Skipped atom 643, because occupancy 0.5 <= existing 0.500001 Skipped atom 645, because occupancy 0.5 <= existing 0.500001 Skipped atom 719, because occupancy 0.5 <= existing 0.500001 Skipped atom 721, because occupancy 0.5 <= existing 0.500001 Skipped atom 723, because occupancy 0.5 <= existing 0.500001 # found chain 1ln4A in template set T0191 41 :ELAKDNNII 1ln4A 42 :EHHELIKVK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1712 # 1bia.42.43 read from T0191.t2k.frag # found chain 1bia in template set T0191 42 :LAKDNNIII 1bia 44 :RDWGVDVFT Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1713 # 1bib.42.43 read from T0191.t2k.frag # found chain 1bib in template set T0191 42 :LAKDNNIII 1bib 44 :RDWGVDVFT Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.15235 Ang N6.OD1 and I8.CD1 other bump:2.13625 Ang N6.OD1 and I8.CG1 Number of specific fragments= 1 total=1714 # 1ln4A.42.42 read from T0191.t2k.frag # found chain 1ln4A in template set T0191 42 :LAKDNNIII 1ln4A 43 :HHELIKVKI Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1715 # 1ihoA.42.43 read from T0191.t2k.frag # adding 1ihoA to template set 1ihoA:Skipped atom 636, because occupancy 0.5 <= existing 0.500001 Skipped atom 638, because occupancy 0.5 <= existing 0.500001 Skipped atom 640, because occupancy 0.5 <= existing 0.500001 Skipped atom 642, because occupancy 0.5 <= existing 0.500001 Skipped atom 2108, because occupancy 0.5 <= existing 0.500001 Skipped atom 2110, because occupancy 0.5 <= existing 0.500001 Skipped atom 2112, because occupancy 0.5 <= existing 0.500001 Skipped atom 2114, because occupancy 0.5 <= existing 0.500001 # found chain 1ihoA in template set T0191 42 :LAKDNNIII 1ihoA 44 :AKARADVVV Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.61072 Ang N6.OD1 and I9.CG2 other bump:2.18795 Ang L2.O and N6.OD1 Number of specific fragments= 1 total=1716 # 3pgm.42.42 read from T0191.t2k.frag # found chain 3pgm in template set T0191 42 :LAKDNNIII 3pgm 43 :KEKGVNVLV Fragment has 14 clashes (null) has 14 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.24919 Ang N7.O and I8.CG2 neighbor-bump: 2.81986 Ang N7.C and I8.CG2 other bump:2.65028 Ang L2.CD1 and N7.OD1 neighbor-bump: 2.54384 Ang D5.C and N6.O neighbor-bump: 1.90693 Ang D5.O and N6.O neighbor-bump: 2.70309 Ang D5.CB and N6.OD1 other bump:2.20513 Ang G1.O and N6.OD1 neighbor-bump: 2.39251 Ang D5.CB and N6.N other bump:2.71197 Ang G1.O and D5.C other bump:1.78179 Ang G1.O and D5.O other bump:2.79508 Ang G1.C and D5.O neighbor-bump: 2.63563 Ang A3.C and K4.C neighbor-bump: 2.38289 Ang A3.O and K4.C neighbor-bump: 2.20579 Ang A3.O and K4.O Number of specific fragments= 1 total=1717 # 1byb.42.42 read from T0191.t2k.frag # found chain 1byb in training set T0191 42 :LAKDNNIII 1byb 43 :RAAGVDGVM Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.33852 Ang N6.OD1 and I8.O Number of specific fragments= 1 total=1718 # 1ln4A.43.43 read from T0191.t2k.frag # found chain 1ln4A in template set T0191 43 :AKDNNIIIA 1ln4A 44 :HELIKVKIA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1719 # 1bia.43.44 read from T0191.t2k.frag # found chain 1bia in template set T0191 43 :AKDNNIIIA 1bia 45 :DWGVDVFTV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1720 # 1bib.43.44 read from T0191.t2k.frag # found chain 1bib in template set T0191 43 :AKDNNIIIA 1bib 45 :DWGVDVFTV Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.15235 Ang N5.OD1 and I7.CD1 other bump:2.13625 Ang N5.OD1 and I7.CG1 Number of specific fragments= 1 total=1721 # 1ihoA.43.44 read from T0191.t2k.frag # found chain 1ihoA in template set T0191 43 :AKDNNIIIA 1ihoA 45 :KARADVVVV Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.61072 Ang N5.OD1 and I8.CG2 other bump:2.18795 Ang G1.O and N5.OD1 Number of specific fragments= 1 total=1722 # 6ldh.43.43 read from T0191.t2k.frag # adding 6ldh to template set 6ldh:Bad short name: ACE for alphabet: ExtAA Replacing ACE with X Bad short name: ACE for alphabet: ExtAA Replacing ACE with X Bad short name: ACE for alphabet: ExtAA Replacing ACE with X Bad short name: ACE for alphabet: ExtAA Replacing ACE with X Bad short name: ACE for alphabet: ExtAA Replacing ACE with X Bad short name: ACE for alphabet: ExtAA Replacing ACE with X # found chain 6ldh in template set T0191 43 :AKDNNII 6ldh 43 :DLADEVA Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 9 residues other bump:2.72126 Ang D4.OD2 and I7.CG2 other bump:3.06919 Ang D4.CG and N6.C other bump:2.84776 Ang D4.OD2 and N6.C other bump:2.12593 Ang D4.CG and N6.O other bump:2.28873 Ang D4.OD1 and N6.O other bump:1.69153 Ang D4.OD2 and N6.O other bump:3.16712 Ang D4.CG and N6.N Number of specific fragments= 1 total=1723 # 1fr9A.43.44 read from T0191.t2k.frag # adding 1fr9A to template set 1fr9A:# found chain 1fr9A in template set T0191 43 :AKDNNIIIA 1fr9A 45 :TQLSHVVVN Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.71804 Ang I8.CG2 and I9.N neighbor-bump: 2.10395 Ang N5.OD1 and N6.N Number of specific fragments= 1 total=1724 # 1ln4A.44.44 read from T0191.t2k.frag # found chain 1ln4A in template set T0191 44 :KDNNIIIAN 1ln4A 45 :ELIKVKIAT Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1725 # 6ldh.44.44 read from T0191.t2k.frag # found chain 6ldh in template set T0191 44 :KDNNII 6ldh 44 :LADEVA Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 8 residues other bump:2.72126 Ang D3.OD2 and I6.CG2 other bump:3.06919 Ang D3.CG and N5.C other bump:2.84776 Ang D3.OD2 and N5.C other bump:2.12593 Ang D3.CG and N5.O other bump:2.28873 Ang D3.OD1 and N5.O other bump:1.69153 Ang D3.OD2 and N5.O other bump:3.16712 Ang D3.CG and N5.N T0191 52 :N 6ldh 52 :D Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 3 residues Number of specific fragments= 2 total=1727 Number of alignments=287 # 1bia.44.45 read from T0191.t2k.frag # found chain 1bia in template set T0191 44 :KDNNIIIAN 1bia 46 :WGVDVFTVP Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1728 # 1bib.44.45 read from T0191.t2k.frag # found chain 1bib in template set T0191 44 :KDNNIIIAN 1bib 46 :WGVDVFTVP Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.23707 Ang N10.ND2 and G11.N self-bump: 1.34809 Ang N10.CA and N10.CB other bump:2.15235 Ang N4.OD1 and I6.CD1 other bump:2.13625 Ang N4.OD1 and I6.CG1 Number of specific fragments= 1 total=1729 # 1ihoA.44.45 read from T0191.t2k.frag # found chain 1ihoA in template set T0191 44 :KDNNIIIAN 1ihoA 46 :ARADVVVVS Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.61072 Ang N4.OD1 and I7.CG2 Number of specific fragments= 1 total=1730 # 1php.44.49 read from T0191.t2k.frag # found chain 1php in training set T0191 44 :KDNNIIIAN 1php 50 :HGAKVILAS Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1731 # 1ln4A.45.45 read from T0191.t2k.frag # found chain 1ln4A in template set T0191 45 :DNNIIIANR 1ln4A 46 :LIKVKIATE Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.87175 Ang N9.CG and G11.N Number of specific fragments= 1 total=1732 # 6ldh.45.45 read from T0191.t2k.frag # found chain 6ldh in template set T0191 45 :DNNII 6ldh 45 :ADEVA Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 7 residues other bump:2.68526 Ang D2.OD1 and N4.C other bump:2.65367 Ang D2.CG and N4.O other bump:1.87826 Ang D2.OD1 and N4.O T0191 52 :NR 6ldh 52 :DV Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues other bump:2.15593 Ang N2.OD1 and G4.N Number of specific fragments= 2 total=1734 Number of alignments=288 # 1php.45.50 read from T0191.t2k.frag # found chain 1php in training set T0191 45 :DNNIIIANR 1php 51 :GAKVILASH Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1735 # 1byb.45.45 read from T0191.t2k.frag # found chain 1byb in training set T0191 45 :DNNIIIANR 1byb 46 :GVDGVMVDV Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.33852 Ang N3.OD1 and I5.O Number of specific fragments= 1 total=1736 # 1bia.45.46 read from T0191.t2k.frag # found chain 1bia in template set T0191 45 :DNNIIIANR 1bia 47 :GVDVFTVPG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1737 # 1uaaA.45.46 read from T0191.t2k.frag # adding 1uaaA to template set 1uaaA:# found chain 1uaaA in template set T0191 45 :DNNIIIANR 1uaaA 47 :ARHIAAVTF Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.15786 Ang N9.OD1 and G11.N Number of specific fragments= 1 total=1738 # 1ln4A.46.46 read from T0191.t2k.frag # found chain 1ln4A in template set T0191 46 :NNIIIANRT 1ln4A 47 :IKVKIATED Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.19429 Ang N8.OD1 and T10.O other bump:2.87175 Ang N8.CG and T10.N Number of specific fragments= 1 total=1739 # 6ldh.46.46 read from T0191.t2k.frag # found chain 6ldh in template set T0191 46 :NNII 6ldh 46 :DEVA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 6 residues T0191 52 :NRT 6ldh 52 :DVM Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 5 residues other bump:2.15593 Ang N2.OD1 and T4.N Number of specific fragments= 2 total=1741 Number of alignments=289 # 1uaaA.46.47 read from T0191.t2k.frag # found chain 1uaaA in template set T0191 46 :NNIIIANRT 1uaaA 48 :RHIAAVTFT Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.15786 Ang N8.OD1 and T10.N Number of specific fragments= 1 total=1742 # 1k4vA.46.49 read from T0191.t2k.frag # adding 1k4vA to template set 1k4vA:Skipped atom 853, because occupancy 0.45 <= existing 0.550001 Skipped atom 857, because occupancy 0.45 <= existing 0.550001 Skipped atom 859, because occupancy 0.45 <= existing 0.550001 Skipped atom 861, because occupancy 0.45 <= existing 0.550001 Skipped atom 863, because occupancy 0.45 <= existing 0.550001 Skipped atom 865, because occupancy 0.45 <= existing 0.550001 Skipped atom 867, because occupancy 0.45 <= existing 0.550001 Skipped atom 869, because occupancy 0.45 <= existing 0.550001 Skipped atom 1342, because occupancy 0.32 <= existing 0.680001 Skipped atom 1346, because occupancy 0.32 <= existing 0.680001 Skipped atom 1348, because occupancy 0.32 <= existing 0.680001 Skipped atom 1350, because occupancy 0.32 <= existing 0.680001 Skipped atom 1352, because occupancy 0.32 <= existing 0.680001 Skipped atom 1354, because occupancy 0.32 <= existing 0.680001 Skipped atom 1406, because occupancy 0.34 <= existing 0.660001 Skipped atom 1410, because occupancy 0.34 <= existing 0.660001 Skipped atom 1412, because occupancy 0.34 <= existing 0.660001 Skipped atom 1414, because occupancy 0.34 <= existing 0.660001 Skipped atom 1416, because occupancy 0.34 <= existing 0.660001 Skipped atom 1418, because occupancy 0.34 <= existing 0.660001 Skipped atom 1420, because occupancy 0.34 <= existing 0.660001 Skipped atom 1422, because occupancy 0.34 <= existing 0.660001 Skipped atom 1424, because occupancy 0.34 <= existing 0.660001 Skipped atom 1426, because occupancy 0.34 <= existing 0.660001 Skipped atom 1428, because occupancy 0.34 <= existing 0.660001 # found chain 1k4vA in template set T0191 46 :NNIIIANRT 1k4vA 129 :VGLTVFAVG Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.27725 Ang T10.CG2 and G11.N self-bump: 1.28189 Ang T10.CA and T10.CB Number of specific fragments= 1 total=1743 # 1jw9B.46.55 read from T0191.t2k.frag # found chain 1jw9B in template set T0191 46 :NNIIIANRT 1jw9B 56 :GNLTLLDFD Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.98643 Ang N8.OD1 and T10.OG1 Number of specific fragments= 1 total=1744 # 1a8l.46.54 read from T0191.t2k.frag # adding 1a8l to template set 1a8l:# found chain 1a8l in template set T0191 46 :NNIIIANRT 1a8l 55 :LSYEIVDFD Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1745 # 1ln4A.47.47 read from T0191.t2k.frag # found chain 1ln4A in template set T0191 47 :NIIIANRTV 1ln4A 48 :KVKIATEDR Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.19429 Ang N7.OD1 and T9.O other bump:2.87175 Ang N7.CG and T9.N Number of specific fragments= 1 total=1746 # 6ldh.47.47 read from T0191.t2k.frag # found chain 6ldh in template set T0191 47 :NII 6ldh 47 :EVA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 5 residues T0191 52 :NRTV 6ldh 52 :DVME Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 6 residues neighbor-bump: 2.67566 Ang V5.CG2 and G6.N self-bump: 1.38533 Ang V5.CA and V5.CB other bump:2.15593 Ang N2.OD1 and T4.N Number of specific fragments= 2 total=1748 Number of alignments=290 # 1uaaA.47.48 read from T0191.t2k.frag # found chain 1uaaA in template set T0191 47 :NIIIANRTV 1uaaA 49 :HIAAVTFTN Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.15786 Ang N7.OD1 and T9.N Number of specific fragments= 1 total=1749 # 1fr9A.47.48 read from T0191.t2k.frag # found chain 1fr9A in template set T0191 47 :NIIIANRTV 1fr9A 49 :HVVVNANRH Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.71804 Ang I4.CG2 and I5.N Number of specific fragments= 1 total=1750 # 1a8l.47.55 read from T0191.t2k.frag # found chain 1a8l in template set T0191 47 :NIIIANRTV 1a8l 56 :SYEIVDFDT Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1751 # 1jw9B.47.56 read from T0191.t2k.frag # found chain 1jw9B in template set T0191 47 :NIIIANRTV 1jw9B 57 :NLTLLDFDT Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.98643 Ang N7.OD1 and T9.OG1 Number of specific fragments= 1 total=1752 # 1ln4A.48.48 read from T0191.t2k.frag # found chain 1ln4A in template set T0191 48 :IIIANRTVE 1ln4A 49 :VKIATEDRE Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.19429 Ang N6.OD1 and T8.O other bump:2.87175 Ang N6.CG and T8.N Number of specific fragments= 1 total=1753 # 6ldh.48.48 read from T0191.t2k.frag # found chain 6ldh in template set T0191 48 :II 6ldh 48 :VA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues T0191 52 :NRTVE 6ldh 52 :DVMED Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 7 residues neighbor-bump: 2.67566 Ang V5.CG2 and E6.N self-bump: 1.38533 Ang V5.CA and V5.CB other bump:2.15593 Ang N2.OD1 and T4.N Number of specific fragments= 2 total=1755 Number of alignments=291 # 1uaaA.48.49 read from T0191.t2k.frag # found chain 1uaaA in template set T0191 48 :IIIANRTVE 1uaaA 50 :IAAVTFTNK Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.15786 Ang N6.OD1 and T8.N Number of specific fragments= 1 total=1756 # 1fr9A.48.49 read from T0191.t2k.frag # found chain 1fr9A in template set T0191 48 :IIIANRTVE 1fr9A 50 :VVVNANRHQ Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.46584 Ang R7.C and E10.OE2 other bump:2.68361 Ang N6.ND2 and E10.CG neighbor-bump: 2.71804 Ang I3.CG2 and I4.N Number of specific fragments= 1 total=1757 # 1a8l.48.56 read from T0191.t2k.frag # found chain 1a8l in template set T0191 48 :IIIANRTVE 1a8l 57 :YEIVDFDTP Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1758 # 1k4vA.48.51 read from T0191.t2k.frag # found chain 1k4vA in template set T0191 48 :IIIANRTVE 1k4vA 131 :LTVFAVGRY Fragment has 9 clashes (null) has 9 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.50039 Ang N6.CG and G11.CA other bump:1.80369 Ang N6.OD1 and G11.CA other bump:2.6041 Ang N6.ND2 and G11.CA other bump:2.67418 Ang N6.CG and G11.N other bump:2.01915 Ang N6.ND2 and G11.N other bump:3.0994 Ang N6.CG and E10.C other bump:2.33144 Ang N6.ND2 and E10.C neighbor-bump: 2.27724 Ang T8.CG2 and V9.N self-bump: 1.28189 Ang T8.CA and T8.CB Number of specific fragments= 1 total=1759 # 1ln4A.49.49 read from T0191.t2k.frag # found chain 1ln4A in template set T0191 49 :IIANRTVEK 1ln4A 50 :KIATEDRET Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.82797 Ang T7.CG2 and K10.CD other bump:2.19429 Ang N5.OD1 and T7.O other bump:2.87175 Ang N5.CG and T7.N Number of specific fragments= 1 total=1760 # 1uaaA.49.50 read from T0191.t2k.frag # found chain 1uaaA in template set T0191 49 :IIANRTVEK 1uaaA 51 :AAVTFTNKA Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.77984 Ang N5.ND2 and K10.CD other bump:2.75674 Ang N5.ND2 and K10.CG other bump:2.54554 Ang N5.ND2 and K10.CB other bump:2.15786 Ang N5.OD1 and T7.N Number of specific fragments= 1 total=1761 # 6ldh.49.49 read from T0191.t2k.frag # found chain 6ldh in template set T0191 49 :I 6ldh 49 :A Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 3 residues T0191 52 :NRTVEK 6ldh 52 :DVMEDK Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 8 residues neighbor-bump: 2.67566 Ang V5.CG2 and E6.N self-bump: 1.38533 Ang V5.CA and V5.CB other bump:2.15593 Ang N2.OD1 and T4.N Number of specific fragments= 2 total=1763 Number of alignments=292 # 1a8l.49.57 read from T0191.t2k.frag # found chain 1a8l in template set T0191 49 :IIANRTVEK 1a8l 58 :EIVDFDTPE Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1764 # 1fr9A.49.50 read from T0191.t2k.frag # found chain 1fr9A in template set T0191 49 :IIANRTVEK 1fr9A 51 :VVNANRHQE Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.46584 Ang R6.C and E9.OE2 other bump:2.6836 Ang N5.ND2 and E9.CG neighbor-bump: 2.71804 Ang I2.CG2 and I3.N Number of specific fragments= 1 total=1765 # 1qhhA.49.59 read from T0191.t2k.frag # found chain 1qhhA in template set T0191 49 :IIANRTVEK 1qhhA 60 :LAITFTNKA Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.22411 Ang N5.ND2 and G11.CA other bump:2.36638 Ang N5.ND2 and G11.N Number of specific fragments= 1 total=1766 # 1ln4A.50.50 read from T0191.t2k.frag # found chain 1ln4A in template set T0191 50 :IANRTVEKA 1ln4A 51 :IATEDRETK Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.82797 Ang T6.CG2 and K9.CD other bump:2.19429 Ang N4.OD1 and T6.O other bump:2.87175 Ang N4.CG and T6.N Number of specific fragments= 1 total=1767 # 1uaaA.50.51 read from T0191.t2k.frag # found chain 1uaaA in template set T0191 50 :IANRTVEKA 1uaaA 52 :AVTFTNKAA Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.54032 Ang N4.ND2 and K9.CB other bump:2.15786 Ang N4.OD1 and T6.N Number of specific fragments= 1 total=1768 # 1a8l.50.58 read from T0191.t2k.frag # found chain 1a8l in template set T0191 50 :IANRTVEKA 1a8l 59 :IVDFDTPEG Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.82235 Ang N4.O and A10.CB other bump:2.65363 Ang N4.C and A10.CB Number of specific fragments= 1 total=1769 # 6ldh.50.50 read from T0191.t2k.frag # found chain 6ldh in template set T0191 52 :NRTVEKA 6ldh 52 :DVMEDKL Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 9 residues neighbor-bump: 2.67566 Ang V5.CG2 and E6.N self-bump: 1.38533 Ang V5.CA and V5.CB other bump:2.15593 Ang N2.OD1 and T4.N Number of specific fragments= 1 total=1770 # 1ga3A.50.54 read from T0191.t2k.frag # adding 1ga3A to template set 1ga3A:# found chain 1ga3A in template set T0191 50 :IANRTVEKA 1ga3A 55 :SGCSAIEKT Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.65879 Ang N4.C and R5.CB self-bump: 1.33607 Ang N4.CA and N4.CB neighbor-bump: 2.04795 Ang I2.O and A3.CB neighbor-bump: 2.38822 Ang I2.C and A3.CB Number of specific fragments= 1 total=1771 # 1h6pA.50.52 read from T0191.t2k.frag # found chain 1h6pA in template set T0191 53 :RTVEKA 1h6pA 98 :SRLLRV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 8 residues Number of specific fragments= 1 total=1772 # 1ln4A.51.51 read from T0191.t2k.frag # found chain 1ln4A in template set T0191 51 :ANRTVEKAE 1ln4A 52 :ATEDRETKT Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.82797 Ang T5.CG2 and K8.CD other bump:2.19429 Ang N3.OD1 and T5.O other bump:2.87175 Ang N3.CG and T5.N Number of specific fragments= 1 total=1773 # 1uaaA.51.52 read from T0191.t2k.frag # found chain 1uaaA in template set T0191 51 :ANRTVEKAE 1uaaA 53 :VTFTNKAAR Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.54032 Ang N3.ND2 and K8.CB other bump:2.15786 Ang N3.OD1 and T5.N Number of specific fragments= 1 total=1774 # 1a8l.51.59 read from T0191.t2k.frag # found chain 1a8l in template set T0191 51 :ANRTVEKAE 1a8l 60 :VDFDTPEGK Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.82235 Ang N3.O and A9.CB other bump:2.65363 Ang N3.C and A9.CB Number of specific fragments= 1 total=1775 # 1ga3A.51.55 read from T0191.t2k.frag # found chain 1ga3A in template set T0191 51 :ANRTVEKAE 1ga3A 56 :GCSAIEKTQ Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.65879 Ang N3.C and R4.CB self-bump: 1.33607 Ang N3.CA and N3.CB neighbor-bump: 2.04795 Ang G1.O and A2.CB neighbor-bump: 2.38822 Ang G1.C and A2.CB Number of specific fragments= 1 total=1776 # 6ldh.51.51 read from T0191.t2k.frag # found chain 6ldh in template set T0191 52 :NRTVEKAE 6ldh 52 :DVMEDKLK Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 10 residues neighbor-bump: 2.67566 Ang V5.CG2 and E6.N self-bump: 1.38533 Ang V5.CA and V5.CB other bump:2.15593 Ang N2.OD1 and T4.N Number of specific fragments= 1 total=1777 # 1j7lA.51.52 read from T0191.t2k.frag # adding 1j7lA to template set 1j7lA:# found chain 1j7lA in template set T0191 51 :ANRTVEKAE 1j7lA 53 :TTYDVEREK Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues self-bump: 1.23524 Ang A9.N and A9.CA Number of specific fragments= 1 total=1778 # 1ln4A.52.52 read from T0191.t2k.frag # found chain 1ln4A in template set T0191 52 :NRTVEKAEA 1ln4A 53 :TEDRETKTL Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.82797 Ang T4.CG2 and K7.CD other bump:2.90101 Ang N2.ND2 and K7.CD other bump:2.72446 Ang N2.ND2 and K7.CB other bump:2.71725 Ang N2.OD1 and T4.CA other bump:1.98613 Ang N2.OD1 and T4.N Number of specific fragments= 1 total=1779 # 1ga3A.52.56 read from T0191.t2k.frag # found chain 1ga3A in template set T0191 52 :NRTVEKAEA 1ga3A 57 :CSAIEKTQR Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.65877 Ang N2.C and R3.CB self-bump: 1.34242 Ang N2.CA and N2.CB Number of specific fragments= 1 total=1780 # 1uaaA.52.53 read from T0191.t2k.frag # found chain 1uaaA in template set T0191 52 :NRTVEKAEA 1uaaA 54 :TFTNKAARE Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.23495 Ang N2.ND2 and A8.CB Number of specific fragments= 1 total=1781 # 1a8l.52.60 read from T0191.t2k.frag # found chain 1a8l in template set T0191 52 :NRTVEKAEA 1a8l 61 :DFDTPEGKE Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.82235 Ang N2.O and A8.CB other bump:2.65363 Ang N2.C and A8.CB Number of specific fragments= 1 total=1782 # 1j7lA.52.53 read from T0191.t2k.frag # found chain 1j7lA in template set T0191 52 :NRTVEKAEA 1j7lA 54 :TYDVEREKD Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues self-bump: 1.23524 Ang A8.N and A8.CA Number of specific fragments= 1 total=1783 # 1ja9A.52.52 read from T0191.t2k.frag # found chain 1ja9A in template set T0191 52 :NRTVEKAEA 1ja9A 61 :GSSSKAAEE Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues self-bump: 1.34689 Ang N2.CA and N2.CB Number of specific fragments= 1 total=1784 # 1ln4A.53.53 read from T0191.t2k.frag # found chain 1ln4A in template set T0191 53 :RTVEKAEAL 1ln4A 54 :EDRETKTLI Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.82797 Ang T3.CG2 and K6.CD Number of specific fragments= 1 total=1785 # 1ga3A.53.57 read from T0191.t2k.frag # found chain 1ga3A in template set T0191 53 :RTVEKAEAL 1ga3A 58 :SAIEKTQRM Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1786 # 1uaaA.53.54 read from T0191.t2k.frag # found chain 1uaaA in template set T0191 53 :RTVEKAEAL 1uaaA 55 :FTNKAAREM Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1787 # 1j7lA.53.54 read from T0191.t2k.frag # found chain 1j7lA in template set T0191 53 :RTVEKAEAL 1j7lA 55 :YDVEREKDM Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues self-bump: 1.23524 Ang A7.N and A7.CA Number of specific fragments= 1 total=1788 # 1a8l.53.61 read from T0191.t2k.frag # found chain 1a8l in template set T0191 53 :RTVEKAEAL 1a8l 62 :FDTPEGKEL Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.82235 Ang G1.O and A7.CB other bump:2.65363 Ang G1.C and A7.CB Number of specific fragments= 1 total=1789 # 1ja9A.53.53 read from T0191.t2k.frag # found chain 1ja9A in template set T0191 53 :RTVEKAEAL 1ja9A 62 :SSSKAAEEV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1790 # 1ln4A.54.54 read from T0191.t2k.frag # found chain 1ln4A in template set T0191 54 :TVEKAEALA 1ln4A 55 :DRETKTLIV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1791 # 1ga3A.54.58 read from T0191.t2k.frag # found chain 1ga3A in template set T0191 54 :TVEKAEALA 1ga3A 59 :AIEKTQRML Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1792 # 1j7lA.54.55 read from T0191.t2k.frag # found chain 1j7lA in template set T0191 54 :TVEKAEALA 1j7lA 56 :DVEREKDMM Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues self-bump: 1.23524 Ang A6.N and A6.CA Number of specific fragments= 1 total=1793 # 1uaaA.54.55 read from T0191.t2k.frag # found chain 1uaaA in template set T0191 54 :TVEKAEALA 1uaaA 56 :TNKAAREMK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1794 # 1a8l.54.62 read from T0191.t2k.frag # found chain 1a8l in template set T0191 54 :TVEKAEALA 1a8l 63 :DTPEGKELA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1795 # 1ja9A.54.54 read from T0191.t2k.frag # found chain 1ja9A in template set T0191 54 :TVEKAEALA 1ja9A 63 :SSKAAEEVV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1796 # 1ln4A.55.55 read from T0191.t2k.frag # found chain 1ln4A in template set T0191 55 :VEKAEALAK 1ln4A 56 :RETKTLIVE Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1797 # 1ga3A.55.59 read from T0191.t2k.frag # found chain 1ga3A in template set T0191 55 :VEKAEALAK 1ga3A 60 :IEKTQRMLS Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1798 # 1j7lA.55.56 read from T0191.t2k.frag # found chain 1j7lA in template set T0191 55 :VEKAEALAK 1j7lA 57 :VEREKDMML Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues self-bump: 1.23524 Ang A5.N and A5.CA Number of specific fragments= 1 total=1799 # 1uaaA.55.56 read from T0191.t2k.frag # found chain 1uaaA in template set T0191 55 :VEKAEALAK 1uaaA 57 :NKAAREMKE Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues self-bump: 1.38881 Ang K10.CA and K10.CB Number of specific fragments= 1 total=1800 # 1a8l.55.63 read from T0191.t2k.frag # found chain 1a8l in template set T0191 55 :VEKAEALAK 1a8l 64 :TPEGKELAK Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.82924 Ang V2.CG1 and K4.N Number of specific fragments= 1 total=1801 # 1ja9A.55.55 read from T0191.t2k.frag # found chain 1ja9A in template set T0191 55 :VEKAEALAK 1ja9A 64 :SKAAEEVVA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1802 # 1ln4A.56.56 read from T0191.t2k.frag # found chain 1ln4A in template set T0191 56 :EKAEALAKE 1ln4A 57 :ETKTLIVEA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1803 # 1ga3A.56.60 read from T0191.t2k.frag # found chain 1ga3A in template set T0191 56 :EKAEALAKE 1ga3A 61 :EKTQRMLSG Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.49041 Ang L7.O and E10.OE2 other bump:2.25451 Ang L7.C and E10.OE2 other bump:2.61651 Ang L7.CA and E10.OE2 other bump:1.78239 Ang L7.O and E10.OE1 other bump:1.80471 Ang L7.C and E10.OE1 other bump:2.16497 Ang A6.O and E10.OE1 other bump:2.007 Ang L7.CA and E10.OE1 other bump:1.43838 Ang L7.O and E10.CD other bump:2.18353 Ang L7.C and E10.CD other bump:2.59895 Ang L7.CA and E10.CD Number of specific fragments= 1 total=1804 # 1j7lA.56.57 read from T0191.t2k.frag # found chain 1j7lA in template set T0191 56 :EKAEALAKE 1j7lA 58 :EREKDMMLW Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.81548 Ang E5.CD and K9.NZ other bump:1.86475 Ang E5.OE2 and K9.NZ other bump:1.77559 Ang E5.OE2 and K9.CE self-bump: 1.23524 Ang A4.N and A4.CA Number of specific fragments= 1 total=1805 # 1uaaA.56.57 read from T0191.t2k.frag # found chain 1uaaA in template set T0191 56 :EKAEALAKE 1uaaA 58 :KAAREMKER Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.3404 Ang A6.O and E10.OE1 self-bump: 1.38882 Ang K9.CA and K9.CB Number of specific fragments= 1 total=1806 # 1a8l.56.64 read from T0191.t2k.frag # found chain 1a8l in template set T0191 56 :EKAEALAKE 1a8l 65 :PEGKELAKR Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1807 # 1ja9A.56.56 read from T0191.t2k.frag # found chain 1ja9A in template set T0191 56 :EKAEALAKE 1ja9A 65 :KAAEEVVAE Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1808 # 1ln4A.57.57 read from T0191.t2k.frag # found chain 1ln4A in template set T0191 57 :KAEALAKEI 1ln4A 58 :TKTLIVEAI Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1809 # 1ga3A.57.61 read from T0191.t2k.frag # found chain 1ga3A in template set T0191 57 :KAEALAKEI 1ga3A 62 :KTQRMLSGF Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.61651 Ang L6.CA and E9.OE2 other bump:1.4904 Ang L6.O and E9.OE2 other bump:2.2545 Ang L6.C and E9.OE2 other bump:2.007 Ang L6.CA and E9.OE1 other bump:1.78239 Ang L6.O and E9.OE1 other bump:1.80471 Ang L6.C and E9.OE1 other bump:2.16497 Ang A5.O and E9.OE1 other bump:2.59895 Ang L6.CA and E9.CD other bump:1.43836 Ang L6.O and E9.CD other bump:2.18352 Ang L6.C and E9.CD Number of specific fragments= 1 total=1810 # 1j7lA.57.58 read from T0191.t2k.frag # found chain 1j7lA in template set T0191 57 :KAEALAKEI 1j7lA 59 :REKDMMLWL Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.4228 Ang L6.O and I10.CD1 other bump:2.26068 Ang L6.O and I10.CG1 other bump:2.61741 Ang L6.O and I10.CB other bump:2.81548 Ang E4.CD and K8.NZ other bump:1.86475 Ang E4.OE2 and K8.NZ other bump:1.77559 Ang E4.OE2 and K8.CE self-bump: 1.23524 Ang A3.N and A3.CA Number of specific fragments= 1 total=1811 # 1uaaA.57.58 read from T0191.t2k.frag # found chain 1uaaA in template set T0191 57 :KAEALAKEI 1uaaA 59 :AAREMKERV Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues self-bump: 1.38882 Ang K8.CA and K8.CB Number of specific fragments= 1 total=1812 # 1a8l.57.65 read from T0191.t2k.frag # found chain 1a8l in template set T0191 57 :KAEALAKEI 1a8l 66 :EGKELAKRY Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1813 # 1ja9A.57.57 read from T0191.t2k.frag # found chain 1ja9A in template set T0191 57 :KAEALAKEI 1ja9A 66 :AAEEVVAEL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1814 # 1ln4A.58.58 read from T0191.t2k.frag # found chain 1ln4A in template set T0191 58 :AEALAKEIA 1ln4A 59 :KTLIVEAIV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1815 # 1ga3A.58.62 read from T0191.t2k.frag # found chain 1ga3A in template set T0191 58 :AEALAKEIA 1ga3A 63 :TQRMLSGFC Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.61651 Ang L5.CA and E8.OE2 other bump:1.4904 Ang L5.O and E8.OE2 other bump:2.2545 Ang L5.C and E8.OE2 other bump:2.007 Ang L5.CA and E8.OE1 other bump:1.78239 Ang L5.O and E8.OE1 other bump:1.80471 Ang L5.C and E8.OE1 other bump:2.16497 Ang A4.O and E8.OE1 other bump:2.59895 Ang L5.CA and E8.CD other bump:1.43836 Ang L5.O and E8.CD other bump:2.18352 Ang L5.C and E8.CD Number of specific fragments= 1 total=1816 # 1j7lA.58.59 read from T0191.t2k.frag # found chain 1j7lA in template set T0191 58 :AEALAKEIA 1j7lA 60 :EKDMMLWLE Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.42279 Ang L5.O and I9.CD1 other bump:2.26068 Ang L5.O and I9.CG1 other bump:2.61741 Ang L5.O and I9.CB other bump:2.81548 Ang E3.CD and K7.NZ other bump:1.86475 Ang E3.OE2 and K7.NZ other bump:1.77559 Ang E3.OE2 and K7.CE self-bump: 1.23524 Ang A2.N and A2.CA Number of specific fragments= 1 total=1817 # 1uaaA.58.59 read from T0191.t2k.frag # found chain 1uaaA in template set T0191 58 :AEALAKEIA 1uaaA 60 :AREMKERVG Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.60987 Ang A6.O and A10.CB self-bump: 1.38882 Ang K7.CA and K7.CB Number of specific fragments= 1 total=1818 # 1a8l.58.66 read from T0191.t2k.frag # found chain 1a8l in template set T0191 58 :AEALAKEIA 1a8l 67 :GKELAKRYR Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1819 # 1f1eA.58.62 read from T0191.t2k.frag # adding 1f1eA to template set 1f1eA:Skipped atom 32, because occupancy 0.15 <= existing 0.850001 Skipped atom 34, because occupancy 0.15 <= existing 0.850001 Skipped atom 272, because occupancy 0.25 <= existing 0.750001 Skipped atom 274, because occupancy 0.25 <= existing 0.750001 Skipped atom 276, because occupancy 0.25 <= existing 0.750001 Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 283, because occupancy 0.39 <= existing 0.610001 Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 285, because occupancy 0.39 <= existing 0.610001 Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 287, because occupancy 0.39 <= existing 0.610001 Skipped atom 331, because occupancy 0.45 <= existing 0.560001 Skipped atom 365, because occupancy 0.5 <= existing 0.500001 Skipped atom 367, because occupancy 0.5 <= existing 0.500001 Skipped atom 369, because occupancy 0.5 <= existing 0.500001 Skipped atom 371, because occupancy 0.5 <= existing 0.500001 Skipped atom 373, because occupancy 0.5 <= existing 0.500001 Skipped atom 375, because occupancy 0.5 <= existing 0.500001 Skipped atom 377, because occupancy 0.5 <= existing 0.500001 Skipped atom 379, because occupancy 0.5 <= existing 0.500001 Skipped atom 381, because occupancy 0.5 <= existing 0.500001 Skipped atom 383, because occupancy 0.5 <= existing 0.500001 Skipped atom 385, because occupancy 0.5 <= existing 0.500001 Skipped atom 387, because occupancy 0.5 <= existing 0.500001 Skipped atom 389, because occupancy 0.5 <= existing 0.500001 Skipped atom 391, because occupancy 0.5 <= existing 0.500001 Skipped atom 393, because occupancy 0.5 <= existing 0.500001 Skipped atom 395, because occupancy 0.5 <= existing 0.500001 Skipped atom 397, because occupancy 0.5 <= existing 0.500001 Skipped atom 399, because occupancy 0.5 <= existing 0.500001 Skipped atom 401, because occupancy 0.5 <= existing 0.500001 Skipped atom 403, because occupancy 0.5 <= existing 0.500001 Skipped atom 405, because occupancy 0.5 <= existing 0.500001 Skipped atom 407, because occupancy 0.5 <= existing 0.500001 Skipped atom 409, because occupancy 0.5 <= existing 0.500001 Skipped atom 411, because occupancy 0.5 <= existing 0.500001 Skipped atom 413, because occupancy 0.5 <= existing 0.500001 Skipped atom 415, because occupancy 0.5 <= existing 0.500001 Skipped atom 417, because occupancy 0.5 <= existing 0.500001 Skipped atom 419, because occupancy 0.5 <= existing 0.500001 Skipped atom 421, because occupancy 0.5 <= existing 0.500001 Skipped atom 423, because occupancy 0.5 <= existing 0.500001 Skipped atom 425, because occupancy 0.5 <= existing 0.500001 Skipped atom 427, because occupancy 0.5 <= existing 0.500001 Skipped atom 429, because occupancy 0.5 <= existing 0.500001 Skipped atom 431, because occupancy 0.5 <= existing 0.500001 Skipped atom 433, because occupancy 0.5 <= existing 0.500001 Skipped atom 435, because occupancy 0.5 <= existing 0.500001 Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 488, because occupancy 0.4 <= existing 0.600001 Skipped atom 490, because occupancy 0.4 <= existing 0.600001 Skipped atom 492, because occupancy 0.4 <= existing 0.600001 Skipped atom 494, because occupancy 0.4 <= existing 0.600001 Skipped atom 496, because occupancy 0.4 <= existing 0.600001 Skipped atom 498, because occupancy 0.4 <= existing 0.600001 Skipped atom 535, because occupancy 0.59 <= existing 0.660001 Skipped atom 536, because occupancy 0.23 <= existing 0.660001 Skipped atom 538, because occupancy 0.59 <= existing 0.660001 Skipped atom 539, because occupancy 0.23 <= existing 0.660001 Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 560, because occupancy 0.41 <= existing 0.590001 Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 562, because occupancy 0.41 <= existing 0.590001 Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 564, because occupancy 0.41 <= existing 0.590001 Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 566, because occupancy 0.41 <= existing 0.590001 Skipped atom 665, because occupancy 0.38 <= existing 0.620001 Skipped atom 667, because occupancy 0.38 <= existing 0.620001 Skipped atom 669, because occupancy 0.38 <= existing 0.620001 Skipped atom 671, because occupancy 0.38 <= existing 0.620001 Skipped atom 673, because occupancy 0.38 <= existing 0.620001 Skipped atom 675, because occupancy 0.38 <= existing 0.620001 Skipped atom 677, because occupancy 0.38 <= existing 0.620001 Skipped atom 713, because occupancy 0.37 <= existing 0.630001 Skipped atom 715, because occupancy 0.37 <= existing 0.630001 Skipped atom 717, because occupancy 0.37 <= existing 0.630001 Skipped atom 719, because occupancy 0.37 <= existing 0.630001 Skipped atom 721, because occupancy 0.37 <= existing 0.630001 Skipped atom 723, because occupancy 0.37 <= existing 0.630001 Skipped atom 725, because occupancy 0.37 <= existing 0.630001 Skipped atom 752, because occupancy 0.45 <= existing 0.550001 Skipped atom 754, because occupancy 0.45 <= existing 0.550001 Skipped atom 756, because occupancy 0.45 <= existing 0.550001 Skipped atom 758, because occupancy 0.45 <= existing 0.550001 Skipped atom 760, because occupancy 0.45 <= existing 0.550001 Skipped atom 762, because occupancy 0.45 <= existing 0.550001 Skipped atom 764, because occupancy 0.45 <= existing 0.550001 Skipped atom 792, because occupancy 0.36 <= existing 0.640001 Skipped atom 794, because occupancy 0.36 <= existing 0.640001 Skipped atom 796, because occupancy 0.36 <= existing 0.640001 Skipped atom 798, because occupancy 0.36 <= existing 0.640001 Skipped atom 800, because occupancy 0.36 <= existing 0.640001 Skipped atom 802, because occupancy 0.36 <= existing 0.640001 Skipped atom 804, because occupancy 0.36 <= existing 0.640001 Skipped atom 945, because occupancy 0.43 <= existing 0.570001 Skipped atom 947, because occupancy 0.43 <= existing 0.570001 Skipped atom 949, because occupancy 0.43 <= existing 0.570001 Skipped atom 951, because occupancy 0.43 <= existing 0.570001 Skipped atom 1124, because occupancy 0.47 <= existing 0.540001 Skipped atom 1126, because occupancy 0.47 <= existing 0.540001 Skipped atom 1128, because occupancy 0.47 <= existing 0.540001 Skipped atom 1130, because occupancy 0.47 <= existing 0.540001 Skipped atom 1132, because occupancy 0.47 <= existing 0.540001 Skipped atom 1151, because occupancy 0.38 <= existing 0.620001 Skipped atom 1153, because occupancy 0.38 <= existing 0.620001 Skipped atom 1155, because occupancy 0.38 <= existing 0.620001 Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 1179, because occupancy 0.49 <= existing 0.510001 Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 1181, because occupancy 0.49 <= existing 0.510001 Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 1183, because occupancy 0.49 <= existing 0.510001 Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 1185, because occupancy 0.49 <= existing 0.510001 Skipped atom 1191, because occupancy 0.48 <= existing 0.520001 Skipped atom 1193, because occupancy 0.48 <= existing 0.520001 Skipped atom 1195, because occupancy 0.48 <= existing 0.520001 # found chain 1f1eA in template set T0191 58 :AEALAKEIA 1f1eA 63 :LKALADVLM Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1820 # 1ln4A.59.59 read from T0191.t2k.frag # found chain 1ln4A in template set T0191 59 :EALAKEIAE 1ln4A 60 :TLIVEAIVR Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1821 # 1ga3A.59.63 read from T0191.t2k.frag # found chain 1ga3A in template set T0191 59 :EALAKEIAE 1ga3A 64 :QRMLSGFCP Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.61651 Ang L4.CA and E7.OE2 other bump:1.4904 Ang L4.O and E7.OE2 other bump:2.2545 Ang L4.C and E7.OE2 other bump:2.007 Ang L4.CA and E7.OE1 other bump:1.78239 Ang L4.O and E7.OE1 other bump:1.80471 Ang L4.C and E7.OE1 other bump:2.16497 Ang A3.O and E7.OE1 other bump:2.59895 Ang L4.CA and E7.CD other bump:1.43836 Ang L4.O and E7.CD other bump:2.18352 Ang L4.C and E7.CD Number of specific fragments= 1 total=1822 # 1j7lA.59.60 read from T0191.t2k.frag # found chain 1j7lA in template set T0191 59 :EALAKEIAE 1j7lA 61 :KDMMLWLEG Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.42279 Ang L4.O and I8.CD1 other bump:2.26068 Ang L4.O and I8.CG1 other bump:2.61741 Ang L4.O and I8.CB other bump:2.81548 Ang E2.CD and K6.NZ other bump:1.86475 Ang E2.OE2 and K6.NZ other bump:1.77558 Ang E2.OE2 and K6.CE Number of specific fragments= 1 total=1823 # 1uaaA.59.60 read from T0191.t2k.frag # found chain 1uaaA in template set T0191 59 :EALAKEIAE 1uaaA 61 :REMKERVGQ Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.60987 Ang A5.O and A9.CB self-bump: 1.38882 Ang K6.CA and K6.CB Number of specific fragments= 1 total=1824 # 1a8l.59.67 read from T0191.t2k.frag # found chain 1a8l in template set T0191 59 :EALAKEIAE 1a8l 68 :KELAKRYRI Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1825 # 1f1eA.59.63 read from T0191.t2k.frag # found chain 1f1eA in template set T0191 59 :EALAKEIAE 1f1eA 64 :KALADVLMV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1826 # 1ln4A.60.60 read from T0191.t2k.frag # found chain 1ln4A in template set T0191 60 :ALAKEIAEK 1ln4A 61 :LIVEAIVRE Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1827 # 1ga3A.60.64 read from T0191.t2k.frag # found chain 1ga3A in template set T0191 60 :ALAKEIAEK 1ga3A 65 :RMLSGFCPH Fragment has 14 clashes (null) has 14 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.38191 Ang E9.O and K10.CG other bump:2.2331 Ang I7.O and E9.OE2 other bump:2.09471 Ang I7.O and E9.OE1 other bump:2.12785 Ang I7.O and E9.CD other bump:2.61651 Ang L3.CA and E6.OE2 other bump:1.4904 Ang L3.O and E6.OE2 other bump:2.2545 Ang L3.C and E6.OE2 other bump:2.007 Ang L3.CA and E6.OE1 other bump:1.78239 Ang L3.O and E6.OE1 other bump:1.80471 Ang L3.C and E6.OE1 other bump:2.16497 Ang A2.O and E6.OE1 other bump:2.59895 Ang L3.CA and E6.CD other bump:1.43836 Ang L3.O and E6.CD other bump:2.18352 Ang L3.C and E6.CD Number of specific fragments= 1 total=1828 # 1j7lA.60.61 read from T0191.t2k.frag # found chain 1j7lA in template set T0191 60 :ALAKEIAEK 1j7lA 62 :DMMLWLEGK Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.42279 Ang L3.O and I7.CD1 other bump:2.26068 Ang L3.O and I7.CG1 other bump:2.61741 Ang L3.O and I7.CB Number of specific fragments= 1 total=1829 # 1uaaA.60.61 read from T0191.t2k.frag # found chain 1uaaA in template set T0191 60 :ALAKEIAEK 1uaaA 62 :EMKERVGQT Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.60987 Ang A4.O and A8.CB self-bump: 1.38882 Ang K5.CA and K5.CB Number of specific fragments= 1 total=1830 # 1ln4A.60.61 read from T0191.t2k.frag # found chain 1ln4A in template set T0191 60 :ALAKEIAEK 1ln4A 62 :IVEAIVRET Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1831 # 1ja9A.60.60 read from T0191.t2k.frag # found chain 1ja9A in template set T0191 60 :ALAKEIAEK 1ja9A 69 :EVVAELKKL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1832 # 1ln4A.61.61 read from T0191.t2k.frag # found chain 1ln4A in template set T0191 61 :LAKEIAEKL 1ln4A 62 :IVEAIVRET Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1833 # 1ga3A.61.65 read from T0191.t2k.frag # found chain 1ga3A in template set T0191 61 :LAKEIAEKL 1ga3A 66 :MLSGFCPHK Fragment has 14 clashes (null) has 14 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.38192 Ang E8.O and K9.CG other bump:2.2331 Ang I6.O and E8.OE2 other bump:2.09471 Ang I6.O and E8.OE1 other bump:2.12785 Ang I6.O and E8.CD other bump:2.61651 Ang L2.CA and E5.OE2 other bump:2.2545 Ang L2.C and E5.OE2 other bump:1.4904 Ang L2.O and E5.OE2 other bump:2.007 Ang L2.CA and E5.OE1 other bump:1.80471 Ang L2.C and E5.OE1 other bump:1.78239 Ang L2.O and E5.OE1 other bump:2.16497 Ang G1.O and E5.OE1 other bump:2.59895 Ang L2.CA and E5.CD other bump:2.18352 Ang L2.C and E5.CD other bump:1.43836 Ang L2.O and E5.CD Number of specific fragments= 1 total=1834 # 1j7lA.61.62 read from T0191.t2k.frag # found chain 1j7lA in template set T0191 61 :LAKEIAEKL 1j7lA 63 :MMLWLEGKL Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.42279 Ang L2.O and I6.CD1 other bump:2.26068 Ang L2.O and I6.CG1 other bump:2.61741 Ang L2.O and I6.CB Number of specific fragments= 1 total=1835 # 1ln4A.61.62 read from T0191.t2k.frag # found chain 1ln4A in template set T0191 61 :LAKEIAEKL 1ln4A 63 :VEAIVRETG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1836 # 1uaaA.61.62 read from T0191.t2k.frag # found chain 1uaaA in template set T0191 61 :LAKEIAEKL 1uaaA 63 :MKERVGQTL Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.36145 Ang A7.O and L10.O other bump:2.60987 Ang A3.O and A7.CB self-bump: 1.38882 Ang K4.CA and K4.CB Number of specific fragments= 1 total=1837 # 1ja9A.61.61 read from T0191.t2k.frag # found chain 1ja9A in template set T0191 61 :LAKEIAEKL 1ja9A 70 :VVAELKKLG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1838 # 1ln4A.62.62 read from T0191.t2k.frag # found chain 1ln4A in template set T0191 62 :AKEIAEKLN 1ln4A 63 :VEAIVRETG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1839 # 1j7lA.62.63 read from T0191.t2k.frag # found chain 1j7lA in template set T0191 62 :AKEIAEKLN 1j7lA 64 :MLWLEGKLP Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.42279 Ang G1.O and I5.CD1 other bump:2.26068 Ang G1.O and I5.CG1 other bump:2.61741 Ang G1.O and I5.CB Number of specific fragments= 1 total=1840 # 1ga3A.62.66 read from T0191.t2k.frag # found chain 1ga3A in template set T0191 62 :AKEIAEKLN 1ga3A 67 :LSGFCPHKV Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.38192 Ang E7.O and K8.CG other bump:2.2331 Ang I5.O and E7.OE2 other bump:2.09471 Ang I5.O and E7.OE1 other bump:2.12785 Ang I5.O and E7.CD other bump:1.4904 Ang G1.O and E4.OE2 other bump:2.2545 Ang G1.C and E4.OE2 other bump:1.78239 Ang G1.O and E4.OE1 other bump:1.80471 Ang G1.C and E4.OE1 other bump:1.43836 Ang G1.O and E4.CD other bump:2.18352 Ang G1.C and E4.CD Number of specific fragments= 1 total=1841 # 1ln4A.62.63 read from T0191.t2k.frag # found chain 1ln4A in template set T0191 62 :AKEIAEKLN 1ln4A 64 :EAIVRETGA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1842 # 1ja9A.62.62 read from T0191.t2k.frag # found chain 1ja9A in template set T0191 62 :AKEIAEKLN 1ja9A 71 :VAELKKLGA Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:3.05408 Ang I5.CG2 and N10.C other bump:2.73252 Ang I5.CG2 and N10.CB Number of specific fragments= 1 total=1843 # 1uaaA.62.63 read from T0191.t2k.frag # found chain 1uaaA in template set T0191 62 :AKEIAEKLN 1uaaA 64 :KERVGQTLG Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.36145 Ang A6.O and L9.O other bump:2.60987 Ang A2.O and A6.CB self-bump: 1.38882 Ang K3.CA and K3.CB Number of specific fragments= 1 total=1844 # 1ln4A.63.63 read from T0191.t2k.frag # found chain 1ln4A in template set T0191 63 :KEIAEKLNK 1ln4A 64 :EAIVRETGA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1845 # 1j7lA.63.64 read from T0191.t2k.frag # found chain 1j7lA in template set T0191 63 :KEIAEKLNK 1j7lA 65 :LWLEGKLPV Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.48537 Ang I4.CG2 and K10.CG Number of specific fragments= 1 total=1846 # 1ga3A.63.67 read from T0191.t2k.frag # found chain 1ga3A in template set T0191 63 :KEIAEKLNK 1ga3A 68 :SGFCPHKVS Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.20736 Ang K10.CB and G11.N self-bump: 2.20325 Ang K10.CB and K10.C neighbor-bump: 2.38192 Ang E6.O and K7.CG other bump:2.2331 Ang I4.O and E6.OE2 other bump:2.09471 Ang I4.O and E6.OE1 other bump:2.12785 Ang I4.O and E6.CD Number of specific fragments= 1 total=1847 # 1ja9A.63.63 read from T0191.t2k.frag # found chain 1ja9A in template set T0191 63 :KEIAEKLNK 1ja9A 72 :AELKKLGAQ Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:3.05408 Ang I4.CG2 and N9.C Number of specific fragments= 1 total=1848 # 1ln4A.63.64 read from T0191.t2k.frag # found chain 1ln4A in template set T0191 63 :KEIAEKLNK 1ln4A 65 :AIVRETGAC Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1849 # 1gvfA.63.66 read from T0191.t2k.frag # adding 1gvfA to template set 1gvfA:Skipped atom 253, because occupancy 0.4 <= existing 0.600001 Skipped atom 254, because occupancy 0.4 <= existing 0.600001 Skipped atom 291, because occupancy 0.4 <= existing 0.600001 Skipped atom 292, because occupancy 0.4 <= existing 0.600001 Skipped atom 321, because occupancy 0.4 <= existing 0.600001 Skipped atom 322, because occupancy 0.4 <= existing 0.600001 Skipped atom 323, because occupancy 0.4 <= existing 0.600001 Skipped atom 324, because occupancy 0.4 <= existing 0.600001 Skipped atom 325, because occupancy 0.4 <= existing 0.600001 Skipped atom 326, because occupancy 0.4 <= existing 0.600001 Skipped atom 327, because occupancy 0.4 <= existing 0.600001 Skipped atom 436, because occupancy 0.4 <= existing 0.600001 Skipped atom 710, because occupancy 0.5 <= existing 0.500001 Skipped atom 711, because occupancy 0.5 <= existing 0.500001 Skipped atom 712, because occupancy 0.5 <= existing 0.500001 Skipped atom 713, because occupancy 0.5 <= existing 0.500001 Skipped atom 714, because occupancy 0.5 <= existing 0.500001 Skipped atom 715, because occupancy 0.5 <= existing 0.500001 Skipped atom 716, because occupancy 0.5 <= existing 0.500001 Skipped atom 770, because occupancy 0.4 <= existing 0.600001 Skipped atom 771, because occupancy 0.4 <= existing 0.600001 Skipped atom 772, because occupancy 0.4 <= existing 0.600001 Skipped atom 1154, because occupancy 0.5 <= existing 0.500001 Skipped atom 1155, because occupancy 0.5 <= existing 0.500001 Skipped atom 1156, because occupancy 0.5 <= existing 0.500001 Skipped atom 1157, because occupancy 0.5 <= existing 0.500001 Skipped atom 1158, because occupancy 0.5 <= existing 0.500001 # found chain 1gvfA in template set T0191 63 :KEIAEKLNK 1gvfA 67 :SAYSTTYNM Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1850 # 1ln4A.64.64 read from T0191.t2k.frag # found chain 1ln4A in template set T0191 64 :EIAEKLNKK 1ln4A 65 :AIVRETGAC Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.83831 Ang L7.CD2 and K9.CE Number of specific fragments= 1 total=1851 # 1j7lA.64.65 read from T0191.t2k.frag # found chain 1j7lA in template set T0191 64 :EIAEKLNKK 1j7lA 66 :WLEGKLPVP Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.48536 Ang I3.CG2 and K9.CG Number of specific fragments= 1 total=1852 # 3kinB.64.65 read from T0191.t2k.frag # adding 3kinB to template set 3kinB:# found chain 3kinB in template set T0191 64 :EIAEKLNKK 3kinB 321 :GQRAKTIKN Fragment has 9 clashes (null) has 9 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.96632 Ang G1.O and E5.OE2 other bump:2.32798 Ang G1.C and E5.OE2 other bump:0.593067 Ang G1.O and E5.OE1 other bump:1.37668 Ang G1.C and E5.OE1 other bump:2.10578 Ang E2.N and E5.OE1 other bump:2.39207 Ang E2.CA and E5.OE1 other bump:2.59834 Ang E2.C and E5.OE1 other bump:1.28842 Ang G1.O and E5.CD other bump:2.09562 Ang G1.C and E5.CD Number of specific fragments= 1 total=1853 # 1ja9A.64.64 read from T0191.t2k.frag # found chain 1ja9A in template set T0191 64 :EIAEKLNKK 1ja9A 73 :ELKKLGAQG Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.91192 Ang I3.CD1 and K10.CD other bump:3.12403 Ang I3.CD1 and K10.CB other bump:3.05408 Ang I3.CG2 and N8.C Number of specific fragments= 1 total=1854 # 1ln4A.64.65 read from T0191.t2k.frag # found chain 1ln4A in template set T0191 64 :EIAEKLNKK 1ln4A 66 :IVRETGACN Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1855 # 1ga3A.64.68 read from T0191.t2k.frag # found chain 1ga3A in template set T0191 64 :EIAEKLNKK 1ga3A 69 :GFCPHKVSA Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.32584 Ang K9.CB and K10.N neighbor-bump: 2.38192 Ang E5.O and K6.CG other bump:2.2331 Ang I3.O and E5.OE2 other bump:2.09471 Ang I3.O and E5.OE1 other bump:2.12785 Ang I3.O and E5.CD Number of specific fragments= 1 total=1856 # 1ln4A.65.65 read from T0191.t2k.frag # found chain 1ln4A in template set T0191 65 :IAEKLNKKF 1ln4A 66 :IVRETGACN Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.83831 Ang L6.CD2 and K8.CE Number of specific fragments= 1 total=1857 # 1j7lA.65.66 read from T0191.t2k.frag # found chain 1j7lA in template set T0191 65 :IAEKLNKKF 1j7lA 67 :LEGKLPVPK Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.48536 Ang I2.CG2 and K8.CG Number of specific fragments= 1 total=1858 # 3kinB.65.66 read from T0191.t2k.frag # found chain 3kinB in template set T0191 65 :IAEKLNKKF 3kinB 322 :QRAKTIKNT Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.59834 Ang G1.C and E4.OE1 Number of specific fragments= 1 total=1859 # 1ja9A.65.65 read from T0191.t2k.frag # found chain 1ja9A in template set T0191 65 :IAEKLNKKF 1ja9A 74 :LKKLGAQGV Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.91193 Ang I2.CD1 and K9.CD other bump:3.12405 Ang I2.CD1 and K9.CB other bump:3.05409 Ang I2.CG2 and N7.C Number of specific fragments= 1 total=1860 # 1ln4A.65.66 read from T0191.t2k.frag # found chain 1ln4A in template set T0191 65 :IAEKLNKKF 1ln4A 67 :VRETGACNV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1861 # 6ldh.65.66 read from T0191.t2k.frag # found chain 6ldh in template set T0191 65 :IAEKLNKKF 6ldh 66 :QHGSLFLHT Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.66466 Ang G1.C and E4.OE1 Number of specific fragments= 1 total=1862 # 1ln4A.66.66 read from T0191.t2k.frag # found chain 1ln4A in template set T0191 66 :AEKLNKKFG 1ln4A 67 :VRETGACNV Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.83831 Ang L5.CD2 and K7.CE Number of specific fragments= 1 total=1863 # 3kinB.66.67 read from T0191.t2k.frag # found chain 3kinB in template set T0191 66 :AEKLNKKFG 3kinB 323 :RAKTIKNTV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1864 # 1ja9A.66.66 read from T0191.t2k.frag # found chain 1ja9A in template set T0191 66 :AEKLNKKFG 1ja9A 75 :KKLGAQGVA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1865 # 1j7lA.66.67 read from T0191.t2k.frag # found chain 1j7lA in template set T0191 66 :AEKLNKKFG 1j7lA 68 :EGKLPVPKV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1866 # 1ln4A.66.67 read from T0191.t2k.frag # found chain 1ln4A in template set T0191 66 :AEKLNKKFG 1ln4A 68 :RETGACNVQ Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1867 # 1qs0B.66.71 read from T0191.t2k.frag # adding 1qs0B to template set 1qs0B:# found chain 1qs0B in template set T0191 67 :EKLNKKFG 1qs0B 74 :AYGLRPVV Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 10 residues other bump:2.83012 Ang K6.CE and F8.CZ neighbor-bump: 1.86997 Ang K3.O and L4.CG neighbor-bump: 2.72511 Ang K3.C and L4.CG Number of specific fragments= 1 total=1868 # 1ln4A.67.67 read from T0191.t2k.frag # found chain 1ln4A in template set T0191 67 :EKLNKKFGE 1ln4A 68 :RETGACNVQ Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:3.15243 Ang F8.CE2 and G11.CA other bump:2.87203 Ang F8.CE2 and G11.N other bump:2.96657 Ang F8.CE2 and E10.C other bump:2.83832 Ang L4.CD2 and K6.CE Number of specific fragments= 1 total=1869 # 1ja9A.67.67 read from T0191.t2k.frag # found chain 1ja9A in template set T0191 67 :EKLNKKFGE 1ja9A 76 :KLGAQGVAI Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1870 # 3kinB.67.68 read from T0191.t2k.frag # found chain 3kinB in template set T0191 67 :EKLNKKFGE 3kinB 324 :AKTIKNTVS Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1871 # 6ldh.67.68 read from T0191.t2k.frag # found chain 6ldh in template set T0191 67 :EKLNKKFGE 6ldh 68 :GSLFLHTAK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1872 # 1j7lA.67.68 read from T0191.t2k.frag # found chain 1j7lA in template set T0191 67 :EKLNKKFGE 1j7lA 69 :GKLPVPKVL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1873 # 1gvfA.67.70 read from T0191.t2k.frag # found chain 1gvfA in template set T0191 67 :EKLNKKFGE 1gvfA 71 :TTYNMPLAL Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.46316 Ang K6.O and F8.CE1 other bump:2.63749 Ang K6.O and F8.CD1 Number of specific fragments= 1 total=1874 # 1ln4A.68.68 read from T0191.t2k.frag # found chain 1ln4A in template set T0191 68 :KLNKKFGEE 1ln4A 69 :ETGACNVQV Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.96739 Ang F7.CE2 and E10.CB other bump:3.15243 Ang F7.CE2 and E10.CA other bump:2.87203 Ang F7.CE2 and E10.N other bump:2.96657 Ang F7.CE2 and E9.C other bump:2.83831 Ang L3.CD2 and K5.CE Number of specific fragments= 1 total=1875 # 6ldh.68.69 read from T0191.t2k.frag # found chain 6ldh in template set T0191 68 :KLNKKFGEE 6ldh 69 :SLFLHTAKI Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1876 # 3kinB.68.69 read from T0191.t2k.frag # found chain 3kinB in template set T0191 68 :KLNKKFGEE 3kinB 325 :KTIKNTVSV Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.43292 Ang G8.O and E9.CG neighbor-bump: 2.8088 Ang G8.C and E9.CG Number of specific fragments= 1 total=1877 # 1fg7A.68.72 read from T0191.t2k.frag # adding 1fg7A to template set 1fg7A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # found chain 1fg7A in template set T0191 68 :KLNKKFGEE 1fg7A 73 :VKPEQVLVS Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1878 # 1ja9A.68.68 read from T0191.t2k.frag # found chain 1ja9A in template set T0191 68 :KLNKKFGEE 1ja9A 77 :LGAQGVAIQ Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1879 # 1j7lA.68.69 read from T0191.t2k.frag # found chain 1j7lA in template set T0191 68 :KLNKKFGEE 1j7lA 70 :KLPVPKVLH Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1880 # 1ln4A.69.69 read from T0191.t2k.frag # found chain 1ln4A in template set T0191 69 :LNKKFGEEV 1ln4A 70 :TGACNVQVI Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.91884 Ang E8.CD and V10.CG1 other bump:2.18763 Ang E8.OE1 and V10.CG1 other bump:2.98664 Ang F6.CE2 and E9.CB other bump:3.15243 Ang F6.CE2 and E9.CA other bump:2.87203 Ang F6.CE2 and E9.N other bump:2.96657 Ang F6.CE2 and E8.C Number of specific fragments= 1 total=1881 # 6ldh.69.70 read from T0191.t2k.frag # found chain 6ldh in template set T0191 69 :LNKKFGEEV 6ldh 70 :LFLHTAKIV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1882 # 3kinB.69.70 read from T0191.t2k.frag # found chain 3kinB in template set T0191 69 :LNKKFGEEV 3kinB 326 :TIKNTVSVN Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.43292 Ang G7.O and E8.CG neighbor-bump: 2.8088 Ang G7.C and E8.CG Number of specific fragments= 1 total=1883 # 1fg7A.69.73 read from T0191.t2k.frag # found chain 1fg7A in template set T0191 69 :LNKKFGEEV 1fg7A 74 :KPEQVLVSR Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1884 # 1an7A.69.70 read from T0191.t2k.frag # found chain 1an7A in template set T0191 69 :LNKKFGEEV 1an7A 73 :DPRPEQVIH Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1885 # 1g4yR.69.71 read from T0191.t2k.frag # adding 1g4yR to template set 1g4yR:# found chain 1g4yR in template set T0191 69 :LNKKFGEEV 1g4yR 72 :MARKMKDTD Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1886 # 1ln4A.70.70 read from T0191.t2k.frag # found chain 1ln4A in template set T0191 70 :NKKFGEEVK 1ln4A 71 :GACNVQVIG Fragment has 9 clashes (null) has 9 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.31534 Ang K10.CG and G11.N self-bump: 2.56123 Ang K10.CG and K10.C self-bump: 1.25208 Ang K10.CA and K10.CB other bump:2.91884 Ang E7.CD and V9.CG1 other bump:2.18763 Ang E7.OE1 and V9.CG1 other bump:2.98664 Ang F5.CE2 and E8.CB other bump:3.15243 Ang F5.CE2 and E8.CA other bump:2.87203 Ang F5.CE2 and E8.N other bump:2.96657 Ang F5.CE2 and E7.C Number of specific fragments= 1 total=1887 # 6ldh.70.71 read from T0191.t2k.frag # found chain 6ldh in template set T0191 70 :NKKFGEEVK 6ldh 71 :FLHTAKIVS Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1888 # 3kinB.70.71 read from T0191.t2k.frag # found chain 3kinB in template set T0191 70 :NKKFGEEVK 3kinB 327 :IKNTVSVNL Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.43292 Ang G6.O and E7.CG neighbor-bump: 2.8088 Ang G6.C and E7.CG Number of specific fragments= 1 total=1889 # 1fg7A.70.74 read from T0191.t2k.frag # found chain 1fg7A in template set T0191 70 :NKKFGEEVK 1fg7A 75 :PEQVLVSRG Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.52344 Ang E8.CD and K10.O other bump:2.57016 Ang E8.CG and K10.O neighbor-bump: 1.95251 Ang V9.O and K10.CG neighbor-bump: 2.7645 Ang V9.C and K10.CG self-bump: 1.39324 Ang V9.CA and V9.CB Number of specific fragments= 1 total=1890 # 1g4yR.70.72 read from T0191.t2k.frag # found chain 1g4yR in template set T0191 70 :NKKFGEEVK 1g4yR 73 :ARKMKDTDS Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1891 # 1an7A.70.71 read from T0191.t2k.frag # found chain 1an7A in template set T0191 70 :NKKFGEEVK 1an7A 74 :PRPEQVIHH Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1892 # 1ln4A.71.71 read from T0191.t2k.frag # found chain 1ln4A in template set T0191 71 :KKFGEEVKF 1ln4A 72 :ACNVQVIGK Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues self-bump: 1.27333 Ang K9.CA and K9.CB other bump:2.91884 Ang E6.CD and V8.CG1 other bump:2.18763 Ang E6.OE1 and V8.CG1 other bump:2.98664 Ang F4.CE2 and E7.CB other bump:3.15243 Ang F4.CE2 and E7.CA other bump:2.87203 Ang F4.CE2 and E7.N other bump:2.96657 Ang F4.CE2 and E6.C Number of specific fragments= 1 total=1893 # 6ldh.71.72 read from T0191.t2k.frag # found chain 6ldh in template set T0191 71 :KKFGEEVKF 6ldh 72 :LHTAKIVSG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1894 # 1fg7A.71.75 read from T0191.t2k.frag # found chain 1fg7A in template set T0191 71 :KKFGEEVKF 1fg7A 76 :EQVLVSRGA Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.52344 Ang E7.CD and K9.O other bump:2.57016 Ang E7.CG and K9.O neighbor-bump: 1.95251 Ang V8.O and K9.CG neighbor-bump: 2.7645 Ang V8.C and K9.CG self-bump: 1.39324 Ang V8.CA and V8.CB Number of specific fragments= 1 total=1895 # 1g4yR.71.73 read from T0191.t2k.frag # found chain 1g4yR in template set T0191 71 :KKFGEEVKF 1g4yR 74 :RKMKDTDSE Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1896 # 3kinB.71.72 read from T0191.t2k.frag # found chain 3kinB in template set T0191 71 :KKFGEEVKF 3kinB 328 :KNTVSVNLE Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.43292 Ang G5.O and E6.CG neighbor-bump: 2.8088 Ang G5.C and E6.CG Number of specific fragments= 1 total=1897 # 1bkpA.71.73 read from T0191.t2k.frag # adding 1bkpA to template set 1bkpA:Skipped atom 1792, because occupancy 0.5 <= existing 0.500001 Skipped atom 1794, because occupancy 0.5 <= existing 0.500001 Skipped atom 1796, because occupancy 0.5 <= existing 0.500001 Skipped atom 1798, because occupancy 0.5 <= existing 0.500001 Skipped atom 1800, because occupancy 0.5 <= existing 0.500001 Skipped atom 1802, because occupancy 0.5 <= existing 0.500001 # found chain 1bkpA in template set T0191 71 :KKFGEEVKF 1bkpA 75 :IWQLKSNDV Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.8669 Ang E7.OE1 and K9.CB other bump:2.96411 Ang E7.CG and K9.N Number of specific fragments= 1 total=1898 # 1ln4A.72.72 read from T0191.t2k.frag # found chain 1ln4A in template set T0191 72 :KFGEEVKFS 1ln4A 73 :CNVQVIGKT Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues self-bump: 1.27333 Ang K8.CA and K8.CB other bump:2.91884 Ang E5.CD and V7.CG1 other bump:2.18763 Ang E5.OE1 and V7.CG1 other bump:2.98664 Ang F3.CE2 and E6.CB other bump:3.15243 Ang F3.CE2 and E6.CA other bump:2.87204 Ang F3.CE2 and E6.N other bump:2.96657 Ang F3.CE2 and E5.C Number of specific fragments= 1 total=1899 # 6ldh.72.73 read from T0191.t2k.frag # found chain 6ldh in template set T0191 72 :KFGEEVKFS 6ldh 73 :HTAKIVSGK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1900 # 1g4yR.72.74 read from T0191.t2k.frag # found chain 1g4yR in template set T0191 72 :KFGEEVKFS 1g4yR 75 :KMKDTDSEE Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1901 # 1fg7A.72.76 read from T0191.t2k.frag # found chain 1fg7A in template set T0191 72 :KFGEEVKFS 1fg7A 77 :QVLVSRGAD Fragment has 8 clashes (null) has 8 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.92175 Ang K8.CE and S10.OG other bump:2.74902 Ang K8.CD and S10.CB other bump:2.63165 Ang K8.CE and S10.CB other bump:2.52344 Ang E6.CD and K8.O other bump:2.57016 Ang E6.CG and K8.O neighbor-bump: 1.95251 Ang V7.O and K8.CG neighbor-bump: 2.7645 Ang V7.C and K8.CG self-bump: 1.39324 Ang V7.CA and V7.CB Number of specific fragments= 1 total=1902 # 1bkpA.72.74 read from T0191.t2k.frag # found chain 1bkpA in template set T0191 72 :KFGEEVKFS 1bkpA 76 :WQLKSNDVN Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.31141 Ang K8.NZ and S10.OG other bump:2.7264 Ang K8.NZ and S10.CB other bump:2.8669 Ang E6.OE1 and K8.CB other bump:2.96411 Ang E6.CG and K8.N Number of specific fragments= 1 total=1903 # 1ja9A.72.72 read from T0191.t2k.frag # found chain 1ja9A in template set T0191 72 :KFGEEVKFS 1ja9A 81 :GVAIQADIS Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.92735 Ang E6.C and V7.CG2 neighbor-bump: 2.45045 Ang E6.O and V7.CG2 Number of specific fragments= 1 total=1904 # 1ln4A.73.73 read from T0191.t2k.frag # found chain 1ln4A in template set T0191 73 :FGEEVKFSG 1ln4A 74 :NVQVIGKTL Fragment has 9 clashes (null) has 9 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues self-bump: 1.27333 Ang K7.CA and K7.CB other bump:2.91884 Ang E4.CD and V6.CG1 other bump:2.18763 Ang E4.OE1 and V6.CG1 other bump:2.53744 Ang F2.CZ and E5.CB other bump:2.84822 Ang F2.CZ and E5.CA other bump:2.72113 Ang F2.CE1 and E5.N other bump:2.76981 Ang F2.CZ and E5.N other bump:2.9048 Ang F2.CE1 and E4.C other bump:3.05364 Ang F2.CZ and E4.C Number of specific fragments= 1 total=1905 # 6ldh.73.74 read from T0191.t2k.frag # found chain 6ldh in template set T0191 73 :FGEEVKFSG 6ldh 74 :TAKIVSGKD Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1906 # 1ja9A.73.73 read from T0191.t2k.frag # found chain 1ja9A in template set T0191 73 :FGEEVKFSG 1ja9A 82 :VAIQADISK Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.92735 Ang E5.C and V6.CG2 neighbor-bump: 2.45045 Ang E5.O and V6.CG2 Number of specific fragments= 1 total=1907 # 1g4yR.73.75 read from T0191.t2k.frag # found chain 1g4yR in template set T0191 73 :FGEEVKFSG 1g4yR 76 :MKDTDSEEE Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1908 # 1bkpA.73.75 read from T0191.t2k.frag # found chain 1bkpA in template set T0191 73 :FGEEVKFSG 1bkpA 77 :QLKSNDVND Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.3114 Ang K7.NZ and S9.OG other bump:2.7264 Ang K7.NZ and S9.CB other bump:2.8669 Ang E5.OE1 and K7.CB other bump:2.96411 Ang E5.CG and K7.N Number of specific fragments= 1 total=1909 # 1cjsA.73.75 read from T0191.t2k.frag # adding 1cjsA to template set 1cjsA:# found chain 1cjsA in template set T0191 73 :FGEEVKFSG 1cjsA 76 :GLTVIRKEE Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.37697 Ang E5.OE1 and K7.NZ other bump:2.47151 Ang E5.OE1 and K7.CE Number of specific fragments= 1 total=1910 # 1ln4A.74.74 read from T0191.t2k.frag # found chain 1ln4A in template set T0191 74 :GEEVKFSGL 1ln4A 75 :VQVIGKTLV Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues self-bump: 1.27333 Ang K6.CA and K6.CB other bump:2.91884 Ang E3.CD and V5.CG1 other bump:2.18763 Ang E3.OE1 and V5.CG1 Number of specific fragments= 1 total=1911 # 1cjsA.74.76 read from T0191.t2k.frag # found chain 1cjsA in template set T0191 74 :GEEVKFSGL 1cjsA 77 :LTVIRKEEI Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.37697 Ang E4.OE1 and K6.NZ other bump:2.47151 Ang E4.OE1 and K6.CE Number of specific fragments= 1 total=1912 # 6ldh.74.75 read from T0191.t2k.frag # found chain 6ldh in template set T0191 74 :GEEVKFSGL 6ldh 75 :AKIVSGKDY Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1913 # 1bkpA.74.76 read from T0191.t2k.frag # found chain 1bkpA in template set T0191 74 :GEEVKFSGL 1bkpA 78 :LKSNDVNDL Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.3114 Ang K6.NZ and S8.OG other bump:2.7264 Ang K6.NZ and S8.CB other bump:2.8669 Ang E4.OE1 and K6.CB other bump:2.96411 Ang E4.CG and K6.N Number of specific fragments= 1 total=1914 # 1ja9A.74.74 read from T0191.t2k.frag # found chain 1ja9A in template set T0191 74 :GEEVKFSGL 1ja9A 83 :AIQADISKP Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.45045 Ang E4.O and V5.CG2 neighbor-bump: 2.92735 Ang E4.C and V5.CG2 Number of specific fragments= 1 total=1915 # 1g4yR.74.76 read from T0191.t2k.frag # found chain 1g4yR in template set T0191 74 :GEEVKFSGL 1g4yR 77 :KDTDSEEEI Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1916 # 6ldh.75.76 read from T0191.t2k.frag # found chain 6ldh in template set T0191 75 :EEVKFSGLD 6ldh 76 :KIVSGKDYS Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1917 # 1cjsA.75.77 read from T0191.t2k.frag # found chain 1cjsA in template set T0191 75 :EEVKFSGLD 1cjsA 78 :TVIRKEEIE Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.37698 Ang E3.OE1 and K5.NZ other bump:2.47151 Ang E3.OE1 and K5.CE Number of specific fragments= 1 total=1918 # 1bkpA.75.77 read from T0191.t2k.frag # found chain 1bkpA in template set T0191 75 :EEVKFSGLD 1bkpA 79 :KSNDVNDLN Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.3114 Ang K5.NZ and S7.OG other bump:2.7264 Ang K5.NZ and S7.CB other bump:2.86689 Ang E3.OE1 and K5.CB other bump:2.96411 Ang E3.CG and K5.N Number of specific fragments= 1 total=1919 # 1ln4A.75.75 read from T0191.t2k.frag # found chain 1ln4A in template set T0191 75 :EEVKFSGLD 1ln4A 76 :QVIGKTLVL Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues self-bump: 1.27333 Ang K5.CA and K5.CB other bump:2.91883 Ang E2.CD and V4.CG1 other bump:2.18763 Ang E2.OE1 and V4.CG1 Number of specific fragments= 1 total=1920 # 1g4yR.75.77 read from T0191.t2k.frag # found chain 1g4yR in template set T0191 75 :EEVKFSGLD 1g4yR 78 :DTDSEEEIR Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1921 # 1ja9A.75.75 read from T0191.t2k.frag # found chain 1ja9A in template set T0191 75 :EEVKFSGLD 1ja9A 84 :IQADISKPS Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.45045 Ang E3.O and V4.CG2 neighbor-bump: 2.92735 Ang E3.C and V4.CG2 Number of specific fragments= 1 total=1922 # 1bkpA.76.78 read from T0191.t2k.frag # found chain 1bkpA in template set T0191 76 :EVKFSGLDV 1bkpA 80 :SNDVNDLNM Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.3114 Ang K4.NZ and S6.OG other bump:2.7264 Ang K4.NZ and S6.CB other bump:2.86689 Ang E2.OE1 and K4.CB other bump:2.96411 Ang E2.CG and K4.N Number of specific fragments= 1 total=1923 # 6ldh.76.77 read from T0191.t2k.frag # found chain 6ldh in template set T0191 76 :EVKFSGLDV 6ldh 77 :IVSGKDYSV Fragment has 15 clashes (null) has 15 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.94769 Ang F5.CE1 and V10.CG2 other bump:2.30199 Ang F5.CZ and V10.CG2 other bump:2.74339 Ang F5.CB and V10.CG2 other bump:1.57899 Ang F5.CG and V10.CG2 other bump:1.53751 Ang F5.CD1 and V10.CG2 other bump:1.98447 Ang F5.CD2 and V10.CG2 other bump:2.31742 Ang F5.CE2 and V10.CG2 other bump:2.77622 Ang F5.CE1 and V10.CG1 other bump:2.90212 Ang F5.CB and V10.CG1 other bump:2.60744 Ang F5.CG and V10.CG1 other bump:1.76415 Ang F5.CD1 and V10.CG1 other bump:2.86333 Ang F5.CE1 and V10.CB other bump:2.71437 Ang F5.CB and V10.CB other bump:2.29435 Ang F5.CG and V10.CB other bump:2.00504 Ang F5.CD1 and V10.CB Number of specific fragments= 1 total=1924 # 1cjsA.76.78 read from T0191.t2k.frag # found chain 1cjsA in template set T0191 76 :EVKFSGLDV 1cjsA 79 :VIRKEEIEE Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.37697 Ang E2.OE1 and K4.NZ other bump:2.4715 Ang E2.OE1 and K4.CE Number of specific fragments= 1 total=1925 # 1g4yR.76.78 read from T0191.t2k.frag # found chain 1g4yR in template set T0191 76 :EVKFSGLDV 1g4yR 79 :TDSEEEIRE Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1926 # 1huuA.76.78 read from T0191.t2k.frag # adding 1huuA to template set 1huuA:# found chain 1huuA in template set T0191 76 :EVKFSGLDV 1huuA 79 :FKPGKALKD Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1927 # 1fg7A.76.80 read from T0191.t2k.frag # found chain 1fg7A in template set T0191 76 :EVKFSGLDV 1fg7A 81 :SRGADEGIE Fragment has 25 clashes (null) has 25 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.05603 Ang F5.O and D9.OD1 other bump:2.77002 Ang E2.CD and L8.CD2 other bump:2.55715 Ang E2.OE2 and L8.CD1 other bump:1.69655 Ang E2.OE2 and L8.CG other bump:2.05834 Ang E2.CD and L8.CG other bump:2.65009 Ang E2.OE1 and L8.CG other bump:3.01486 Ang E2.CG and L8.CG other bump:2.07292 Ang E2.OE2 and L8.CB other bump:2.69505 Ang E2.CD and L8.CB other bump:2.86883 Ang E2.OE1 and L8.CB other bump:2.57049 Ang E2.OE2 and L8.CA other bump:2.705 Ang E2.CD and L8.CA other bump:2.21858 Ang E2.OE1 and L8.CA other bump:2.25526 Ang E2.OE2 and L8.N other bump:2.22477 Ang E2.CD and L8.N other bump:1.79681 Ang E2.OE1 and L8.N other bump:3.11653 Ang E2.CD and G7.C other bump:2.3123 Ang E2.OE1 and G7.C other bump:2.77654 Ang K4.CD and S6.CB other bump:2.65946 Ang K4.CE and S6.CB other bump:2.52343 Ang E2.CD and K4.O other bump:2.57016 Ang E2.CG and K4.O neighbor-bump: 1.95251 Ang V3.O and K4.CG neighbor-bump: 2.7645 Ang V3.C and K4.CG self-bump: 1.39324 Ang V3.CA and V3.CB Number of specific fragments= 1 total=1928 # 1bkpA.77.79 read from T0191.t2k.frag # found chain 1bkpA in template set T0191 77 :VKFSGLDVD 1bkpA 81 :NDVNDLNMM Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.31141 Ang K3.NZ and S5.OG other bump:2.72641 Ang K3.NZ and S5.CB Number of specific fragments= 1 total=1929 # 6ldh.77.78 read from T0191.t2k.frag # found chain 6ldh in template set T0191 77 :VKFSGLDVD 6ldh 78 :VSGKDYSVS Fragment has 15 clashes (null) has 15 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.94769 Ang F4.CE1 and V9.CG2 other bump:2.30199 Ang F4.CZ and V9.CG2 other bump:2.74339 Ang F4.CB and V9.CG2 other bump:1.57899 Ang F4.CG and V9.CG2 other bump:1.53751 Ang F4.CD1 and V9.CG2 other bump:1.98447 Ang F4.CD2 and V9.CG2 other bump:2.31742 Ang F4.CE2 and V9.CG2 other bump:2.77622 Ang F4.CE1 and V9.CG1 other bump:2.90212 Ang F4.CB and V9.CG1 other bump:2.60744 Ang F4.CG and V9.CG1 other bump:1.76415 Ang F4.CD1 and V9.CG1 other bump:2.86333 Ang F4.CE1 and V9.CB other bump:2.71437 Ang F4.CB and V9.CB other bump:2.29435 Ang F4.CG and V9.CB other bump:2.00504 Ang F4.CD1 and V9.CB Number of specific fragments= 1 total=1930 # 1cjsA.77.79 read from T0191.t2k.frag # found chain 1cjsA in template set T0191 77 :VKFSGLDVD 1cjsA 80 :IRKEEIEEL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1931 # 1g4yR.77.79 read from T0191.t2k.frag # found chain 1g4yR in template set T0191 77 :VKFSGLDVD 1g4yR 80 :DSEEEIREA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1932 # 1huuA.77.79 read from T0191.t2k.frag # found chain 1huuA in template set T0191 77 :VKFSGLDVD 1huuA 80 :KPGKALKDA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1933 # 1ds9A.77.82 read from T0191.t2k.frag # found chain 1ds9A in template set T0191 77 :VKFSGLDVD 1ds9A 83 :KKIENLDAV Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.84809 Ang F4.CZ and D8.N other bump:2.59787 Ang F4.CE2 and L7.CB Number of specific fragments= 1 total=1934 # 1bkpA.78.80 read from T0191.t2k.frag # found chain 1bkpA in template set T0191 78 :KFSGLDVDL 1bkpA 82 :DVNDLNMMG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1935 # 6ldh.78.79 read from T0191.t2k.frag # found chain 6ldh in template set T0191 78 :KFSGLDVDL 6ldh 79 :SGKDYSVSA Fragment has 15 clashes (null) has 15 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.94769 Ang F3.CE1 and V8.CG2 other bump:2.30199 Ang F3.CZ and V8.CG2 other bump:2.74339 Ang F3.CB and V8.CG2 other bump:1.579 Ang F3.CG and V8.CG2 other bump:1.53752 Ang F3.CD1 and V8.CG2 other bump:1.98448 Ang F3.CD2 and V8.CG2 other bump:2.31743 Ang F3.CE2 and V8.CG2 other bump:2.77621 Ang F3.CE1 and V8.CG1 other bump:2.90211 Ang F3.CB and V8.CG1 other bump:2.60744 Ang F3.CG and V8.CG1 other bump:1.76415 Ang F3.CD1 and V8.CG1 other bump:2.86333 Ang F3.CE1 and V8.CB other bump:2.71438 Ang F3.CB and V8.CB other bump:2.29436 Ang F3.CG and V8.CB other bump:2.00504 Ang F3.CD1 and V8.CB Number of specific fragments= 1 total=1936 # 1ds9A.78.83 read from T0191.t2k.frag # found chain 1ds9A in template set T0191 78 :KFSGLDVDL 1ds9A 84 :KIENLDAVA Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.6525 Ang L6.O and L10.CB other bump:2.84809 Ang F3.CZ and D7.N other bump:2.59787 Ang F3.CE2 and L6.CB Number of specific fragments= 1 total=1937 # 1cjsA.78.80 read from T0191.t2k.frag # found chain 1cjsA in template set T0191 78 :KFSGLDVDL 1cjsA 81 :RKEEIEELG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1938 # 1abv.78.83 read from T0191.t2k.frag # adding 1abv to template set 1abv:# found chain 1abv in template set T0191 78 :KFSGLDVDL 1abv 84 :RLNALPDVL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1939 # 1g4yR.78.80 read from T0191.t2k.frag # found chain 1g4yR in template set T0191 78 :KFSGLDVDL 1g4yR 81 :SEEEIREAF Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1940 # 1bkpA.79.81 read from T0191.t2k.frag # found chain 1bkpA in template set T0191 79 :FSGLDVDLD 1bkpA 83 :VNDLNMMGV Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.93894 Ang F2.CD1 and D6.OD1 Number of specific fragments= 1 total=1941 # 1ds9A.79.84 read from T0191.t2k.frag # found chain 1ds9A in template set T0191 79 :FSGLDVDLD 1ds9A 85 :IENLDAVAD Fragment has 9 clashes (null) has 9 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.6525 Ang L5.O and L9.CB other bump:2.47298 Ang F2.CE1 and D6.N other bump:2.61737 Ang F2.CZ and D6.N other bump:3.11252 Ang F2.CE1 and L5.C other bump:2.67361 Ang F2.CZ and L5.C other bump:2.90229 Ang F2.CE2 and L5.CD1 other bump:2.2382 Ang F2.CE2 and L5.CB other bump:2.18899 Ang F2.CZ and L5.CB other bump:2.81686 Ang F2.CZ and L5.CA Number of specific fragments= 1 total=1942 # 1ir6A.79.79 read from T0191.t2k.frag # adding 1ir6A to template set 1ir6A:# found chain 1ir6A in template set T0191 79 :FSGLDVDLD 1ir6A 119 :MERVPEHLE Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1943 # 6ldh.79.80 read from T0191.t2k.frag # found chain 6ldh in template set T0191 79 :FSGLDVDLD 6ldh 80 :GKDYSVSAG Fragment has 35 clashes (null) has 35 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues self-bump: 1.39544 Ang L9.CA and L9.CB other bump:2.70117 Ang F2.CE1 and D8.N other bump:2.39882 Ang F2.CZ and D8.N other bump:2.46234 Ang F2.CE1 and V7.C other bump:2.7578 Ang F2.CZ and V7.C other bump:2.70541 Ang F2.CB and V7.CG2 other bump:2.5845 Ang F2.CG and V7.CG2 other bump:2.60391 Ang F2.CD1 and V7.CG2 other bump:2.15544 Ang F2.CG and V7.CG1 other bump:0.85985 Ang F2.CD1 and V7.CG1 other bump:1.49565 Ang F2.CE1 and V7.CG1 other bump:3.15617 Ang F2.CD2 and V7.CG1 other bump:2.75932 Ang F2.CZ and V7.CG1 other bump:2.85646 Ang F2.CB and V7.CB other bump:1.89193 Ang F2.CG and V7.CB other bump:1.55958 Ang F2.CD1 and V7.CB other bump:2.07705 Ang F2.CE1 and V7.CB other bump:2.55157 Ang F2.CD2 and V7.CB other bump:2.89877 Ang F2.CE2 and V7.CB other bump:2.70336 Ang F2.CZ and V7.CB other bump:2.85302 Ang F2.CD1 and V7.CA other bump:2.6108 Ang F2.CE1 and V7.CA other bump:2.82282 Ang F2.CZ and V7.CA other bump:2.78313 Ang F2.CE2 and V7.N other bump:2.87659 Ang F2.CZ and V7.N other bump:2.66521 Ang F2.CE2 and L5.C other bump:3.26036 Ang F2.CZ and L5.C other bump:2.90065 Ang F2.CE2 and L5.O other bump:2.67058 Ang F2.CE2 and L5.CA other bump:3.03689 Ang F2.CE2 and L5.N other bump:2.36626 Ang F2.CD2 and G4.C other bump:2.58292 Ang F2.CE2 and G4.C other bump:2.52952 Ang F2.CG and G4.O other bump:1.18318 Ang F2.CD2 and G4.O other bump:1.59816 Ang F2.CE2 and G4.O Number of specific fragments= 1 total=1944 # 1cjsA.79.81 read from T0191.t2k.frag # found chain 1cjsA in template set T0191 79 :FSGLDVDLD 1cjsA 82 :KEEIEELGK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1945 # 1abv.79.84 read from T0191.t2k.frag # found chain 1abv in template set T0191 79 :FSGLDVDLD 1abv 85 :LNALPDVLE Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1946 # 1ds9A.80.85 read from T0191.t2k.frag # found chain 1ds9A in template set T0191 80 :SGLDVDLDG 1ds9A 86 :ENLDAVADT Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.6525 Ang L4.O and L8.CB Number of specific fragments= 1 total=1947 # 1ir6A.80.80 read from T0191.t2k.frag # found chain 1ir6A in template set T0191 80 :SGLDVDLDG 1ir6A 120 :ERVPEHLEA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1948 # 1bkpA.80.82 read from T0191.t2k.frag # found chain 1bkpA in template set T0191 80 :SGLDVDLDG 1bkpA 84 :NDLNMMGVH Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1949 # 6ldh.80.81 read from T0191.t2k.frag # found chain 6ldh in template set T0191 80 :SGLDVDLDG 6ldh 81 :KDYSVSAGS Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues self-bump: 1.39544 Ang L8.CA and L8.CB Number of specific fragments= 1 total=1950 # 1mldA.80.59 read from T0191.t2k.frag # adding 1mldA to template set 1mldA:# found chain 1mldA in template set T0191 80 :SGLDVDLDG 1mldA 60 :EQLPDCLKG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1951 # 1abv.80.85 read from T0191.t2k.frag # found chain 1abv in template set T0191 80 :SGLDVDLDG 1abv 86 :NALPDVLEQ Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1952 # 1ir6A.81.81 read from T0191.t2k.frag # found chain 1ir6A in template set T0191 81 :GLDVDLDGV 1ir6A 121 :RVPEHLEAS Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1953 # 1ds9A.81.86 read from T0191.t2k.frag # found chain 1ds9A in template set T0191 81 :GLDVDLDGV 1ds9A 87 :NLDAVADTL Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.19233 Ang D6.O and V10.CG2 other bump:3.05712 Ang D6.C and V10.CG2 other bump:2.6525 Ang L3.O and L7.CB Number of specific fragments= 1 total=1954 # 1mldA.81.60 read from T0191.t2k.frag # found chain 1mldA in template set T0191 81 :GLDVDLDGV 1mldA 61 :QLPDCLKGC Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1955 # 6ldh.81.82 read from T0191.t2k.frag # found chain 6ldh in template set T0191 81 :GLDVDLDGV 6ldh 82 :DYSVSAGSK Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues self-bump: 1.39544 Ang L7.CA and L7.CB Number of specific fragments= 1 total=1956 # 1a9nA.81.81 read from T0191.t2k.frag # adding 1a9nA to template set 1a9nA:# found chain 1a9nA in template set T0191 81 :GLDVDLDGV 1a9nA 82 :GLDQALPDL Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.85174 Ang L7.CB and V10.CG2 other bump:2.12356 Ang D4.O and D8.OD1 Number of specific fragments= 1 total=1957 # 1g4yR.81.83 read from T0191.t2k.frag # found chain 1g4yR in template set T0191 81 :GLDVDLDGV 1g4yR 84 :EIREAFRVF Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1958 # 1ir6A.82.82 read from T0191.t2k.frag # found chain 1ir6A in template set T0191 82 :LDVDLDGVD 1ir6A 122 :VPEHLEASD Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1959 # 1mldA.82.61 read from T0191.t2k.frag # found chain 1mldA in template set T0191 82 :LDVDLDGVD 1mldA 62 :LPDCLKGCD Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1960 # 1ds9A.82.87 read from T0191.t2k.frag # found chain 1ds9A in template set T0191 82 :LDVDLDGVD 1ds9A 88 :LDAVADTLE Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues self-bump: 1.39955 Ang D10.CA and D10.CB other bump:2.19234 Ang D5.O and V9.CG2 other bump:3.05713 Ang D5.C and V9.CG2 other bump:2.6525 Ang L2.O and L6.CB Number of specific fragments= 1 total=1961 # 6ldh.82.83 read from T0191.t2k.frag # found chain 6ldh in template set T0191 82 :LDVDLDGVD 6ldh 83 :YSVSAGSKL Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues self-bump: 1.37777 Ang V9.CA and V9.CB self-bump: 1.39544 Ang L6.CA and L6.CB Number of specific fragments= 1 total=1962 # 1a9nA.82.82 read from T0191.t2k.frag # found chain 1a9nA in template set T0191 82 :LDVDLDGVD 1a9nA 83 :LDQALPDLT Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.85174 Ang L6.CB and V9.CG2 other bump:2.12356 Ang D3.O and D7.OD1 Number of specific fragments= 1 total=1963 # 6ldh.82.82 read from T0191.t2k.frag # found chain 6ldh in template set T0191 82 :LDVDLDGVD 6ldh 82 :DYSVSAGSK Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues self-bump: 1.38023 Ang D10.CA and D10.CB Number of specific fragments= 1 total=1964 # 1ir6A.83.83 read from T0191.t2k.frag # found chain 1ir6A in template set T0191 83 :DVDLDGVDI 1ir6A 123 :PEHLEASDL Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.88467 Ang V8.CG1 and I10.C Number of specific fragments= 1 total=1965 # 6ldh.83.84 read from T0191.t2k.frag # found chain 6ldh in template set T0191 83 :DVDLDGVDI 6ldh 84 :SVSAGSKLV Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues self-bump: 1.37777 Ang V8.CA and V8.CB self-bump: 1.39544 Ang L5.CA and L5.CB Number of specific fragments= 1 total=1966 # 1mldA.83.62 read from T0191.t2k.frag # found chain 1mldA in template set T0191 83 :DVDLDGVDI 1mldA 63 :PDCLKGCDV Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:3.08445 Ang V8.CG1 and I10.C other bump:2.36304 Ang V8.CG1 and I10.O Number of specific fragments= 1 total=1967 # 6ldh.83.83 read from T0191.t2k.frag # found chain 6ldh in template set T0191 83 :DVDLDGVDI 6ldh 83 :YSVSAGSKL Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.98501 Ang V8.CG1 and I10.C other bump:2.39976 Ang V8.CG1 and I10.O self-bump: 1.38022 Ang D9.CA and D9.CB Number of specific fragments= 1 total=1968 # 1a9nA.83.83 read from T0191.t2k.frag # found chain 1a9nA in template set T0191 83 :DVDLDGVDI 1a9nA 84 :DQALPDLTE Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.85174 Ang L5.CB and V8.CG2 other bump:2.12356 Ang D2.O and D6.OD1 Number of specific fragments= 1 total=1969 # 1ds9A.83.88 read from T0191.t2k.frag # found chain 1ds9A in template set T0191 83 :DVDLDGVDI 1ds9A 89 :DAVADTLEE Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues self-bump: 1.39955 Ang D9.CA and D9.CB other bump:3.05713 Ang D4.C and V8.CG2 other bump:2.19234 Ang D4.O and V8.CG2 other bump:2.6525 Ang G1.O and L5.CB Number of specific fragments= 1 total=1970 # 1ir6A.84.84 read from T0191.t2k.frag # found chain 1ir6A in template set T0191 84 :VDLDGVDII 1ir6A 124 :EHLEASDLF Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.88467 Ang V7.CG1 and I9.C Number of specific fragments= 1 total=1971 # 6ldh.84.84 read from T0191.t2k.frag # found chain 6ldh in template set T0191 84 :VDLDGVDII 6ldh 84 :SVSAGSKLV Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.98501 Ang V7.CG1 and I9.C other bump:2.39976 Ang V7.CG1 and I9.O self-bump: 1.38022 Ang D8.CA and D8.CB Number of specific fragments= 1 total=1972 # 6ldh.84.85 read from T0191.t2k.frag # found chain 6ldh in template set T0191 84 :VDLDGVDII 6ldh 85 :VSAGSKLVV Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues self-bump: 1.37777 Ang V7.CA and V7.CB self-bump: 1.39544 Ang L4.CA and L4.CB Number of specific fragments= 1 total=1973 # 1a9nA.84.84 read from T0191.t2k.frag # found chain 1a9nA in template set T0191 84 :VDLDGVDII 1a9nA 85 :QALPDLTEL Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.85174 Ang L4.CB and V7.CG2 other bump:2.12356 Ang G1.O and D5.OD1 Number of specific fragments= 1 total=1974 # 2cmd.84.64 read from T0191.t2k.frag # adding 2cmd to template set 2cmd:# found chain 2cmd in template set T0191 84 :VDLDGVDII 2cmd 65 :PALEGADVV Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.69136 Ang V7.CG1 and I10.CG2 other bump:2.58024 Ang V7.CG1 and I9.O Number of specific fragments= 1 total=1975 # 1mldA.84.63 read from T0191.t2k.frag # found chain 1mldA in template set T0191 84 :VDLDGVDII 1mldA 64 :DCLKGCDVV Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:3.08445 Ang V7.CG1 and I9.C other bump:2.36304 Ang V7.CG1 and I9.O Number of specific fragments= 1 total=1976 # 6ldh.85.85 read from T0191.t2k.frag # found chain 6ldh in template set T0191 85 :DLDGVDIII 6ldh 85 :VSAGSKLVV Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.98501 Ang V6.CG1 and I8.C other bump:2.39976 Ang V6.CG1 and I8.O self-bump: 1.38022 Ang D7.CA and D7.CB Number of specific fragments= 1 total=1977 # 1ir6A.85.85 read from T0191.t2k.frag # found chain 1ir6A in template set T0191 85 :DLDGVDIII 1ir6A 125 :HLEASDLFL Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.88467 Ang V6.CG1 and I8.C Number of specific fragments= 1 total=1978 # 6ldh.85.86 read from T0191.t2k.frag # found chain 6ldh in template set T0191 85 :DLDGVDIII 6ldh 86 :SAGSKLVVI Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues self-bump: 1.37777 Ang V6.CA and V6.CB self-bump: 1.39544 Ang L3.CA and L3.CB Number of specific fragments= 1 total=1979 # 1a9nA.85.85 read from T0191.t2k.frag # found chain 1a9nA in template set T0191 85 :DLDGVDIII 1a9nA 86 :ALPDLTELI Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.85174 Ang L3.CB and V6.CG2 Number of specific fragments= 1 total=1980 # 1gt91.85.88 read from T0191.t2k.frag # adding 1gt91 to template set 1gt91:Skipped atom 93, because occupancy 0.5 <= existing 0.500001 Skipped atom 94, because occupancy 0.5 <= existing 0.500001 Skipped atom 95, because occupancy 0.5 <= existing 0.500001 Skipped atom 96, because occupancy 0.5 <= existing 0.500001 Skipped atom 97, because occupancy 0.5 <= existing 0.500001 Skipped atom 98, because occupancy 0.5 <= existing 0.500001 Skipped atom 99, because occupancy 0.5 <= existing 0.500001 Skipped atom 100, because occupancy 0.5 <= existing 0.500001 Skipped atom 101, because occupancy 0.5 <= existing 0.500001 Skipped atom 679, because occupancy 0.5 <= existing 0.500001 Skipped atom 680, because occupancy 0.5 <= existing 0.500001 Skipped atom 681, because occupancy 0.5 <= existing 0.500001 Skipped atom 682, because occupancy 0.5 <= existing 0.500001 Skipped atom 683, because occupancy 0.5 <= existing 0.500001 Skipped atom 684, because occupancy 0.5 <= existing 0.500001 Skipped atom 685, because occupancy 0.5 <= existing 0.500001 Skipped atom 686, because occupancy 0.5 <= existing 0.500001 Skipped atom 1020, because occupancy 0.5 <= existing 0.500001 Skipped atom 1021, because occupancy 0.5 <= existing 0.500001 Skipped atom 1022, because occupancy 0.5 <= existing 0.500001 Skipped atom 1023, because occupancy 0.5 <= existing 0.500001 Skipped atom 1024, because occupancy 0.5 <= existing 0.500001 Skipped atom 1025, because occupancy 0.5 <= existing 0.500001 Skipped atom 1034, because occupancy 0.5 <= existing 0.500001 Skipped atom 1035, because occupancy 0.5 <= existing 0.500001 Skipped atom 1036, because occupancy 0.5 <= existing 0.500001 Skipped atom 1037, because occupancy 0.5 <= existing 0.500001 Skipped atom 1038, because occupancy 0.5 <= existing 0.500001 Skipped atom 1039, because occupancy 0.5 <= existing 0.500001 Skipped atom 1040, because occupancy 0.5 <= existing 0.500001 Skipped atom 1041, because occupancy 0.5 <= existing 0.500001 Skipped atom 1060, because occupancy 0.5 <= existing 0.500001 Skipped atom 1061, because occupancy 0.5 <= existing 0.500001 Skipped atom 1062, because occupancy 0.5 <= existing 0.500001 Skipped atom 1063, because occupancy 0.5 <= existing 0.500001 Skipped atom 1064, because occupancy 0.5 <= existing 0.500001 Skipped atom 1065, because occupancy 0.5 <= existing 0.500001 Skipped atom 1066, because occupancy 0.5 <= existing 0.500001 Skipped atom 1067, because occupancy 0.5 <= existing 0.500001 Skipped atom 1208, because occupancy 0.5 <= existing 0.500001 Skipped atom 1209, because occupancy 0.5 <= existing 0.500001 Skipped atom 1210, because occupancy 0.5 <= existing 0.500001 Skipped atom 1211, because occupancy 0.5 <= existing 0.500001 Skipped atom 1212, because occupancy 0.5 <= existing 0.500001 Skipped atom 1213, because occupancy 0.5 <= existing 0.500001 Skipped atom 1423, because occupancy 0.5 <= existing 0.500001 Skipped atom 1424, because occupancy 0.5 <= existing 0.500001 Skipped atom 1425, because occupancy 0.5 <= existing 0.500001 Skipped atom 1426, because occupancy 0.5 <= existing 0.500001 Skipped atom 1427, because occupancy 0.5 <= existing 0.500001 Skipped atom 1428, because occupancy 0.5 <= existing 0.500001 Skipped atom 1429, because occupancy 0.5 <= existing 0.500001 Skipped atom 1430, because occupancy 0.5 <= existing 0.500001 Skipped atom 1431, because occupancy 0.5 <= existing 0.500001 Skipped atom 1432, because occupancy 0.5 <= existing 0.500001 Skipped atom 1433, because occupancy 0.5 <= existing 0.500001 Skipped atom 1645, because occupancy 0.5 <= existing 0.500001 Skipped atom 1646, because occupancy 0.5 <= existing 0.500001 Skipped atom 1647, because occupancy 0.5 <= existing 0.500001 Skipped atom 1648, because occupancy 0.5 <= existing 0.500001 Skipped atom 1649, because occupancy 0.5 <= existing 0.500001 Skipped atom 1650, because occupancy 0.5 <= existing 0.500001 Skipped atom 1651, because occupancy 0.5 <= existing 0.500001 Skipped atom 1652, because occupancy 0.5 <= existing 0.500001 Skipped atom 1788, because occupancy 0.5 <= existing 0.500001 Skipped atom 1789, because occupancy 0.5 <= existing 0.500001 Skipped atom 1790, because occupancy 0.5 <= existing 0.500001 Skipped atom 1791, because occupancy 0.5 <= existing 0.500001 Skipped atom 1792, because occupancy 0.5 <= existing 0.500001 Skipped atom 1793, because occupancy 0.5 <= existing 0.500001 Skipped atom 1794, because occupancy 0.5 <= existing 0.500001 Skipped atom 1795, because occupancy 0.5 <= existing 0.500001 Skipped atom 1803, because occupancy 0.5 <= existing 0.500001 Skipped atom 1804, because occupancy 0.5 <= existing 0.500001 Skipped atom 1805, because occupancy 0.5 <= existing 0.500001 Skipped atom 1806, because occupancy 0.5 <= existing 0.500001 Skipped atom 1807, because occupancy 0.5 <= existing 0.500001 Skipped atom 1808, because occupancy 0.5 <= existing 0.500001 Skipped atom 1809, because occupancy 0.5 <= existing 0.500001 Skipped atom 1814, because occupancy 0.5 <= existing 0.500001 Skipped atom 1815, because occupancy 0.5 <= existing 0.500001 Skipped atom 1816, because occupancy 0.5 <= existing 0.500001 Skipped atom 1817, because occupancy 0.5 <= existing 0.500001 Skipped atom 1823, because occupancy 0.5 <= existing 0.500001 Skipped atom 1824, because occupancy 0.5 <= existing 0.500001 Skipped atom 1825, because occupancy 0.5 <= existing 0.500001 Skipped atom 1826, because occupancy 0.5 <= existing 0.500001 Skipped atom 1827, because occupancy 0.5 <= existing 0.500001 Skipped atom 1832, because occupancy 0.5 <= existing 0.500001 Skipped atom 1833, because occupancy 0.5 <= existing 0.500001 Skipped atom 1834, because occupancy 0.5 <= existing 0.500001 Skipped atom 1835, because occupancy 0.5 <= existing 0.500001 Skipped atom 2036, because occupancy 0.5 <= existing 0.500001 Skipped atom 2037, because occupancy 0.5 <= existing 0.500001 Skipped atom 2038, because occupancy 0.5 <= existing 0.500001 Skipped atom 2039, because occupancy 0.5 <= existing 0.500001 Skipped atom 2040, because occupancy 0.5 <= existing 0.500001 Skipped atom 2041, because occupancy 0.5 <= existing 0.500001 Skipped atom 2042, because occupancy 0.5 <= existing 0.500001 Skipped atom 2043, because occupancy 0.5 <= existing 0.500001 # found chain 1gt91 in template set T0191 85 :DLDGVDIII 1gt91 89 :LAPGAKIAV Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.11113 Ang L3.O and V6.CG1 other bump:2.85789 Ang G1.C and D4.OD1 Number of specific fragments= 1 total=1981 # 2cmd.85.65 read from T0191.t2k.frag # found chain 2cmd in template set T0191 85 :DLDGVDIII 2cmd 66 :ALEGADVVL Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.69136 Ang V6.CG1 and I9.CG2 other bump:2.58024 Ang V6.CG1 and I8.O Number of specific fragments= 1 total=1982 # 6ldh.86.86 read from T0191.t2k.frag # found chain 6ldh in template set T0191 86 :LDGVDIIIN 6ldh 86 :SAGSKLVVI Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.98501 Ang V5.CG1 and I7.C other bump:2.39976 Ang V5.CG1 and I7.O self-bump: 1.38022 Ang D6.CA and D6.CB Number of specific fragments= 1 total=1983 # 1ir6A.86.86 read from T0191.t2k.frag # found chain 1ir6A in template set T0191 86 :LDGVDIIIN 1ir6A 126 :LEASDLFLT Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.88467 Ang V5.CG1 and I7.C Number of specific fragments= 1 total=1984 # 1gt91.86.89 read from T0191.t2k.frag # found chain 1gt91 in template set T0191 86 :LDGVDIIIN 1gt91 90 :APGAKIAVY Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.11113 Ang L2.O and V5.CG1 Number of specific fragments= 1 total=1985 # 6ldh.86.87 read from T0191.t2k.frag # found chain 6ldh in template set T0191 86 :LDGVDIIIN 6ldh 87 :AGSKLVVIT Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues self-bump: 1.37777 Ang V5.CA and V5.CB self-bump: 1.39544 Ang L2.CA and L2.CB Number of specific fragments= 1 total=1986 # 1a9nA.86.86 read from T0191.t2k.frag # found chain 1a9nA in template set T0191 86 :LDGVDIIIN 1a9nA 87 :LPDLTELIL Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.85174 Ang L2.CB and V5.CG2 Number of specific fragments= 1 total=1987 # 2hdhA.86.86 read from T0191.t2k.frag # adding 2hdhA to template set 2hdhA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 1961, because occupancy 0.5 <= existing 0.500001 Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 1963, because occupancy 0.5 <= existing 0.500001 Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 1965, because occupancy 0.5 <= existing 0.500001 Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 1967, because occupancy 0.5 <= existing 0.500001 Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 1969, because occupancy 0.5 <= existing 0.500001 Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 1971, because occupancy 0.5 <= existing 0.500001 Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 1973, because occupancy 0.5 <= existing 0.500001 Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 1975, because occupancy 0.5 <= existing 0.500001 # found chain 2hdhA in template set T0191 86 :LDGVDIIIN 2hdhA 98 :VHSTDLVVE Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.50569 Ang L2.CD2 and I8.CG2 other bump:3.16821 Ang L2.CA and V5.CG2 Number of specific fragments= 1 total=1988 # 6ldh.87.87 read from T0191.t2k.frag # found chain 6ldh in template set T0191 87 :DGVDIIINA 6ldh 87 :AGSKLVVIT Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.98501 Ang V4.CG1 and I6.C other bump:2.39976 Ang V4.CG1 and I6.O self-bump: 1.38022 Ang D5.CA and D5.CB Number of specific fragments= 1 total=1989 # 1ir6A.87.87 read from T0191.t2k.frag # found chain 1ir6A in template set T0191 87 :DGVDIIINA 1ir6A 127 :EASDLFLTV Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.88467 Ang V4.CG1 and I6.C Number of specific fragments= 1 total=1990 # 1gt91.87.90 read from T0191.t2k.frag # found chain 1gt91 in template set T0191 87 :DGVDIIINA 1gt91 91 :PGAKIAVYF Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.11113 Ang G1.O and V4.CG1 Number of specific fragments= 1 total=1991 # 6ldh.87.88 read from T0191.t2k.frag # found chain 6ldh in template set T0191 87 :DGVDIIINA 6ldh 88 :GSKLVVITA Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues self-bump: 1.37777 Ang V4.CA and V4.CB Number of specific fragments= 1 total=1992 # 2hdhA.87.87 read from T0191.t2k.frag # found chain 2hdhA in template set T0191 87 :DGVDIIINA 2hdhA 99 :HSTDLVVEA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1993 # 1d4aA.87.91 read from T0191.t2k.frag # adding 1d4aA to template set 1d4aA:# found chain 1d4aA in template set T0191 87 :DGVDIIINA 1d4aA 92 :EAADLVIFQ Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.87784 Ang V4.CG1 and I7.CG2 other bump:3.04951 Ang V4.CG1 and I6.C other bump:2.29512 Ang V4.CG1 and I6.O Number of specific fragments= 1 total=1994 # 6ldh.88.88 read from T0191.t2k.frag # found chain 6ldh in template set T0191 88 :GVDIIINAT 6ldh 88 :GSKLVVITA Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.98501 Ang V3.CG1 and I5.C other bump:2.39976 Ang V3.CG1 and I5.O self-bump: 1.38022 Ang D4.CA and D4.CB Number of specific fragments= 1 total=1995 # 1gt91.88.91 read from T0191.t2k.frag # found chain 1gt91 in template set T0191 88 :GVDIIINAT 1gt91 92 :GAKIAVYFA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1996 # 2hdhA.88.88 read from T0191.t2k.frag # found chain 2hdhA in template set T0191 88 :GVDIIINAT 2hdhA 100 :STDLVVEAI Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1997 # 6ldh.88.89 read from T0191.t2k.frag # found chain 6ldh in template set T0191 88 :GVDIIINAT 6ldh 89 :SKLVVITAG Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues self-bump: 1.37777 Ang V3.CA and V3.CB Number of specific fragments= 1 total=1998 # 1d4aA.88.92 read from T0191.t2k.frag # found chain 1d4aA in template set T0191 88 :GVDIIINAT 1d4aA 93 :AADLVIFQF Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.87784 Ang V3.CG1 and I6.CG2 other bump:3.04951 Ang V3.CG1 and I5.C other bump:2.29512 Ang V3.CG1 and I5.O Number of specific fragments= 1 total=1999 # 1cf2O.88.77 read from T0191.t2k.frag # adding 1cf2O to template set 1cf2O:# found chain 1cf2O in template set T0191 88 :GVDIIINAT 1cf2O 78 :EADIVIDCT Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.86817 Ang V3.CG2 and I5.C other bump:2.05973 Ang V3.CG2 and I5.O Number of specific fragments= 1 total=2000 # 6ldh.89.89 read from T0191.t2k.frag # found chain 6ldh in template set T0191 89 :VDIIINATP 6ldh 89 :SKLVVITAG Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.17052 Ang T9.CA and P10.CD neighbor-bump: 2.40977 Ang T9.O and P10.CD neighbor-bump: 1.55578 Ang T9.C and P10.CD neighbor-bump: 2.80047 Ang T9.C and P10.CG self-bump: 1.38022 Ang D3.CA and D3.CB Number of specific fragments= 1 total=2001 # 1gt91.89.92 read from T0191.t2k.frag # found chain 1gt91 in template set T0191 89 :VDIIINATP 1gt91 93 :AKIAVYFAP Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2002 # 2hdhA.89.89 read from T0191.t2k.frag # found chain 2hdhA in template set T0191 89 :VDIIINATP 2hdhA 101 :TDLVVEAIV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2003 # 6ldh.89.90 read from T0191.t2k.frag # found chain 6ldh in template set T0191 89 :VDIIINATP 6ldh 90 :KLVVITAGA Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues self-bump: 1.37777 Ang V2.CA and V2.CB Number of specific fragments= 1 total=2004 # 1cf2O.89.78 read from T0191.t2k.frag # found chain 1cf2O in template set T0191 89 :VDIIINATP 1cf2O 79 :ADIVIDCTP Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.60324 Ang V2.CG1 and I4.C other bump:2.03716 Ang V2.CG1 and I4.O other bump:3.04388 Ang V2.CG1 and I4.CA other bump:2.49323 Ang V2.CG1 and I4.N Number of specific fragments= 1 total=2005 # 1d4aA.89.93 read from T0191.t2k.frag # found chain 1d4aA in template set T0191 89 :VDIIINATP 1d4aA 94 :ADLVIFQFP Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.69167 Ang V2.CG1 and I5.CG2 other bump:2.96098 Ang V2.CG1 and I4.C other bump:2.31777 Ang V2.CG1 and I4.O Number of specific fragments= 1 total=2006 # 6ldh.90.90 read from T0191.t2k.frag # found chain 6ldh in template set T0191 90 :DIIINATPI 6ldh 90 :KLVVITAGA Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.29288 Ang T8.CA and P9.CD neighbor-bump: 1.65609 Ang T8.C and P9.CD self-bump: 1.35724 Ang D2.CA and D2.CB Number of specific fragments= 1 total=2007 # 1gt91.90.93 read from T0191.t2k.frag # found chain 1gt91 in template set T0191 90 :DIIINATPI 1gt91 94 :KIAVYFAPN Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2008 # 2hdhA.90.90 read from T0191.t2k.frag # found chain 2hdhA in template set T0191 90 :DIIINATPI 2hdhA 102 :DLVVEAIVE Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.74107 Ang T8.CB and P9.CD Number of specific fragments= 1 total=2009 # 6ldh.90.91 read from T0191.t2k.frag # found chain 6ldh in template set T0191 90 :DIIINATPI 6ldh 91 :LVVITAGAR Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2010 # 5ldh.90.90 read from T0191.t2k.frag # adding 5ldh to template set 5ldh:Bad short name: ACE for alphabet: ExtAA Replacing ACE with X Bad short name: ACE for alphabet: ExtAA Replacing ACE with X Bad short name: ACE for alphabet: ExtAA Replacing ACE with X Bad short name: ACE for alphabet: ExtAA Replacing ACE with X Bad short name: ACE for alphabet: ExtAA Replacing ACE with X Bad short name: ACE for alphabet: ExtAA Replacing ACE with X Bad short name: AE1 for alphabet: pdb_atoms Bad short name: AE2 for alphabet: pdb_atoms Bad short name: AE1 for alphabet: pdb_atoms Bad short name: AE2 for alphabet: pdb_atoms Bad short name: AD1 for alphabet: pdb_atoms Bad short name: AD2 for alphabet: pdb_atoms Bad short name: AE1 for alphabet: pdb_atoms Bad short name: AE2 for alphabet: pdb_atoms Bad short name: AE1 for alphabet: pdb_atoms Bad short name: AE2 for alphabet: pdb_atoms Bad short name: AE1 for alphabet: pdb_atoms Bad short name: AE2 for alphabet: pdb_atoms Bad short name: AD1 for alphabet: pdb_atoms Bad short name: AD2 for alphabet: pdb_atoms Bad short name: AD1 for alphabet: pdb_atoms Bad short name: AD2 for alphabet: pdb_atoms Bad short name: AE1 for alphabet: pdb_atoms Bad short name: AE2 for alphabet: pdb_atoms Bad short name: AE1 for alphabet: pdb_atoms Bad short name: AE2 for alphabet: pdb_atoms Bad short name: AD1 for alphabet: pdb_atoms Bad short name: AD2 for alphabet: pdb_atoms Bad short name: AE1 for alphabet: pdb_atoms Bad short name: AE2 for alphabet: pdb_atoms Bad short name: AD1 for alphabet: pdb_atoms Bad short name: AD2 for alphabet: pdb_atoms Bad short name: AD1 for alphabet: pdb_atoms Bad short name: AD2 for alphabet: pdb_atoms Bad short name: AE1 for alphabet: pdb_atoms Bad short name: AE2 for alphabet: pdb_atoms Bad short name: AD1 for alphabet: pdb_atoms Bad short name: AD2 for alphabet: pdb_atoms Bad short name: AD1 for alphabet: pdb_atoms Bad short name: AD2 for alphabet: pdb_atoms Bad short name: AD1 for alphabet: pdb_atoms Bad short name: AD2 for alphabet: pdb_atoms Bad short name: AD1 for alphabet: pdb_atoms Bad short name: AD2 for alphabet: pdb_atoms Bad short name: AE1 for alphabet: pdb_atoms Bad short name: AE2 for alphabet: pdb_atoms Bad short name: AE1 for alphabet: pdb_atoms Bad short name: AE2 for alphabet: pdb_atoms Bad short name: AD1 for alphabet: pdb_atoms Bad short name: AD2 for alphabet: pdb_atoms Bad short name: AD1 for alphabet: pdb_atoms Bad short name: AD2 for alphabet: pdb_atoms Bad short name: AD1 for alphabet: pdb_atoms Bad short name: AD2 for alphabet: pdb_atoms Bad short name: AD1 for alphabet: pdb_atoms Bad short name: AD2 for alphabet: pdb_atoms Bad short name: AD1 for alphabet: pdb_atoms Bad short name: AD2 for alphabet: pdb_atoms Bad short name: AE1 for alphabet: pdb_atoms Bad short name: AE2 for alphabet: pdb_atoms Bad short name: AD1 for alphabet: pdb_atoms Bad short name: AD2 for alphabet: pdb_atoms Bad short name: AD1 for alphabet: pdb_atoms Bad short name: AD2 for alphabet: pdb_atoms Bad short name: AD1 for alphabet: pdb_atoms Bad short name: AD2 for alphabet: pdb_atoms Bad short name: AE1 for alphabet: pdb_atoms Bad short name: AE2 for alphabet: pdb_atoms Bad short name: AE1 for alphabet: pdb_atoms Bad short name: AE2 for alphabet: pdb_atoms Bad short name: AD1 for alphabet: pdb_atoms Bad short name: AD2 for alphabet: pdb_atoms Bad short name: AE1 for alphabet: pdb_atoms Bad short name: AE2 for alphabet: pdb_atoms # found chain 5ldh in template set T0191 90 :DIIINATPI 5ldh 92 :KIVVVTAGV Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues self-bump: 2.10203 Ang I10.N and I10.C self-bump: 1.34883 Ang I10.CA and I10.CB neighbor-bump: 2.52145 Ang A7.O and T8.CG2 self-bump: 2.35896 Ang I3.CG2 and I3.C self-bump: 1.28073 Ang D2.CA and D2.CB Number of specific fragments= 1 total=2011 # 1cf2O.90.79 read from T0191.t2k.frag # found chain 1cf2O in template set T0191 90 :DIIINATPI 1cf2O 80 :DIVIDCTPE Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2012 # 6ldh.91.91 read from T0191.t2k.frag # found chain 6ldh in template set T0191 91 :IIINATPIG 6ldh 91 :LVVITAGAR Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.29288 Ang T7.CA and P8.CD neighbor-bump: 1.65609 Ang T7.C and P8.CD Number of specific fragments= 1 total=2013 # 1gt91.91.94 read from T0191.t2k.frag # found chain 1gt91 in template set T0191 91 :IIINATPIG 1gt91 95 :IAVYFAPNT Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2014 # 2hdhA.91.91 read from T0191.t2k.frag # found chain 2hdhA in template set T0191 91 :IIINATPIG 2hdhA 103 :LVVEAIVEN Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.74107 Ang T7.CB and P8.CD Number of specific fragments= 1 total=2015 # 5ldh.91.91 read from T0191.t2k.frag # found chain 5ldh in template set T0191 91 :IIINATPIG 5ldh 93 :IVVVTAGVR Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues self-bump: 2.10203 Ang I9.N and I9.C self-bump: 1.34883 Ang I9.CA and I9.CB neighbor-bump: 2.52145 Ang A6.O and T7.CG2 self-bump: 2.35896 Ang I2.CG2 and I2.C Number of specific fragments= 1 total=2016 # 6ldh.91.92 read from T0191.t2k.frag # found chain 6ldh in template set T0191 91 :IIINATPIG 6ldh 92 :VVITAGARQ Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2017 # 1f6bA.91.94 read from T0191.t2k.frag # adding 1f6bA to template set 1f6bA:# found chain 1f6bA in template set T0191 91 :IIINATPIG 1f6bA 95 :GIVFLVDCA Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues self-bump: 1.38318 Ang P8.CA and P8.CB Number of specific fragments= 1 total=2018 # 6ldh.92.92 read from T0191.t2k.frag # found chain 6ldh in template set T0191 92 :IINATPIGM 6ldh 92 :VVITAGARQ Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.29288 Ang T6.CA and P7.CD neighbor-bump: 1.65609 Ang T6.C and P7.CD Number of specific fragments= 1 total=2019 # 1gt91.92.95 read from T0191.t2k.frag # found chain 1gt91 in template set T0191 92 :IINATPIGM 1gt91 96 :AVYFAPNTD Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2020 # 1fr9A.92.93 read from T0191.t2k.frag # found chain 1fr9A in template set T0191 92 :IINATPIGM 1fr9A 94 :WFLFCPCDT Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:3.3846 Ang P7.CD and M10.SD Number of specific fragments= 1 total=2021 # 1e5kA.92.93 read from T0191.t2k.frag # adding 1e5kA to template set 1e5kA:# found chain 1e5kA in template set T0191 92 :IINATPIGM 1e5kA 94 :WFLFCPCDT Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:3.08775 Ang P7.CG and M10.SD Number of specific fragments= 1 total=2022 # 1f6bA.92.95 read from T0191.t2k.frag # found chain 1f6bA in template set T0191 92 :IINATPIGM 1f6bA 96 :IVFLVDCAD Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues self-bump: 1.38318 Ang P7.CA and P7.CB Number of specific fragments= 1 total=2023 # 5ldh.92.92 read from T0191.t2k.frag # found chain 5ldh in template set T0191 92 :IINATPIGM 5ldh 94 :VVVTAGVRQ Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues self-bump: 2.10203 Ang I8.N and I8.C self-bump: 1.34883 Ang I8.CA and I8.CB neighbor-bump: 2.52145 Ang A5.O and T6.CG2 Number of specific fragments= 1 total=2024 # 1gt91.93.96 read from T0191.t2k.frag # found chain 1gt91 in template set T0191 93 :INATPIGMY 1gt91 97 :VYFAPNTDA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2025 # 6ldh.93.93 read from T0191.t2k.frag # found chain 6ldh in template set T0191 93 :INATPIGMY 6ldh 93 :VITAGARQQ Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.29288 Ang T5.CA and P6.CD neighbor-bump: 1.65609 Ang T5.C and P6.CD Number of specific fragments= 1 total=2026 # 1fr9A.93.94 read from T0191.t2k.frag # found chain 1fr9A in template set T0191 93 :INATPIGMY 1fr9A 95 :FLFCPCDTP Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2027 # 1e5kA.93.94 read from T0191.t2k.frag # found chain 1e5kA in template set T0191 93 :INATPIGMY 1e5kA 95 :FLFCPCDTP Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2028 # 1f6bA.93.96 read from T0191.t2k.frag # found chain 1f6bA in template set T0191 93 :INATPIGMY 1f6bA 97 :VFLVDCADH Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues self-bump: 1.38318 Ang P6.CA and P6.CB Number of specific fragments= 1 total=2029 # 1d2eA.93.93 read from T0191.t2k.frag # adding 1d2eA to template set 1d2eA:# found chain 1d2eA in template set T0191 93 :INATPIGMY 1d2eA 148 :ILVVAANDG Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.3068 Ang M9.O and Y10.CE2 neighbor-bump: 2.40197 Ang M9.C and Y10.CD2 neighbor-bump: 1.63196 Ang M9.O and Y10.CD2 neighbor-bump: 2.38187 Ang M9.O and Y10.CD1 neighbor-bump: 2.55415 Ang M9.C and Y10.CG neighbor-bump: 1.69397 Ang M9.O and Y10.CG Number of specific fragments= 1 total=2030 # 1gt91.94.97 read from T0191.t2k.frag # found chain 1gt91 in template set T0191 94 :NATPIGMYP 1gt91 98 :YFAPNTDAG Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.89184 Ang G7.C and P10.CD other bump:3.24016 Ang G7.CA and P10.CD other bump:2.39829 Ang P5.O and P10.CB other bump:3.17399 Ang P5.C and P10.CB Number of specific fragments= 1 total=2031 # 1fr9A.94.95 read from T0191.t2k.frag # found chain 1fr9A in template set T0191 94 :NATPIGMYP 1fr9A 96 :LFCPCDTPY Fragment has 8 clashes (null) has 8 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 1.7926 Ang Y9.C and P10.CD self-bump: 1.28986 Ang P10.N and P10.CD neighbor-bump: 2.19927 Ang Y9.N and P10.CD neighbor-bump: 2.11693 Ang Y9.CA and P10.CD neighbor-bump: 2.73778 Ang Y9.CB and P10.CD self-bump: 2.13023 Ang P10.N and P10.CG neighbor-bump: 2.98376 Ang Y9.CG and P10.CG neighbor-bump: 2.83296 Ang Y9.CD2 and P10.CG Number of specific fragments= 1 total=2032 # 6ldh.94.94 read from T0191.t2k.frag # found chain 6ldh in template set T0191 94 :NATPIGMYP 6ldh 94 :ITAGARQQE Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.29288 Ang T4.CA and P5.CD neighbor-bump: 1.65609 Ang T4.C and P5.CD Number of specific fragments= 1 total=2033 # 1e5kA.94.95 read from T0191.t2k.frag # found chain 1e5kA in template set T0191 94 :NATPIGMYP 1e5kA 96 :LFCPCDTPY Fragment has 8 clashes (null) has 8 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.11657 Ang Y9.N and P10.CD neighbor-bump: 2.0836 Ang Y9.CA and P10.CD neighbor-bump: 2.7418 Ang Y9.CB and P10.CD neighbor-bump: 1.78052 Ang Y9.C and P10.CD self-bump: 1.28704 Ang P10.N and P10.CD self-bump: 2.13899 Ang P10.N and P10.CG neighbor-bump: 2.99514 Ang Y9.CG and P10.CG neighbor-bump: 2.8324 Ang Y9.CD2 and P10.CG Number of specific fragments= 1 total=2034 # 1d2eA.94.94 read from T0191.t2k.frag # found chain 1d2eA in template set T0191 94 :NATPIGMYP 1d2eA 149 :LVVAANDGP Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2035 # 1f6bA.94.97 read from T0191.t2k.frag # found chain 1f6bA in template set T0191 94 :NATPIGMYP 1f6bA 98 :FLVDCADHE Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues self-bump: 1.38318 Ang P5.CA and P5.CB Number of specific fragments= 1 total=2036 # 1gt91.95.98 read from T0191.t2k.frag # found chain 1gt91 in template set T0191 95 :ATPIGMYPN 1gt91 99 :FAPNTDAGF Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.89184 Ang G6.C and P9.CD other bump:3.24015 Ang G6.CA and P9.CD other bump:3.17399 Ang P4.C and P9.CB other bump:2.39829 Ang P4.O and P9.CB Number of specific fragments= 1 total=2037 # 1fr9A.95.96 read from T0191.t2k.frag # found chain 1fr9A in template set T0191 95 :ATPIGMYPN 1fr9A 97 :FCPCDTPYI Fragment has 8 clashes (null) has 8 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 1.79259 Ang Y8.C and P9.CD self-bump: 1.28985 Ang P9.N and P9.CD neighbor-bump: 2.11693 Ang Y8.CA and P9.CD neighbor-bump: 2.19927 Ang Y8.N and P9.CD neighbor-bump: 2.73779 Ang Y8.CB and P9.CD self-bump: 2.13023 Ang P9.N and P9.CG neighbor-bump: 2.98376 Ang Y8.CG and P9.CG neighbor-bump: 2.83297 Ang Y8.CD2 and P9.CG Number of specific fragments= 1 total=2038 # 1e5kA.95.96 read from T0191.t2k.frag # found chain 1e5kA in template set T0191 95 :ATPIGMYPN 1e5kA 97 :FCPCDTPYI Fragment has 8 clashes (null) has 8 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.11657 Ang Y8.N and P9.CD neighbor-bump: 2.0836 Ang Y8.CA and P9.CD neighbor-bump: 2.74181 Ang Y8.CB and P9.CD neighbor-bump: 1.78051 Ang Y8.C and P9.CD self-bump: 1.28703 Ang P9.N and P9.CD self-bump: 2.13898 Ang P9.N and P9.CG neighbor-bump: 2.99514 Ang Y8.CG and P9.CG neighbor-bump: 2.8324 Ang Y8.CD2 and P9.CG Number of specific fragments= 1 total=2039 # 6ldh.95.95 read from T0191.t2k.frag # found chain 6ldh in template set T0191 95 :ATPIGMYPN 6ldh 95 :TAGARQQEG Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.29288 Ang T3.CA and P4.CD neighbor-bump: 1.65609 Ang T3.C and P4.CD Number of specific fragments= 1 total=2040 # 1d2eA.95.95 read from T0191.t2k.frag # found chain 1d2eA in template set T0191 95 :ATPIGMYPN 1d2eA 150 :VVAANDGPM Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2041 # 1rfbA.95.96 read from T0191.t2k.frag # adding 1rfbA to template set 1rfbA:# found chain 1rfbA in template set T0191 95 :ATPIGMYPN 1rfbA 97 :QIPVDDLQI Fragment has 13 clashes (null) has 13 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues self-bump: 2.11693 Ang N10.CB and N10.C other bump:2.78039 Ang P4.O and Y8.C other bump:2.4453 Ang P4.O and Y8.O neighbor-bump: 2.45316 Ang M7.O and Y8.CE1 neighbor-bump: 1.39607 Ang M7.O and Y8.CD1 neighbor-bump: 2.50863 Ang M7.C and Y8.CD1 neighbor-bump: 2.30554 Ang M7.O and Y8.CG neighbor-bump: 2.83269 Ang I5.CG2 and G6.CA neighbor-bump: 2.42256 Ang I5.CB and G6.N neighbor-bump: 1.62637 Ang I5.CG2 and G6.N self-bump: 2.32209 Ang I5.CG2 and I5.C neighbor-bump: 2.16745 Ang P4.O and I5.O self-bump: 1.32054 Ang I5.CA and I5.CB Number of specific fragments= 1 total=2042 # 1fr9A.96.97 read from T0191.t2k.frag # found chain 1fr9A in template set T0191 96 :TPIGMYPNI 1fr9A 98 :CPCDTPYIP Fragment has 9 clashes (null) has 9 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.11693 Ang Y7.CA and P8.CD neighbor-bump: 1.79259 Ang Y7.C and P8.CD self-bump: 1.28985 Ang P8.N and P8.CD neighbor-bump: 2.19927 Ang Y7.N and P8.CD neighbor-bump: 2.73779 Ang Y7.CB and P8.CD self-bump: 2.13023 Ang P8.N and P8.CG neighbor-bump: 2.98376 Ang Y7.CG and P8.CG neighbor-bump: 2.83297 Ang Y7.CD2 and P8.CG neighbor-bump: 2.43311 Ang G1.O and T2.CG2 Number of specific fragments= 1 total=2043 # 1e5kA.96.97 read from T0191.t2k.frag # found chain 1e5kA in template set T0191 96 :TPIGMYPNI 1e5kA 98 :CPCDTPYIP Fragment has 8 clashes (null) has 8 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.11657 Ang Y7.N and P8.CD neighbor-bump: 2.0836 Ang Y7.CA and P8.CD neighbor-bump: 2.74181 Ang Y7.CB and P8.CD neighbor-bump: 1.78051 Ang Y7.C and P8.CD self-bump: 1.28703 Ang P8.N and P8.CD self-bump: 2.13898 Ang P8.N and P8.CG neighbor-bump: 2.99514 Ang Y7.CG and P8.CG neighbor-bump: 2.8324 Ang Y7.CD2 and P8.CG Number of specific fragments= 1 total=2044 # 1gt91.96.99 read from T0191.t2k.frag # found chain 1gt91 in template set T0191 96 :TPIGMYPNI 1gt91 100 :APNTDAGFL Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.89184 Ang G5.C and P8.CD other bump:3.24015 Ang G5.CA and P8.CD other bump:2.39829 Ang P3.O and P8.CB other bump:3.17399 Ang P3.C and P8.CB Number of specific fragments= 1 total=2045 # 6ldh.96.96 read from T0191.t2k.frag # found chain 6ldh in template set T0191 96 :TPIGMYPNI 6ldh 96 :AGARQQEGE Fragment has 9 clashes (null) has 9 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.54752 Ang Y7.CB and I10.CD1 other bump:2.70416 Ang M6.SD and I10.CG2 other bump:2.60322 Ang Y7.N and I10.CG1 other bump:2.71436 Ang Y7.CA and I10.CG1 other bump:2.79003 Ang Y7.C and I10.CG1 other bump:2.18193 Ang Y7.CB and I10.CG1 other bump:2.84567 Ang M6.SD and I10.CB neighbor-bump: 2.29288 Ang T2.CA and P3.CD neighbor-bump: 1.65609 Ang T2.C and P3.CD Number of specific fragments= 1 total=2046 # 1rfbA.96.97 read from T0191.t2k.frag # found chain 1rfbA in template set T0191 96 :TPIGMYPNI 1rfbA 98 :IPVDDLQIQ Fragment has 13 clashes (null) has 13 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.78039 Ang P3.O and Y7.C other bump:2.4453 Ang P3.O and Y7.O neighbor-bump: 2.45316 Ang M6.O and Y7.CE1 neighbor-bump: 1.39607 Ang M6.O and Y7.CD1 neighbor-bump: 2.50863 Ang M6.C and Y7.CD1 neighbor-bump: 2.30554 Ang M6.O and Y7.CG neighbor-bump: 2.83269 Ang I4.CG2 and G5.CA neighbor-bump: 2.42256 Ang I4.CB and G5.N neighbor-bump: 1.62637 Ang I4.CG2 and G5.N self-bump: 2.32209 Ang I4.CG2 and I4.C neighbor-bump: 2.16745 Ang P3.O and I4.O self-bump: 1.32054 Ang I4.CA and I4.CB self-bump: 2.22061 Ang T2.CA and T2.OG1 Number of specific fragments= 1 total=2047 # 1d2eA.96.96 read from T0191.t2k.frag # found chain 1d2eA in template set T0191 96 :TPIGMYPNI 1d2eA 151 :VAANDGPMP Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2048 # 1fr9A.97.98 read from T0191.t2k.frag # found chain 1fr9A in template set T0191 97 :PIGMYPNID 1fr9A 99 :PCDTPYIPP Fragment has 8 clashes (null) has 8 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues self-bump: 1.28985 Ang P7.N and P7.CD neighbor-bump: 2.19927 Ang Y6.N and P7.CD neighbor-bump: 2.11693 Ang Y6.CA and P7.CD neighbor-bump: 1.79259 Ang Y6.C and P7.CD neighbor-bump: 2.73779 Ang Y6.CB and P7.CD self-bump: 2.13023 Ang P7.N and P7.CG neighbor-bump: 2.98376 Ang Y6.CG and P7.CG neighbor-bump: 2.83297 Ang Y6.CD2 and P7.CG Number of specific fragments= 1 total=2049 # 1e5kA.97.98 read from T0191.t2k.frag # found chain 1e5kA in template set T0191 97 :PIGMYPNID 1e5kA 99 :PCDTPYIPP Fragment has 8 clashes (null) has 8 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.11657 Ang Y6.N and P7.CD neighbor-bump: 2.0836 Ang Y6.CA and P7.CD neighbor-bump: 2.74181 Ang Y6.CB and P7.CD neighbor-bump: 1.78051 Ang Y6.C and P7.CD self-bump: 1.28703 Ang P7.N and P7.CD self-bump: 2.13898 Ang P7.N and P7.CG neighbor-bump: 2.99514 Ang Y6.CG and P7.CG neighbor-bump: 2.8324 Ang Y6.CD2 and P7.CG Number of specific fragments= 1 total=2050 # 1gt91.97.100 read from T0191.t2k.frag # found chain 1gt91 in template set T0191 97 :PIGMYPNID 1gt91 101 :PNTDAGFLN Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.89184 Ang G4.C and P7.CD other bump:3.24015 Ang G4.CA and P7.CD other bump:3.17399 Ang P2.C and P7.CB other bump:2.39829 Ang P2.O and P7.CB Number of specific fragments= 1 total=2051 # 1rfbA.97.98 read from T0191.t2k.frag # found chain 1rfbA in template set T0191 97 :PIGMYPNID 1rfbA 99 :PVDDLQIQR Fragment has 12 clashes (null) has 12 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.78039 Ang P2.O and Y6.C other bump:2.4453 Ang P2.O and Y6.O neighbor-bump: 2.45316 Ang M5.O and Y6.CE1 neighbor-bump: 1.39607 Ang M5.O and Y6.CD1 neighbor-bump: 2.50863 Ang M5.C and Y6.CD1 neighbor-bump: 2.30554 Ang M5.O and Y6.CG neighbor-bump: 2.83269 Ang I3.CG2 and G4.CA neighbor-bump: 2.42256 Ang I3.CB and G4.N neighbor-bump: 1.62637 Ang I3.CG2 and G4.N self-bump: 2.32209 Ang I3.CG2 and I3.C neighbor-bump: 2.16745 Ang P2.O and I3.O self-bump: 1.32054 Ang I3.CA and I3.CB Number of specific fragments= 1 total=2052 # 6ldh.97.97 read from T0191.t2k.frag # found chain 6ldh in template set T0191 97 :PIGMYPNID 6ldh 97 :GARQQEGES Fragment has 8 clashes (null) has 8 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.54752 Ang Y6.CB and I9.CD1 other bump:2.70416 Ang M5.SD and I9.CG2 other bump:2.60322 Ang Y6.N and I9.CG1 other bump:2.71436 Ang Y6.CA and I9.CG1 other bump:2.79003 Ang Y6.C and I9.CG1 other bump:2.18193 Ang Y6.CB and I9.CG1 other bump:2.84567 Ang M5.SD and I9.CB neighbor-bump: 1.65609 Ang G1.C and P2.CD Number of specific fragments= 1 total=2053 # 1e2tA.97.101 read from T0191.t2k.frag # adding 1e2tA to template set 1e2tA:# found chain 1e2tA in template set T0191 97 :PIGMYPNID 1e2tA 99 :PASLPPRTH Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:3.05104 Ang P2.CG and Y6.CZ other bump:2.4519 Ang P2.CB and Y6.CE2 other bump:2.02202 Ang P2.CG and Y6.CE2 other bump:2.84678 Ang P2.CG and Y6.CD2 Number of specific fragments= 1 total=2054 # 1fr9A.98.99 read from T0191.t2k.frag # found chain 1fr9A in template set T0191 98 :IGMYPNIDV 1fr9A 100 :CDTPYIPPD Fragment has 8 clashes (null) has 8 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues self-bump: 1.28985 Ang P6.N and P6.CD neighbor-bump: 2.19927 Ang Y5.N and P6.CD neighbor-bump: 2.11693 Ang Y5.CA and P6.CD neighbor-bump: 1.79259 Ang Y5.C and P6.CD neighbor-bump: 2.73779 Ang Y5.CB and P6.CD self-bump: 2.13023 Ang P6.N and P6.CG neighbor-bump: 2.98376 Ang Y5.CG and P6.CG neighbor-bump: 2.83297 Ang Y5.CD2 and P6.CG Number of specific fragments= 1 total=2055 # 1e5kA.98.99 read from T0191.t2k.frag # found chain 1e5kA in template set T0191 98 :IGMYPNIDV 1e5kA 100 :CDTPYIPPD Fragment has 8 clashes (null) has 8 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.74181 Ang Y5.CB and P6.CD neighbor-bump: 2.11657 Ang Y5.N and P6.CD neighbor-bump: 2.0836 Ang Y5.CA and P6.CD neighbor-bump: 1.78051 Ang Y5.C and P6.CD self-bump: 1.28703 Ang P6.N and P6.CD neighbor-bump: 2.99514 Ang Y5.CG and P6.CG self-bump: 2.13898 Ang P6.N and P6.CG neighbor-bump: 2.8324 Ang Y5.CD2 and P6.CG Number of specific fragments= 1 total=2056 # 1e2tA.98.102 read from T0191.t2k.frag # found chain 1e2tA in template set T0191 98 :IGMYPNIDV 1e2tA 100 :ASLPPRTHR Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2057 # 1rfbA.98.99 read from T0191.t2k.frag # found chain 1rfbA in template set T0191 98 :IGMYPNIDV 1rfbA 100 :VDDLQIQRK Fragment has 12 clashes (null) has 12 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.78039 Ang G1.O and Y5.C other bump:2.4453 Ang G1.O and Y5.O neighbor-bump: 2.45316 Ang M4.O and Y5.CE1 neighbor-bump: 1.39607 Ang M4.O and Y5.CD1 neighbor-bump: 2.50863 Ang M4.C and Y5.CD1 neighbor-bump: 2.30554 Ang M4.O and Y5.CG neighbor-bump: 2.83269 Ang I2.CG2 and G3.CA neighbor-bump: 2.42256 Ang I2.CB and G3.N neighbor-bump: 1.62638 Ang I2.CG2 and G3.N self-bump: 2.3221 Ang I2.CG2 and I2.C neighbor-bump: 2.16745 Ang G1.O and I2.O self-bump: 1.32054 Ang I2.CA and I2.CB Number of specific fragments= 1 total=2058 # 1bkpA.98.99 read from T0191.t2k.frag # found chain 1bkpA in template set T0191 98 :IGMYPNIDV 1bkpA 101 :DGTIGHAYG Fragment has 13 clashes (null) has 13 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues self-bump: 1.37266 Ang D9.CA and D9.CB neighbor-bump: 2.63162 Ang I8.CG2 and D9.N other bump:3.02538 Ang P6.CG and I8.CG1 neighbor-bump: 2.40933 Ang Y5.N and P6.CD neighbor-bump: 1.44953 Ang Y5.CA and P6.CD neighbor-bump: 2.73183 Ang Y5.CB and P6.CD neighbor-bump: 0.382676 Ang Y5.C and P6.CD neighbor-bump: 1.31406 Ang Y5.O and P6.CD neighbor-bump: 2.65425 Ang Y5.CA and P6.CG neighbor-bump: 1.38318 Ang Y5.C and P6.CG neighbor-bump: 0.335647 Ang Y5.O and P6.CG neighbor-bump: 2.29241 Ang Y5.C and P6.CB neighbor-bump: 1.79889 Ang Y5.O and P6.CB Number of specific fragments= 1 total=2059 # 1ds9A.98.101 read from T0191.t2k.frag # found chain 1ds9A in template set T0191 98 :IGMYPNIDV 1ds9A 102 :YNQIASLSG Fragment has 8 clashes (null) has 8 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.42813 Ang N7.ND2 and V10.CG2 other bump:3.03919 Ang N7.CG and V10.N neighbor-bump: 1.40947 Ang Y5.C and P6.CD self-bump: 1.34424 Ang P6.N and P6.CD neighbor-bump: 1.984 Ang Y5.CA and P6.CD neighbor-bump: 2.34204 Ang Y5.O and P6.CD neighbor-bump: 2.34029 Ang Y5.C and P6.CG self-bump: 2.2075 Ang P6.N and P6.CG Number of specific fragments= 1 total=2060 # 1fr9A.99.100 read from T0191.t2k.frag # found chain 1fr9A in template set T0191 99 :GMYPNIDVE 1fr9A 101 :DTPYIPPDL Fragment has 8 clashes (null) has 8 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.19927 Ang Y4.N and P5.CD neighbor-bump: 2.11693 Ang Y4.CA and P5.CD neighbor-bump: 1.79259 Ang Y4.C and P5.CD self-bump: 1.28985 Ang P5.N and P5.CD neighbor-bump: 2.73779 Ang Y4.CB and P5.CD self-bump: 2.13023 Ang P5.N and P5.CG neighbor-bump: 2.98376 Ang Y4.CG and P5.CG neighbor-bump: 2.83297 Ang Y4.CD2 and P5.CG Number of specific fragments= 1 total=2061 # 1e5kA.99.100 read from T0191.t2k.frag # found chain 1e5kA in template set T0191 99 :GMYPNIDVE 1e5kA 101 :DTPYIPPDL Fragment has 8 clashes (null) has 8 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.11657 Ang Y4.N and P5.CD neighbor-bump: 2.0836 Ang Y4.CA and P5.CD neighbor-bump: 2.74181 Ang Y4.CB and P5.CD neighbor-bump: 1.78051 Ang Y4.C and P5.CD self-bump: 1.28703 Ang P5.N and P5.CD self-bump: 2.13898 Ang P5.N and P5.CG neighbor-bump: 2.99514 Ang Y4.CG and P5.CG neighbor-bump: 2.8324 Ang Y4.CD2 and P5.CG Number of specific fragments= 1 total=2062 # 1e2tA.99.103 read from T0191.t2k.frag # found chain 1e2tA in template set T0191 99 :GMYPNIDVE 1e2tA 101 :SLPPRTHRL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2063 # 1rfbA.99.100 read from T0191.t2k.frag # found chain 1rfbA in template set T0191 99 :GMYPNIDVE 1rfbA 101 :DDLQIQRKA Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.45316 Ang M3.O and Y4.CE1 neighbor-bump: 1.39607 Ang M3.O and Y4.CD1 neighbor-bump: 2.50863 Ang M3.C and Y4.CD1 neighbor-bump: 2.30554 Ang M3.O and Y4.CG Number of specific fragments= 1 total=2064 # 1bkpA.99.100 read from T0191.t2k.frag # found chain 1bkpA in template set T0191 99 :GMYPNIDVE 1bkpA 102 :GTIGHAYGF Fragment has 20 clashes (null) has 20 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.69363 Ang N6.CG and E10.OE2 other bump:1.82001 Ang N6.OD1 and E10.OE2 other bump:2.26864 Ang P5.O and E10.OE1 other bump:2.0578 Ang N6.CA and E10.OE1 other bump:2.68062 Ang P5.C and E10.OE1 other bump:2.71856 Ang N6.CA and E10.CD other bump:2.55398 Ang N6.OD1 and E10.CD self-bump: 1.37266 Ang D8.CA and D8.CB neighbor-bump: 2.63162 Ang I7.CG2 and D8.N other bump:3.02538 Ang P5.CG and I7.CG1 neighbor-bump: 2.73183 Ang Y4.CB and P5.CD neighbor-bump: 2.40933 Ang Y4.N and P5.CD neighbor-bump: 1.44953 Ang Y4.CA and P5.CD neighbor-bump: 0.382676 Ang Y4.C and P5.CD neighbor-bump: 1.31406 Ang Y4.O and P5.CD neighbor-bump: 2.65425 Ang Y4.CA and P5.CG neighbor-bump: 1.38318 Ang Y4.C and P5.CG neighbor-bump: 0.335647 Ang Y4.O and P5.CG neighbor-bump: 2.29241 Ang Y4.C and P5.CB neighbor-bump: 1.79889 Ang Y4.O and P5.CB Number of specific fragments= 1 total=2065 # 1ds9A.99.102 read from T0191.t2k.frag # found chain 1ds9A in template set T0191 99 :GMYPNIDVE 1ds9A 103 :NQIASLSGI Fragment has 9 clashes (null) has 9 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.54234 Ang Y4.CE1 and E10.OE1 other bump:2.42813 Ang N6.ND2 and V9.CG2 other bump:3.03919 Ang N6.CG and V9.N neighbor-bump: 1.40947 Ang Y4.C and P5.CD self-bump: 1.34424 Ang P5.N and P5.CD neighbor-bump: 1.984 Ang Y4.CA and P5.CD neighbor-bump: 2.34204 Ang Y4.O and P5.CD neighbor-bump: 2.34029 Ang Y4.C and P5.CG self-bump: 2.2075 Ang P5.N and P5.CG Number of specific fragments= 1 total=2066 # 1fr9A.100.101 read from T0191.t2k.frag # found chain 1fr9A in template set T0191 100 :MYPNIDVEP 1fr9A 102 :TPYIPPDLA Fragment has 8 clashes (null) has 8 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.11693 Ang Y3.CA and P4.CD neighbor-bump: 1.7926 Ang Y3.C and P4.CD self-bump: 1.28986 Ang P4.N and P4.CD neighbor-bump: 2.19927 Ang Y3.N and P4.CD neighbor-bump: 2.73779 Ang Y3.CB and P4.CD self-bump: 2.13023 Ang P4.N and P4.CG neighbor-bump: 2.98376 Ang Y3.CG and P4.CG neighbor-bump: 2.83296 Ang Y3.CD2 and P4.CG Number of specific fragments= 1 total=2067 # 1e5kA.100.101 read from T0191.t2k.frag # found chain 1e5kA in template set T0191 100 :MYPNIDVEP 1e5kA 102 :TPYIPPDLA Fragment has 8 clashes (null) has 8 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.11657 Ang Y3.N and P4.CD neighbor-bump: 2.74181 Ang Y3.CB and P4.CD neighbor-bump: 2.0836 Ang Y3.CA and P4.CD neighbor-bump: 1.78051 Ang Y3.C and P4.CD self-bump: 1.28703 Ang P4.N and P4.CD self-bump: 2.13898 Ang P4.N and P4.CG neighbor-bump: 2.99515 Ang Y3.CG and P4.CG neighbor-bump: 2.83241 Ang Y3.CD2 and P4.CG Number of specific fragments= 1 total=2068 # 1rfbA.100.101 read from T0191.t2k.frag # found chain 1rfbA in template set T0191 100 :MYPNIDVEP 1rfbA 102 :DLQIQRKAI Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.64977 Ang E9.N and P10.CD neighbor-bump: 2.8311 Ang E9.CB and P10.CD neighbor-bump: 2.45316 Ang M2.O and Y3.CE1 neighbor-bump: 1.39608 Ang M2.O and Y3.CD1 neighbor-bump: 2.50864 Ang M2.C and Y3.CD1 neighbor-bump: 2.30554 Ang M2.O and Y3.CG Number of specific fragments= 1 total=2069 # 1e2tA.100.104 read from T0191.t2k.frag # found chain 1e2tA in template set T0191 100 :MYPNIDVEP 1e2tA 102 :LPPRTHRLL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2070 # 1bkpA.100.101 read from T0191.t2k.frag # found chain 1bkpA in template set T0191 100 :MYPNIDVEP 1bkpA 103 :TIGHAYGFQ Fragment has 21 clashes (null) has 21 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.7226 Ang N5.CA and E9.OE2 other bump:2.56724 Ang N5.CB and E9.OE2 other bump:2.30261 Ang N5.CG and E9.OE2 other bump:1.68104 Ang N5.OD1 and E9.OE2 other bump:2.36367 Ang P4.O and E9.OE1 other bump:2.42239 Ang N5.CA and E9.OE1 other bump:2.52517 Ang N5.CA and E9.CD other bump:2.50479 Ang N5.OD1 and E9.CD self-bump: 1.37266 Ang D7.CA and D7.CB neighbor-bump: 2.63162 Ang I6.CG2 and D7.N other bump:3.02538 Ang P4.CG and I6.CG1 neighbor-bump: 2.40932 Ang Y3.N and P4.CD neighbor-bump: 1.44952 Ang Y3.CA and P4.CD neighbor-bump: 2.73184 Ang Y3.CB and P4.CD neighbor-bump: 0.382671 Ang Y3.C and P4.CD neighbor-bump: 1.31406 Ang Y3.O and P4.CD neighbor-bump: 2.65425 Ang Y3.CA and P4.CG neighbor-bump: 1.38318 Ang Y3.C and P4.CG neighbor-bump: 0.335644 Ang Y3.O and P4.CG neighbor-bump: 2.29241 Ang Y3.C and P4.CB neighbor-bump: 1.79889 Ang Y3.O and P4.CB Number of specific fragments= 1 total=2071 # 1spgB.100.101 read from T0191.t2k.frag # adding 1spgB to template set 1spgB:# found chain 1spgB in template set T0191 100 :MYPNIDVEP 1spgB 102 :NFRLLGEII Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.71764 Ang I6.C and P10.CD other bump:1.50031 Ang I6.O and P10.CD other bump:2.27151 Ang I6.O and P10.CG other bump:2.40469 Ang Y3.C and D7.OD1 other bump:1.31244 Ang Y3.O and D7.OD1 other bump:2.47773 Ang Y3.O and D7.CG Number of specific fragments= 1 total=2072 # 1fr9A.101.102 read from T0191.t2k.frag # found chain 1fr9A in template set T0191 101 :YPNIDVEPI 1fr9A 103 :PYIPPDLAA Fragment has 8 clashes (null) has 8 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.19927 Ang Y2.N and P3.CD neighbor-bump: 2.11693 Ang Y2.CA and P3.CD self-bump: 1.28986 Ang P3.N and P3.CD neighbor-bump: 2.73779 Ang Y2.CB and P3.CD neighbor-bump: 1.7926 Ang Y2.C and P3.CD self-bump: 2.13023 Ang P3.N and P3.CG neighbor-bump: 2.98376 Ang Y2.CG and P3.CG neighbor-bump: 2.83297 Ang Y2.CD2 and P3.CG Number of specific fragments= 1 total=2073 # 1e5kA.101.102 read from T0191.t2k.frag # found chain 1e5kA in template set T0191 101 :YPNIDVEPI 1e5kA 103 :PYIPPDLAA Fragment has 8 clashes (null) has 8 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.11657 Ang Y2.N and P3.CD neighbor-bump: 2.08359 Ang Y2.CA and P3.CD neighbor-bump: 2.7418 Ang Y2.CB and P3.CD neighbor-bump: 1.78052 Ang Y2.C and P3.CD self-bump: 1.28704 Ang P3.N and P3.CD self-bump: 2.13898 Ang P3.N and P3.CG neighbor-bump: 2.99514 Ang Y2.CG and P3.CG neighbor-bump: 2.83241 Ang Y2.CD2 and P3.CG Number of specific fragments= 1 total=2074 # 1rfbA.101.102 read from T0191.t2k.frag # found chain 1rfbA in template set T0191 101 :YPNIDVEPI 1rfbA 103 :LQIQRKAIN Fragment has 9 clashes (null) has 9 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.06619 Ang V7.CG1 and I10.CD1 other bump:2.99136 Ang V7.CB and I10.CD1 other bump:1.69974 Ang V7.O and I10.CD1 other bump:2.61876 Ang V7.C and I10.CD1 other bump:2.73943 Ang V7.CG1 and I10.CG1 other bump:1.78766 Ang V7.O and I10.CG1 other bump:2.79889 Ang V7.C and I10.CG1 neighbor-bump: 2.64977 Ang E8.N and P9.CD neighbor-bump: 2.8311 Ang E8.CB and P9.CD Number of specific fragments= 1 total=2075 # 1e2tA.101.105 read from T0191.t2k.frag # found chain 1e2tA in template set T0191 101 :YPNIDVEPI 1e2tA 103 :PPRTHRLLL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2076 # 1lj5A.101.102 read from T0191.t2k.frag # adding 1lj5A to template set 1lj5A:# found chain 1lj5A in template set T0191 101 :YPNIDVEPI 1lj5A 103 :LKLVQGFMP Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.48716 Ang D6.OD1 and V7.CG2 neighbor-bump: 2.93789 Ang D6.C and V7.CG2 neighbor-bump: 2.54932 Ang D6.C and V7.CB neighbor-bump: 2.17674 Ang D6.O and V7.CB Number of specific fragments= 1 total=2077 # 1spgB.101.102 read from T0191.t2k.frag # found chain 1spgB in template set T0191 101 :YPNIDVEPI 1spgB 103 :FRLLGEIIT Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.71764 Ang I5.C and P9.CD other bump:1.50031 Ang I5.O and P9.CD other bump:2.2715 Ang I5.O and P9.CG other bump:2.40469 Ang Y2.C and D6.OD1 other bump:1.31244 Ang Y2.O and D6.OD1 other bump:2.47773 Ang Y2.O and D6.CG Number of specific fragments= 1 total=2078 # 1fr9A.102.103 read from T0191.t2k.frag # found chain 1fr9A in template set T0191 102 :PNIDVEPIV 1fr9A 104 :YIPPDLAAR Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.95461 Ang V6.CG1 and V10.CG2 neighbor-bump: 1.79259 Ang G1.C and P2.CD self-bump: 1.28985 Ang P2.N and P2.CD self-bump: 2.13023 Ang P2.N and P2.CG Number of specific fragments= 1 total=2079 # 1e5kA.102.103 read from T0191.t2k.frag # found chain 1e5kA in template set T0191 102 :PNIDVEPIV 1e5kA 104 :YIPPDLAAR Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.89894 Ang V6.CG1 and V10.CG2 neighbor-bump: 1.78052 Ang G1.C and P2.CD self-bump: 1.28704 Ang P2.N and P2.CD self-bump: 2.13898 Ang P2.N and P2.CG Number of specific fragments= 1 total=2080 # 1rfbA.102.103 read from T0191.t2k.frag # found chain 1rfbA in template set T0191 102 :PNIDVEPIV 1rfbA 104 :QIQRKAINE Fragment has 9 clashes (null) has 9 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.99136 Ang V6.CB and I9.CD1 other bump:2.06619 Ang V6.CG1 and I9.CD1 other bump:1.69974 Ang V6.O and I9.CD1 other bump:2.61876 Ang V6.C and I9.CD1 other bump:2.73943 Ang V6.CG1 and I9.CG1 other bump:1.78766 Ang V6.O and I9.CG1 other bump:2.79888 Ang V6.C and I9.CG1 neighbor-bump: 2.64977 Ang E7.N and P8.CD neighbor-bump: 2.8311 Ang E7.CB and P8.CD Number of specific fragments= 1 total=2081 # 1lj5A.102.103 read from T0191.t2k.frag # found chain 1lj5A in template set T0191 102 :PNIDVEPIV 1lj5A 104 :KLVQGFMPH Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.48716 Ang D5.OD1 and V6.CG2 neighbor-bump: 2.93789 Ang D5.C and V6.CG2 neighbor-bump: 2.54932 Ang D5.C and V6.CB neighbor-bump: 2.17674 Ang D5.O and V6.CB Number of specific fragments= 1 total=2082 # 1e2tA.102.106 read from T0191.t2k.frag # found chain 1e2tA in template set T0191 102 :PNIDVEPIV 1e2tA 104 :PRTHRLLLV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2083 # 1spgB.102.103 read from T0191.t2k.frag # found chain 1spgB in template set T0191 102 :PNIDVEPIV 1spgB 104 :RLLGEIITM Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.50031 Ang I4.O and P8.CD other bump:2.71764 Ang I4.C and P8.CD other bump:2.2715 Ang I4.O and P8.CG other bump:1.31244 Ang G1.O and D5.OD1 other bump:2.40469 Ang G1.C and D5.OD1 other bump:2.47773 Ang G1.O and D5.CG Number of specific fragments= 1 total=2084 # 1fr9A.103.104 read from T0191.t2k.frag # found chain 1fr9A in template set T0191 103 :NIDVEPIVK 1fr9A 105 :IPPDLAARL Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.95461 Ang V5.CG1 and V9.CG2 Number of specific fragments= 1 total=2085 # 1e5kA.103.104 read from T0191.t2k.frag # found chain 1e5kA in template set T0191 103 :NIDVEPIVK 1e5kA 105 :IPPDLAARL Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.89895 Ang V5.CG1 and V9.CG2 Number of specific fragments= 1 total=2086 # 1lj5A.103.104 read from T0191.t2k.frag # found chain 1lj5A in template set T0191 103 :NIDVEPIVK 1lj5A 105 :LVQGFMPHF Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.48716 Ang D4.OD1 and V5.CG2 neighbor-bump: 2.93789 Ang D4.C and V5.CG2 neighbor-bump: 2.54932 Ang D4.C and V5.CB neighbor-bump: 2.17674 Ang D4.O and V5.CB Number of specific fragments= 1 total=2087 # 1rfbA.103.104 read from T0191.t2k.frag # found chain 1rfbA in template set T0191 103 :NIDVEPIVK 1rfbA 105 :IQRKAINEL Fragment has 9 clashes (null) has 9 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.06619 Ang V5.CG1 and I8.CD1 other bump:2.99136 Ang V5.CB and I8.CD1 other bump:1.69974 Ang V5.O and I8.CD1 other bump:2.61876 Ang V5.C and I8.CD1 other bump:2.73943 Ang V5.CG1 and I8.CG1 other bump:1.78766 Ang V5.O and I8.CG1 other bump:2.79888 Ang V5.C and I8.CG1 neighbor-bump: 2.64977 Ang E6.N and P7.CD neighbor-bump: 2.8311 Ang E6.CB and P7.CD Number of specific fragments= 1 total=2088 # 1qqyA.103.104 read from T0191.t2k.frag # adding 1qqyA to template set 1qqyA:# found chain 1qqyA in template set T0191 103 :NIDVEPIVK 1qqyA 104 :GMSAWVAWV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2089 # 1e2tA.103.107 read from T0191.t2k.frag # found chain 1e2tA in template set T0191 103 :NIDVEPIVK 1e2tA 105 :RTHRLLLVD Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2090 # 1fr9A.104.105 read from T0191.t2k.frag # found chain 1fr9A in template set T0191 104 :IDVEPIVKA 1fr9A 106 :PPDLAARLN Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.95461 Ang V4.CG1 and V8.CG2 Number of specific fragments= 1 total=2091 # 1lj5A.104.105 read from T0191.t2k.frag # found chain 1lj5A in template set T0191 104 :IDVEPIVKA 1lj5A 106 :VQGFMPHFF Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.48717 Ang D3.OD1 and V4.CG2 neighbor-bump: 2.9379 Ang D3.C and V4.CG2 neighbor-bump: 2.54932 Ang D3.C and V4.CB neighbor-bump: 2.17675 Ang D3.O and V4.CB Number of specific fragments= 1 total=2092 # 1e5kA.104.105 read from T0191.t2k.frag # found chain 1e5kA in template set T0191 104 :IDVEPIVKA 1e5kA 106 :PPDLAARLN Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.89895 Ang V4.CG1 and V8.CG2 Number of specific fragments= 1 total=2093 # 1rfbA.104.105 read from T0191.t2k.frag # found chain 1rfbA in template set T0191 104 :IDVEPIVKA 1rfbA 106 :QRKAINELI Fragment has 9 clashes (null) has 9 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.99135 Ang V4.CB and I7.CD1 other bump:2.06618 Ang V4.CG1 and I7.CD1 other bump:1.69974 Ang V4.O and I7.CD1 other bump:2.61876 Ang V4.C and I7.CD1 other bump:2.73942 Ang V4.CG1 and I7.CG1 other bump:1.78766 Ang V4.O and I7.CG1 other bump:2.79888 Ang V4.C and I7.CG1 neighbor-bump: 2.64977 Ang E5.N and P6.CD neighbor-bump: 2.8311 Ang E5.CB and P6.CD Number of specific fragments= 1 total=2094 # 1qqyA.104.105 read from T0191.t2k.frag # found chain 1qqyA in template set T0191 104 :IDVEPIVKA 1qqyA 105 :MSAWVAWVK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2095 # 1b77A.104.104 read from T0191.t2k.frag # found chain 1b77A in template set T0191 104 :IDVEPIVKA 1b77A 105 :KPIQFPVAS Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues self-bump: 1.39976 Ang E5.CA and E5.CB Number of specific fragments= 1 total=2096 # 1fr9A.105.106 read from T0191.t2k.frag # found chain 1fr9A in template set T0191 105 :DVEPIVKAE 1fr9A 107 :PDLAARLNH Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.95461 Ang V3.CG1 and V7.CG2 Number of specific fragments= 1 total=2097 # 1lj5A.105.106 read from T0191.t2k.frag # found chain 1lj5A in template set T0191 105 :DVEPIVKAE 1lj5A 107 :QGFMPHFFR Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.48716 Ang D2.OD1 and V3.CG2 neighbor-bump: 2.93789 Ang D2.C and V3.CG2 neighbor-bump: 2.17675 Ang D2.O and V3.CB neighbor-bump: 2.54932 Ang D2.C and V3.CB Number of specific fragments= 1 total=2098 # 1e5kA.105.106 read from T0191.t2k.frag # found chain 1e5kA in template set T0191 105 :DVEPIVKAE 1e5kA 107 :PDLAARLNH Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.89895 Ang V3.CG1 and V7.CG2 Number of specific fragments= 1 total=2099 # 1rfbA.105.106 read from T0191.t2k.frag # found chain 1rfbA in template set T0191 105 :DVEPIVKAE 1rfbA 107 :RKAINELIK Fragment has 9 clashes (null) has 9 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.99136 Ang V3.CB and I6.CD1 other bump:2.06619 Ang V3.CG1 and I6.CD1 other bump:1.69974 Ang V3.O and I6.CD1 other bump:2.61876 Ang V3.C and I6.CD1 other bump:2.73943 Ang V3.CG1 and I6.CG1 other bump:1.78766 Ang V3.O and I6.CG1 other bump:2.79888 Ang V3.C and I6.CG1 neighbor-bump: 2.64977 Ang E4.N and P5.CD neighbor-bump: 2.83109 Ang E4.CB and P5.CD Number of specific fragments= 1 total=2100 # 1qqyA.105.106 read from T0191.t2k.frag # found chain 1qqyA in template set T0191 105 :DVEPIVKAE 1qqyA 106 :SAWVAWVKH Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2101 # 1a7cA.105.106 read from T0191.t2k.frag # adding 1a7cA to template set 1a7cA:# found chain 1a7cA in template set T0191 105 :DVEPIVKAE 1a7cA 107 :QGFMPHFFR Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.50204 Ang D2.OD1 and V3.CG2 neighbor-bump: 2.12441 Ang D2.O and V3.CB neighbor-bump: 2.4908 Ang D2.C and V3.CB Number of specific fragments= 1 total=2102 # 1lj5A.106.107 read from T0191.t2k.frag # found chain 1lj5A in template set T0191 106 :VEPIVKAEK 1lj5A 108 :GFMPHFFRL Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.9379 Ang G1.C and V2.CG2 neighbor-bump: 2.54932 Ang G1.C and V2.CB neighbor-bump: 2.17675 Ang G1.O and V2.CB Number of specific fragments= 1 total=2103 # 1fr9A.106.107 read from T0191.t2k.frag # found chain 1fr9A in template set T0191 106 :VEPIVKAEK 1fr9A 108 :DLAARLNHQ Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2104 # 1e5kA.106.107 read from T0191.t2k.frag # found chain 1e5kA in template set T0191 106 :VEPIVKAEK 1e5kA 108 :DLAARLNHQ Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2105 # 1rfbA.106.107 read from T0191.t2k.frag # found chain 1rfbA in template set T0191 106 :VEPIVKAEK 1rfbA 108 :KAINELIKV Fragment has 9 clashes (null) has 9 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.99136 Ang V2.CB and I5.CD1 other bump:2.0662 Ang V2.CG1 and I5.CD1 other bump:1.69974 Ang V2.O and I5.CD1 other bump:2.61876 Ang V2.C and I5.CD1 other bump:2.73943 Ang V2.CG1 and I5.CG1 other bump:1.78766 Ang V2.O and I5.CG1 other bump:2.79888 Ang V2.C and I5.CG1 neighbor-bump: 2.64977 Ang E3.N and P4.CD neighbor-bump: 2.83109 Ang E3.CB and P4.CD Number of specific fragments= 1 total=2106 # 1qqyA.106.107 read from T0191.t2k.frag # found chain 1qqyA in template set T0191 106 :VEPIVKAEK 1qqyA 107 :AWVAWVKHC Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2107 # 1a7cA.106.107 read from T0191.t2k.frag # found chain 1a7cA in template set T0191 106 :VEPIVKAEK 1a7cA 108 :GFMPHFFRL Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.12441 Ang G1.O and V2.CB neighbor-bump: 2.4908 Ang G1.C and V2.CB Number of specific fragments= 1 total=2108 # 1lj5A.107.108 read from T0191.t2k.frag # found chain 1lj5A in template set T0191 107 :EPIVKAEKL 1lj5A 109 :FMPHFFRLF Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2109 # 1fr9A.107.108 read from T0191.t2k.frag # found chain 1fr9A in template set T0191 107 :EPIVKAEKL 1fr9A 109 :LAARLNHQR Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.12231 Ang K6.O and L10.CD1 Number of specific fragments= 1 total=2110 # 1e5kA.107.108 read from T0191.t2k.frag # found chain 1e5kA in template set T0191 107 :EPIVKAEKL 1e5kA 109 :LAARLNHQR Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2111 # 1rfbA.107.108 read from T0191.t2k.frag # found chain 1rfbA in template set T0191 107 :EPIVKAEKL 1rfbA 109 :AINELIKVM Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues self-bump: 2.32178 Ang L10.N and L10.O other bump:1.69974 Ang G1.O and I4.CD1 other bump:2.61876 Ang G1.C and I4.CD1 other bump:1.78766 Ang G1.O and I4.CG1 other bump:2.79888 Ang G1.C and I4.CG1 neighbor-bump: 2.64977 Ang E2.N and P3.CD neighbor-bump: 2.8311 Ang E2.CB and P3.CD Number of specific fragments= 1 total=2112 # 2polA.107.107 read from T0191.t2k.frag # adding 2polA to template set 2polA:# found chain 2polA in template set T0191 107 :EPIVKAEKL 2polA 108 :LSTLPAADF Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.6342 Ang K6.CD and E8.OE2 other bump:2.65416 Ang K6.CB and E8.OE2 other bump:2.89876 Ang K6.CB and E8.CD Number of specific fragments= 1 total=2113 # 1qqyA.107.108 read from T0191.t2k.frag # found chain 1qqyA in template set T0191 107 :EPIVKAEKL 1qqyA 108 :WVAWVKHCK Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.45801 Ang V5.CG2 and K9.NZ Number of specific fragments= 1 total=2114 # 1lj5A.108.109 read from T0191.t2k.frag # found chain 1lj5A in template set T0191 108 :PIVKAEKLR 1lj5A 110 :MPHFFRLFR Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2115 # 1fr9A.108.109 read from T0191.t2k.frag # found chain 1fr9A in template set T0191 108 :PIVKAEKLR 1fr9A 110 :AARLNHQRK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2116 # 1rfbA.108.109 read from T0191.t2k.frag # found chain 1rfbA in template set T0191 108 :PIVKAEKLR 1rfbA 110 :INELIKVMN Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues self-bump: 2.13936 Ang L9.CB and L9.C self-bump: 2.32178 Ang L9.N and L9.O self-bump: 1.16477 Ang L9.CA and L9.CB Number of specific fragments= 1 total=2117 # 2polA.108.108 read from T0191.t2k.frag # found chain 2polA in template set T0191 108 :PIVKAEKLR 2polA 109 :STLPAADFP Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.6342 Ang K5.CD and E7.OE2 other bump:2.65416 Ang K5.CB and E7.OE2 other bump:2.89876 Ang K5.CB and E7.CD Number of specific fragments= 1 total=2118 # 1qqyA.108.109 read from T0191.t2k.frag # found chain 1qqyA in template set T0191 108 :PIVKAEKLR 1qqyA 109 :VAWVKHCKG Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.458 Ang V4.CG2 and K8.NZ Number of specific fragments= 1 total=2119 # 1cseE.108.108 read from T0191.t2k.frag # found chain 1cseE in template set T0191 108 :PIVKAEKLR 1cseE 110 :GIEWATTNG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2120 # 1lj5A.109.110 read from T0191.t2k.frag # found chain 1lj5A in template set T0191 109 :IVKAEKLRE 1lj5A 111 :PHFFRLFRS Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2121 # 1fr9A.109.110 read from T0191.t2k.frag # found chain 1fr9A in template set T0191 109 :IVKAEKLRE 1fr9A 111 :ARLNHQRKD Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2122 # 1e5kA.109.110 read from T0191.t2k.frag # found chain 1e5kA in template set T0191 109 :IVKAEKLRE 1e5kA 111 :ARLNHQRKD Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2123 # 1cseE.109.109 read from T0191.t2k.frag # found chain 1cseE in template set T0191 109 :IVKAEKLRE 1cseE 111 :IEWATTNGM Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.67414 Ang A5.CA and E10.OE2 other bump:2.08737 Ang A5.CA and E10.OE1 other bump:1.26959 Ang A5.O and E10.OE1 other bump:1.78749 Ang A5.C and E10.OE1 other bump:2.52008 Ang A5.CA and E10.CD other bump:2.50162 Ang A5.O and E10.CD other bump:2.86482 Ang A5.C and E10.CD Number of specific fragments= 1 total=2124 # 1qqyA.109.110 read from T0191.t2k.frag # found chain 1qqyA in template set T0191 109 :IVKAEKLRE 1qqyA 110 :AWVKHCKGK Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.98551 Ang E6.O and E10.OE2 other bump:2.458 Ang V3.CG2 and K7.NZ Number of specific fragments= 1 total=2125 # 1hy3A.109.111 read from T0191.t2k.frag # adding 1hy3A to template set 1hy3A:# found chain 1hy3A in template set T0191 109 :IVKAEKLRE 1hy3A 112 :LLPASFWEK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2126 # 1lj5A.110.111 read from T0191.t2k.frag # found chain 1lj5A in template set T0191 110 :VKAEKLRED 1lj5A 112 :HFFRLFRST Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2127 # 1fr9A.110.111 read from T0191.t2k.frag # found chain 1fr9A in template set T0191 110 :VKAEKLRED 1fr9A 112 :RLNHQRKDA Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.6263 Ang L7.CA and D10.OD1 other bump:1.49748 Ang L7.O and D10.OD1 other bump:2.30012 Ang L7.C and D10.OD1 other bump:2.53532 Ang L7.O and D10.CG Number of specific fragments= 1 total=2128 # 1e5kA.110.111 read from T0191.t2k.frag # found chain 1e5kA in template set T0191 110 :VKAEKLRED 1e5kA 112 :RLNHQRKDA Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.54479 Ang L7.O and D10.OD1 other bump:2.4486 Ang L7.C and D10.OD1 Number of specific fragments= 1 total=2129 # 1cseE.110.110 read from T0191.t2k.frag # found chain 1cseE in template set T0191 110 :VKAEKLRED 1cseE 112 :EWATTNGMD Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.205 Ang A4.CB and E9.OE1 other bump:3.05139 Ang A4.CB and E9.CD other bump:3.28443 Ang A4.CA and E9.CD Number of specific fragments= 1 total=2130 # 1qqyA.110.111 read from T0191.t2k.frag # found chain 1qqyA in template set T0191 110 :VKAEKLRED 1qqyA 111 :WVKHCKGKD Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.67467 Ang E5.O and E9.OE1 other bump:2.29798 Ang E5.O and E9.CD other bump:2.45801 Ang V2.CG2 and K6.NZ Number of specific fragments= 1 total=2131 # 1sup.110.110 read from T0191.t2k.frag # adding 1sup to template set 1sup:Skipped atom 21, because occupancy 0.28 <= existing 0.720001 Skipped atom 174, because occupancy 0.3 <= existing 0.700001 Skipped atom 421, because occupancy 0.32 <= existing 0.680001 Skipped atom 423, because occupancy 0.32 <= existing 0.680001 Skipped atom 425, because occupancy 0.32 <= existing 0.680001 Skipped atom 427, because occupancy 0.32 <= existing 0.680001 Skipped atom 458, because occupancy 0.15 <= existing 0.700001 Skipped atom 459, because occupancy 0.15 <= existing 0.700001 Skipped atom 466, because occupancy 0.2 <= existing 0.800001 Skipped atom 468, because occupancy 0.2 <= existing 0.800001 Skipped atom 470, because occupancy 0.2 <= existing 0.800001 Skipped atom 472, because occupancy 0.2 <= existing 0.800001 Skipped atom 474, because occupancy 0.2 <= existing 0.800001 Skipped atom 518, because occupancy 0.15 <= existing 0.850001 Skipped atom 520, because occupancy 0.15 <= existing 0.850001 Skipped atom 568, because occupancy 0.2 <= existing 0.800001 Skipped atom 675, because occupancy 0.32 <= existing 0.680001 Skipped atom 677, because occupancy 0.32 <= existing 0.680001 Skipped atom 679, because occupancy 0.32 <= existing 0.680001 Skipped atom 688, because occupancy 0.33 <= existing 0.670001 Skipped atom 690, because occupancy 0.33 <= existing 0.670001 Skipped atom 692, because occupancy 0.33 <= existing 0.670001 Skipped atom 694, because occupancy 0.33 <= existing 0.670001 Skipped atom 696, because occupancy 0.33 <= existing 0.670001 Skipped atom 698, because occupancy 0.33 <= existing 0.670001 Skipped atom 700, because occupancy 0.33 <= existing 0.670001 Skipped atom 702, because occupancy 0.33 <= existing 0.670001 Skipped atom 704, because occupancy 0.33 <= existing 0.670001 Skipped atom 706, because occupancy 0.33 <= existing 0.670001 Skipped atom 708, because occupancy 0.33 <= existing 0.670001 Skipped atom 710, because occupancy 0.33 <= existing 0.670001 Skipped atom 712, because occupancy 0.33 <= existing 0.670001 Skipped atom 714, because occupancy 0.33 <= existing 0.670001 Skipped atom 716, because occupancy 0.33 <= existing 0.670001 Skipped atom 718, because occupancy 0.33 <= existing 0.670001 Skipped atom 720, because occupancy 0.33 <= existing 0.670001 Skipped atom 722, because occupancy 0.33 <= existing 0.670001 Skipped atom 724, because occupancy 0.33 <= existing 0.670001 Skipped atom 726, because occupancy 0.33 <= existing 0.670001 Skipped atom 728, because occupancy 0.33 <= existing 0.670001 Skipped atom 730, because occupancy 0.33 <= existing 0.670001 Skipped atom 732, because occupancy 0.33 <= existing 0.670001 Skipped atom 734, because occupancy 0.33 <= existing 0.670001 Skipped atom 736, because occupancy 0.33 <= existing 0.670001 Skipped atom 1217, because occupancy 0.32 <= existing 0.680001 Skipped atom 1219, because occupancy 0.32 <= existing 0.680001 Skipped atom 1271, because occupancy 0.15 <= existing 0.850001 Skipped atom 1273, because occupancy 0.15 <= existing 0.850001 Skipped atom 1589, because occupancy 0.3 <= existing 0.700001 Skipped atom 1591, because occupancy 0.3 <= existing 0.700001 Skipped atom 1593, because occupancy 0.3 <= existing 0.700001 Skipped atom 1786, because occupancy 0.45 <= existing 0.550001 Skipped atom 1793, because occupancy 0.37 <= existing 0.450001 Skipped atom 1794, because occupancy 0.18 <= existing 0.450001 Skipped atom 1840, because occupancy 0.25 <= existing 0.750001 Skipped atom 1842, because occupancy 0.25 <= existing 0.750001 Skipped atom 1853, because occupancy 0.28 <= existing 0.720001 Skipped atom 1855, because occupancy 0.28 <= existing 0.720001 Skipped atom 1857, because occupancy 0.28 <= existing 0.720001 Skipped atom 1859, because occupancy 0.28 <= existing 0.720001 Skipped atom 1861, because occupancy 0.28 <= existing 0.720001 Skipped atom 1863, because occupancy 0.28 <= existing 0.720001 Skipped atom 1865, because occupancy 0.28 <= existing 0.720001 Skipped atom 1867, because occupancy 0.28 <= existing 0.720001 Skipped atom 1869, because occupancy 0.28 <= existing 0.720001 Skipped atom 1871, because occupancy 0.28 <= existing 0.720001 Skipped atom 1873, because occupancy 0.28 <= existing 0.720001 Skipped atom 1875, because occupancy 0.28 <= existing 0.720001 Skipped atom 1877, because occupancy 0.28 <= existing 0.720001 Skipped atom 1879, because occupancy 0.28 <= existing 0.720001 Skipped atom 1881, because occupancy 0.28 <= existing 0.720001 Skipped atom 1883, because occupancy 0.28 <= existing 0.720001 Skipped atom 1885, because occupancy 0.28 <= existing 0.720001 Skipped atom 1887, because occupancy 0.28 <= existing 0.720001 Skipped atom 1889, because occupancy 0.28 <= existing 0.720001 Skipped atom 1891, because occupancy 0.28 <= existing 0.720001 Skipped atom 1980, because occupancy 0.38 <= existing 0.450001 Skipped atom 1981, because occupancy 0.17 <= existing 0.450001 Skipped atom 1983, because occupancy 0.38 <= existing 0.450001 Skipped atom 1984, because occupancy 0.17 <= existing 0.450001 # found chain 1sup in template set T0191 110 :VKAEKLRED 1sup 111 :IEWAIANNM Fragment has 8 clashes (null) has 8 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.79232 Ang E5.CB and D10.OD2 other bump:2.7826 Ang E5.CG and D10.OD2 other bump:2.29738 Ang G1.O and E5.OE2 other bump:1.1512 Ang G1.O and E5.OE1 other bump:2.00341 Ang G1.C and E5.OE1 other bump:2.50004 Ang V2.CA and E5.OE1 other bump:1.87657 Ang G1.O and E5.CD other bump:2.79443 Ang G1.C and E5.CD Number of specific fragments= 1 total=2132 # 1fr9A.111.112 read from T0191.t2k.frag # found chain 1fr9A in template set T0191 111 :KAEKLREDM 1fr9A 113 :LNHQRKDAP Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2133 # 1lj5A.111.112 read from T0191.t2k.frag # found chain 1lj5A in template set T0191 111 :KAEKLREDM 1lj5A 113 :FFRLFRSTV Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.89572 Ang K2.CE and M10.SD other bump:2.62784 Ang K2.NZ and M10.SD other bump:2.32001 Ang K2.CD and M10.SD Number of specific fragments= 1 total=2134 # 1sup.111.111 read from T0191.t2k.frag # found chain 1sup in template set T0191 111 :KAEKLREDM 1sup 112 :EWAIANNMD Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.79232 Ang E4.CB and D9.OD2 other bump:2.7826 Ang E4.CG and D9.OD2 Number of specific fragments= 1 total=2135 # 1dqnA.111.112 read from T0191.t2k.frag # adding 1dqnA to template set 1dqnA:# found chain 1dqnA in template set T0191 111 :KAEKLREDM 1dqnA 113 :KQLKEKREV Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.85746 Ang R7.O and M10.CE other bump:2.82552 Ang R7.C and M10.CE other bump:2.45686 Ang E4.O and M10.CE other bump:1.80305 Ang E4.O and M10.SD other bump:3.0313 Ang R7.CB and M10.CG self-bump: 1.37221 Ang E8.CA and E8.CB Number of specific fragments= 1 total=2136 # 1e5kA.111.112 read from T0191.t2k.frag # found chain 1e5kA in template set T0191 111 :KAEKLREDM 1e5kA 113 :LNHQRKDAP Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2137 # 1dqpA.111.112 read from T0191.t2k.frag # adding 1dqpA to template set 1dqpA:# found chain 1dqpA in template set T0191 111 :KAEKLREDM 1dqpA 113 :KQLKEKREV Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.87303 Ang R7.O and M10.CE other bump:2.85731 Ang R7.C and M10.CE other bump:2.46442 Ang E4.O and M10.CE other bump:1.86843 Ang E4.O and M10.SD other bump:3.0738 Ang R7.CB and M10.CG self-bump: 1.39578 Ang E8.CA and E8.CB Number of specific fragments= 1 total=2138 # 1dqnA.112.113 read from T0191.t2k.frag # found chain 1dqnA in template set T0191 112 :AEKLREDMV 1dqnA 114 :QLKEKREVV Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.16648 Ang E3.CA and M9.CE other bump:2.06238 Ang E3.O and M9.CE other bump:2.25888 Ang E3.C and M9.CE other bump:2.23761 Ang E3.CB and M9.CE other bump:1.89422 Ang E3.O and M9.SD self-bump: 1.37221 Ang E7.CA and E7.CB Number of specific fragments= 1 total=2139 # 1dqpA.112.113 read from T0191.t2k.frag # found chain 1dqpA in template set T0191 112 :AEKLREDMV 1dqpA 114 :QLKEKREVV Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.19418 Ang E3.CA and M9.CE other bump:2.12351 Ang E3.O and M9.CE other bump:2.34952 Ang E3.C and M9.CE other bump:2.27004 Ang E3.CB and M9.CE other bump:1.93116 Ang E3.O and M9.SD self-bump: 1.39578 Ang E7.CA and E7.CB Number of specific fragments= 1 total=2140 # 1sup.112.112 read from T0191.t2k.frag # found chain 1sup in template set T0191 112 :AEKLREDMV 1sup 113 :WAIANNMDV Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.79232 Ang E3.CB and D8.OD2 other bump:2.7826 Ang E3.CG and D8.OD2 Number of specific fragments= 1 total=2141 # 1fr9A.112.113 read from T0191.t2k.frag # found chain 1fr9A in template set T0191 112 :AEKLREDMV 1fr9A 114 :NHQRKDAPV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2142 # 1hy3A.112.114 read from T0191.t2k.frag # found chain 1hy3A in template set T0191 112 :AEKLREDMV 1hy3A 115 :ASFWEKDCK Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.8296 Ang K4.CG and M9.CE other bump:2.26383 Ang K4.CA and M9.CE Number of specific fragments= 1 total=2143 # 1e5kA.112.113 read from T0191.t2k.frag # found chain 1e5kA in template set T0191 112 :AEKLREDMV 1e5kA 114 :NHQRKDAPV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2144 # 1dqnA.113.114 read from T0191.t2k.frag # found chain 1dqnA in template set T0191 113 :EKLREDMVV 1dqnA 115 :LKEKREVVL Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.16648 Ang E2.CA and M8.CE other bump:2.06238 Ang E2.O and M8.CE other bump:2.25888 Ang E2.C and M8.CE other bump:2.23761 Ang E2.CB and M8.CE other bump:1.89422 Ang E2.O and M8.SD self-bump: 1.37221 Ang E6.CA and E6.CB Number of specific fragments= 1 total=2145 # 1dqpA.113.114 read from T0191.t2k.frag # found chain 1dqpA in template set T0191 113 :EKLREDMVV 1dqpA 115 :LKEKREVVL Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.19418 Ang E2.CA and M8.CE other bump:2.12351 Ang E2.O and M8.CE other bump:2.34952 Ang E2.C and M8.CE other bump:2.27004 Ang E2.CB and M8.CE other bump:1.93116 Ang E2.O and M8.SD self-bump: 1.39578 Ang E6.CA and E6.CB Number of specific fragments= 1 total=2146 # 1sup.113.113 read from T0191.t2k.frag # found chain 1sup in template set T0191 113 :EKLREDMVV 1sup 114 :AIANNMDVI Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.79232 Ang E2.CB and D7.OD2 other bump:2.7826 Ang E2.CG and D7.OD2 Number of specific fragments= 1 total=2147 # 1fr9A.113.114 read from T0191.t2k.frag # found chain 1fr9A in template set T0191 113 :EKLREDMVV 1fr9A 115 :HQRKDAPVV Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.35708 Ang L4.CD2 and V10.CG2 Number of specific fragments= 1 total=2148 # 1hy3A.113.115 read from T0191.t2k.frag # found chain 1hy3A in template set T0191 113 :EKLREDMVV 1hy3A 116 :SFWEKDCKI Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.8296 Ang K3.CG and M8.CE other bump:2.26383 Ang K3.CA and M8.CE other bump:2.28005 Ang E2.OE2 and E6.CD Number of specific fragments= 1 total=2149 # 1e5kA.113.114 read from T0191.t2k.frag # found chain 1e5kA in template set T0191 113 :EKLREDMVV 1e5kA 115 :HQRKDAPVV Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.35243 Ang L4.CD2 and V10.CG2 Number of specific fragments= 1 total=2150 # 1dqnA.114.115 read from T0191.t2k.frag # found chain 1dqnA in template set T0191 114 :KLREDMVVM 1dqnA 116 :KEKREVVLI Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.06238 Ang G1.O and M7.CE other bump:2.25888 Ang G1.C and M7.CE other bump:1.89422 Ang G1.O and M7.SD self-bump: 1.37221 Ang E5.CA and E5.CB Number of specific fragments= 1 total=2151 # 1dqpA.114.115 read from T0191.t2k.frag # found chain 1dqpA in template set T0191 114 :KLREDMVVM 1dqpA 116 :KEKREVVLI Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.12351 Ang G1.O and M7.CE other bump:2.34952 Ang G1.C and M7.CE other bump:1.93116 Ang G1.O and M7.SD self-bump: 1.39578 Ang E5.CA and E5.CB Number of specific fragments= 1 total=2152 # 1sup.114.114 read from T0191.t2k.frag # found chain 1sup in template set T0191 114 :KLREDMVVM 1sup 115 :IANNMDVIN Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2153 # 1fr9A.114.115 read from T0191.t2k.frag # found chain 1fr9A in template set T0191 114 :KLREDMVVM 1fr9A 116 :QRKDAPVVW Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.35708 Ang L3.CD2 and V9.CG2 Number of specific fragments= 1 total=2154 # 1hy3A.114.116 read from T0191.t2k.frag # found chain 1hy3A in template set T0191 114 :KLREDMVVM 1hy3A 117 :FWEKDCKII Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.8296 Ang K2.CG and M7.CE other bump:2.26383 Ang K2.CA and M7.CE Number of specific fragments= 1 total=2155 # 1e5kA.114.115 read from T0191.t2k.frag # found chain 1e5kA in template set T0191 114 :KLREDMVVM 1e5kA 116 :QRKDAPVVW Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.35244 Ang L3.CD2 and V9.CG2 Number of specific fragments= 1 total=2156 # 1dqnA.115.116 read from T0191.t2k.frag # found chain 1dqnA in template set T0191 115 :LREDMVVMD 1dqnA 117 :EKREVVLID Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues self-bump: 1.37221 Ang E4.CA and E4.CB Number of specific fragments= 1 total=2157 # 1dqpA.115.116 read from T0191.t2k.frag # found chain 1dqpA in template set T0191 115 :LREDMVVMD 1dqpA 117 :EKREVVLID Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues self-bump: 1.39578 Ang E4.CA and E4.CB Number of specific fragments= 1 total=2158 # 1sup.115.115 read from T0191.t2k.frag # found chain 1sup in template set T0191 115 :LREDMVVMD 1sup 116 :ANNMDVINM Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2159 # 1fr9A.115.116 read from T0191.t2k.frag # found chain 1fr9A in template set T0191 115 :LREDMVVMD 1fr9A 117 :RKDAPVVWV Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.90802 Ang L2.CD2 and V8.CG2 other bump:2.65293 Ang L2.CD2 and V8.CG1 other bump:2.74574 Ang L2.CD2 and V8.CB Number of specific fragments= 1 total=2160 # 1gqeA.115.122 read from T0191.t2k.frag # adding 1gqeA to template set 1gqeA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # found chain 1gqeA in template set T0191 115 :LREDMVVMD 1gqeA 123 :YDSADCYLD Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.68529 Ang V7.CG2 and V8.N other bump:2.86931 Ang L2.CG and D5.OD2 other bump:2.3803 Ang L2.CD1 and D5.OD2 Number of specific fragments= 1 total=2161 # 1hy3A.115.117 read from T0191.t2k.frag # found chain 1hy3A in template set T0191 115 :LREDMVVMD 1hy3A 118 :WEKDCKIIY Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2162 # 1dqnA.116.117 read from T0191.t2k.frag # found chain 1dqnA in template set T0191 116 :REDMVVMDL 1dqnA 118 :KREVVLIDE Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:3.13972 Ang R2.CB and M5.CG self-bump: 1.37221 Ang E3.CA and E3.CB Number of specific fragments= 1 total=2163 # 1dqpA.116.117 read from T0191.t2k.frag # found chain 1dqpA in template set T0191 116 :REDMVVMDL 1dqpA 118 :KREVVLIDE Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues self-bump: 1.39578 Ang E3.CA and E3.CB Number of specific fragments= 1 total=2164 # 1gqeA.116.123 read from T0191.t2k.frag # found chain 1gqeA in template set T0191 116 :REDMVVMDL 1gqeA 124 :DSADCYLDI Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.68529 Ang V6.CG2 and V7.N Number of specific fragments= 1 total=2165 # 1fyhB.116.119 read from T0191.t2k.frag # adding 1fyhB to template set 1fyhB:# found chain 1fyhB in template set T0191 116 :REDMVVMDL 1fyhB 120 :EEKQIMIDI Fragment has 9 clashes (null) has 9 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.90305 Ang M8.CG and L10.CD2 other bump:3.03371 Ang M8.SD and L10.CD2 other bump:2.77522 Ang M8.CE and L10.CD2 other bump:2.78054 Ang M8.CE and L10.CD1 other bump:2.43052 Ang R2.NE and V7.CG2 other bump:2.91656 Ang R2.CZ and V7.CG2 other bump:2.78868 Ang R2.NH2 and V7.CG2 other bump:3.13822 Ang R2.CD and M5.SD other bump:2.64792 Ang R2.CD and M5.CG Number of specific fragments= 1 total=2166 # 1sup.116.116 read from T0191.t2k.frag # found chain 1sup in template set T0191 116 :REDMVVMDL 1sup 117 :NNMDVINMS Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.43703 Ang M8.CG and L10.CD1 other bump:2.8857 Ang M8.SD and L10.CD1 Number of specific fragments= 1 total=2167 # 1hy3A.116.118 read from T0191.t2k.frag # found chain 1hy3A in template set T0191 116 :REDMVVMDL 1hy3A 119 :EKDCKIIYL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2168 # 1dqnA.117.118 read from T0191.t2k.frag # found chain 1dqnA in template set T0191 117 :EDMVVMDLI 1dqnA 119 :REVVLIDEY Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2169 # 1dqpA.117.118 read from T0191.t2k.frag # found chain 1dqpA in template set T0191 117 :EDMVVMDLI 1dqpA 119 :REVVLIDEY Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2170 # 1fyhB.117.120 read from T0191.t2k.frag # found chain 1fyhB in template set T0191 117 :EDMVVMDLI 1fyhB 121 :EKQIMIDIF Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.90306 Ang M7.CG and L9.CD2 other bump:3.03371 Ang M7.SD and L9.CD2 other bump:2.77521 Ang M7.CE and L9.CD2 other bump:2.78055 Ang M7.CE and L9.CD1 Number of specific fragments= 1 total=2171 # 1gqeA.117.124 read from T0191.t2k.frag # found chain 1gqeA in template set T0191 117 :EDMVVMDLI 1gqeA 125 :SADCYLDIQ Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.68529 Ang V5.CG2 and V6.N Number of specific fragments= 1 total=2172 # 1sup.117.117 read from T0191.t2k.frag # found chain 1sup in template set T0191 117 :EDMVVMDLI 1sup 118 :NMDVINMSL Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.43702 Ang M7.CG and L9.CD1 other bump:2.8857 Ang M7.SD and L9.CD1 Number of specific fragments= 1 total=2173 # 1hy3A.117.119 read from T0191.t2k.frag # found chain 1hy3A in template set T0191 117 :EDMVVMDLI 1hy3A 120 :KDCKIIYLC Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2174 # 1dqnA.118.119 read from T0191.t2k.frag # found chain 1dqnA in template set T0191 118 :DMVVMDLIY 1dqnA 120 :EVVLIDEYV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2175 # 1dqpA.118.119 read from T0191.t2k.frag # found chain 1dqpA in template set T0191 118 :DMVVMDLIY 1dqpA 120 :EVVLIDEYV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2176 # 1fyhB.118.121 read from T0191.t2k.frag # found chain 1fyhB in template set T0191 118 :DMVVMDLIY 1fyhB 122 :KQIMIDIFH Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.77521 Ang M6.CE and L8.CD2 other bump:2.90306 Ang M6.CG and L8.CD2 other bump:3.03371 Ang M6.SD and L8.CD2 other bump:2.78055 Ang M6.CE and L8.CD1 Number of specific fragments= 1 total=2177 # 1gqeA.118.125 read from T0191.t2k.frag # found chain 1gqeA in template set T0191 118 :DMVVMDLIY 1gqeA 126 :ADCYLDIQA Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.6853 Ang V4.CG2 and V5.N Number of specific fragments= 1 total=2178 # 1sup.118.118 read from T0191.t2k.frag # found chain 1sup in template set T0191 118 :DMVVMDLIY 1sup 119 :MDVINMSLG Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.43702 Ang M6.CG and L8.CD1 other bump:2.8857 Ang M6.SD and L8.CD1 Number of specific fragments= 1 total=2179 # 1juhA.118.119 read from T0191.t2k.frag # adding 1juhA to template set 1juhA:Skipped atom 39, because occupancy 0.5 <= existing 0.500001 Skipped atom 41, because occupancy 0.5 <= existing 0.500001 Skipped atom 43, because occupancy 0.5 <= existing 0.500001 Skipped atom 45, because occupancy 0.5 <= existing 0.500001 Skipped atom 47, because occupancy 0.5 <= existing 0.500001 Skipped atom 566, because occupancy 0.5 <= existing 0.500001 Skipped atom 568, because occupancy 0.5 <= existing 0.500001 Skipped atom 570, because occupancy 0.5 <= existing 0.500001 Skipped atom 572, because occupancy 0.5 <= existing 0.500001 Skipped atom 574, because occupancy 0.5 <= existing 0.500001 Skipped atom 617, because occupancy 0.5 <= existing 0.500001 Skipped atom 619, because occupancy 0.5 <= existing 0.500001 Skipped atom 621, because occupancy 0.5 <= existing 0.500001 Skipped atom 623, because occupancy 0.5 <= existing 0.500001 Skipped atom 642, because occupancy 0.5 <= existing 0.500001 Skipped atom 644, because occupancy 0.5 <= existing 0.500001 Skipped atom 797, because occupancy 0.5 <= existing 0.500001 Skipped atom 799, because occupancy 0.5 <= existing 0.500001 Skipped atom 1583, because occupancy 0.5 <= existing 0.500001 Skipped atom 1585, because occupancy 0.5 <= existing 0.500001 Skipped atom 1587, because occupancy 0.5 <= existing 0.500001 Skipped atom 1589, because occupancy 0.5 <= existing 0.500001 Skipped atom 1674, because occupancy 0.5 <= existing 0.500001 Skipped atom 1676, because occupancy 0.5 <= existing 0.500001 Skipped atom 2107, because occupancy 0.5 <= existing 0.500001 Skipped atom 2109, because occupancy 0.5 <= existing 0.500001 Skipped atom 2111, because occupancy 0.5 <= existing 0.500001 Skipped atom 2196, because occupancy 0.5 <= existing 0.500001 Skipped atom 2198, because occupancy 0.5 <= existing 0.500001 Skipped atom 2472, because occupancy 0.5 <= existing 0.500001 Skipped atom 2474, because occupancy 0.5 <= existing 0.500001 Skipped atom 2476, because occupancy 0.5 <= existing 0.500001 Skipped atom 2478, because occupancy 0.5 <= existing 0.500001 Skipped atom 2547, because occupancy 0.5 <= existing 0.500001 Skipped atom 2549, because occupancy 0.5 <= existing 0.500001 # found chain 1juhA in template set T0191 118 :DMVVMDLIY 1juhA 120 :DTEMTGVIV Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.8491 Ang L8.CD1 and Y10.OH other bump:2.61901 Ang L8.CD2 and Y10.OH other bump:2.20238 Ang L8.CD2 and Y10.CZ other bump:1.36299 Ang L8.CD2 and Y10.CE2 other bump:2.81326 Ang L8.CG and Y10.CE2 other bump:2.39473 Ang L8.CD2 and Y10.CD2 Number of specific fragments= 1 total=2180 # 1dqnA.119.120 read from T0191.t2k.frag # found chain 1dqnA in template set T0191 119 :MVVMDLIYN 1dqnA 121 :VVLIDEYVD Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues self-bump: 1.39359 Ang N10.CA and N10.CB Number of specific fragments= 1 total=2181 # 1dqpA.119.120 read from T0191.t2k.frag # found chain 1dqpA in template set T0191 119 :MVVMDLIYN 1dqpA 121 :VVLIDEYVD Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2182 # 1fyhB.119.122 read from T0191.t2k.frag # found chain 1fyhB in template set T0191 119 :MVVMDLIYN 1fyhB 123 :QIMIDIFHP Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.90306 Ang M5.CG and L7.CD2 other bump:3.03371 Ang M5.SD and L7.CD2 other bump:2.77521 Ang M5.CE and L7.CD2 other bump:2.78055 Ang M5.CE and L7.CD1 Number of specific fragments= 1 total=2183 # 1gqeA.119.126 read from T0191.t2k.frag # found chain 1gqeA in template set T0191 119 :MVVMDLIYN 1gqeA 127 :DCYLDIQAG Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.66394 Ang Y9.CE2 and N10.O neighbor-bump: 2.63671 Ang Y9.CD2 and N10.O neighbor-bump: 2.96908 Ang Y9.CD1 and N10.OD1 neighbor-bump: 2.47934 Ang Y9.CE1 and N10.OD1 neighbor-bump: 2.68529 Ang V3.CG2 and V4.N Number of specific fragments= 1 total=2184 # 1sup.119.119 read from T0191.t2k.frag # found chain 1sup in template set T0191 119 :MVVMDLIYN 1sup 120 :DVINMSLGG Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.43702 Ang M5.CG and L7.CD1 other bump:2.8857 Ang M5.SD and L7.CD1 Number of specific fragments= 1 total=2185 # 1juhA.119.120 read from T0191.t2k.frag # found chain 1juhA in template set T0191 119 :MVVMDLIYN 1juhA 121 :TEMTGVIVP Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2186 # 1dqnA.120.121 read from T0191.t2k.frag # found chain 1dqnA in template set T0191 120 :VVMDLIYNP 1dqnA 122 :VLIDEYVDS Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.39335 Ang N9.CB and P10.CD neighbor-bump: 2.333 Ang N9.OD1 and P10.CD neighbor-bump: 2.6341 Ang N9.OD1 and P10.CG self-bump: 1.38998 Ang N9.CA and N9.CB Number of specific fragments= 1 total=2187 # 1dqpA.120.121 read from T0191.t2k.frag # found chain 1dqpA in template set T0191 120 :VVMDLIYNP 1dqpA 122 :VLIDEYVDS Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.44866 Ang N9.CB and P10.CD neighbor-bump: 2.57144 Ang N9.OD1 and P10.CD Number of specific fragments= 1 total=2188 # 1fyhB.120.123 read from T0191.t2k.frag # found chain 1fyhB in template set T0191 120 :VVMDLIYNP 1fyhB 124 :IMIDIFHPS Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.77521 Ang M4.CE and L6.CD2 other bump:2.90306 Ang M4.CG and L6.CD2 other bump:3.03371 Ang M4.SD and L6.CD2 other bump:2.78055 Ang M4.CE and L6.CD1 Number of specific fragments= 1 total=2189 # 1gqeA.120.127 read from T0191.t2k.frag # found chain 1gqeA in template set T0191 120 :VVMDLIYNP 1gqeA 128 :CYLDIQAGS Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.42651 Ang Y8.OH and G11.CA other bump:3.19406 Ang Y8.CZ and G11.N neighbor-bump: 2.63671 Ang Y8.CD2 and N9.O neighbor-bump: 2.66394 Ang Y8.CE2 and N9.O neighbor-bump: 2.47935 Ang Y8.CE1 and N9.OD1 neighbor-bump: 2.96908 Ang Y8.CD1 and N9.OD1 neighbor-bump: 2.68529 Ang V2.CG2 and V3.N Number of specific fragments= 1 total=2190 # 1sup.120.120 read from T0191.t2k.frag # found chain 1sup in template set T0191 120 :VVMDLIYNP 1sup 121 :VINMSLGGP Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.32399 Ang N9.OD1 and P10.CD other bump:2.43702 Ang M4.CG and L6.CD1 other bump:2.8857 Ang M4.SD and L6.CD1 Number of specific fragments= 1 total=2191 # 1juhA.120.121 read from T0191.t2k.frag # found chain 1juhA in template set T0191 120 :VVMDLIYNP 1juhA 122 :EMTGVIVPG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2192 # 1dqnA.121.122 read from T0191.t2k.frag # found chain 1dqnA in template set T0191 121 :VMDLIYNPL 1dqnA 123 :LIDEYVDSG Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.39336 Ang N8.CB and P9.CD neighbor-bump: 2.33301 Ang N8.OD1 and P9.CD neighbor-bump: 2.63411 Ang N8.OD1 and P9.CG self-bump: 1.38998 Ang N8.CA and N8.CB Number of specific fragments= 1 total=2193 # 1dqpA.121.122 read from T0191.t2k.frag # found chain 1dqpA in template set T0191 121 :VMDLIYNPL 1dqpA 123 :LIDEYVDSG Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.44866 Ang N8.CB and P9.CD neighbor-bump: 2.57144 Ang N8.OD1 and P9.CD Number of specific fragments= 1 total=2194 # 1gqeA.121.128 read from T0191.t2k.frag # found chain 1gqeA in template set T0191 121 :VMDLIYNPL 1gqeA 129 :YLDIQAGSG Fragment has 25 clashes (null) has 25 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.82509 Ang Y7.OH and G11.CA other bump:2.07642 Ang Y7.OH and G11.N other bump:3.12709 Ang Y7.CE2 and G11.N other bump:2.97695 Ang Y7.CZ and G11.N other bump:1.75485 Ang Y7.OH and L10.C other bump:3.02931 Ang Y7.CZ and L10.C other bump:2.16051 Ang Y7.OH and L10.O other bump:2.51471 Ang N8.CG and L10.CD1 other bump:1.68375 Ang N8.ND2 and L10.CD1 other bump:2.93747 Ang N8.CG and L10.CG other bump:2.75606 Ang N8.ND2 and L10.CG other bump:2.53799 Ang N8.OD1 and L10.CB other bump:2.71768 Ang Y7.OH and L10.CB other bump:2.42651 Ang Y7.OH and L10.CA other bump:3.19406 Ang Y7.CZ and L10.N neighbor-bump: 2.30357 Ang N8.CA and P9.CD neighbor-bump: 2.77123 Ang N8.CB and P9.CD neighbor-bump: 1.99175 Ang N8.C and P9.CD self-bump: 1.34688 Ang P9.N and P9.CD self-bump: 2.05273 Ang P9.N and P9.CG self-bump: 2.15408 Ang P9.N and P9.CB neighbor-bump: 2.63671 Ang Y7.CD2 and N8.O neighbor-bump: 2.66394 Ang Y7.CE2 and N8.O neighbor-bump: 2.96908 Ang Y7.CD1 and N8.OD1 neighbor-bump: 2.47935 Ang Y7.CE1 and N8.OD1 Number of specific fragments= 1 total=2195 # 1fyhB.121.124 read from T0191.t2k.frag # found chain 1fyhB in template set T0191 121 :VMDLIYNPL 1fyhB 125 :MIDIFHPSV Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues self-bump: 1.3982 Ang P9.N and P9.CD other bump:2.90306 Ang M3.CG and L5.CD2 other bump:3.03372 Ang M3.SD and L5.CD2 other bump:2.77524 Ang M3.CE and L5.CD2 other bump:2.78056 Ang M3.CE and L5.CD1 Number of specific fragments= 1 total=2196 # 1sup.121.121 read from T0191.t2k.frag # found chain 1sup in template set T0191 121 :VMDLIYNPL 1sup 122 :INMSLGGPS Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.32399 Ang N8.OD1 and P9.CD other bump:2.43702 Ang M3.CG and L5.CD1 other bump:2.8857 Ang M3.SD and L5.CD1 Number of specific fragments= 1 total=2197 # 1juhA.121.122 read from T0191.t2k.frag # found chain 1juhA in template set T0191 121 :VMDLIYNPL 1juhA 123 :MTGVIVPGG Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.84196 Ang N8.CB and P9.CD Number of specific fragments= 1 total=2198 # 1dqnA.122.123 read from T0191.t2k.frag # found chain 1dqnA in template set T0191 122 :MDLIYNPLE 1dqnA 124 :IDEYVDSGH Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.39336 Ang N7.CB and P8.CD neighbor-bump: 2.33301 Ang N7.OD1 and P8.CD neighbor-bump: 2.63411 Ang N7.OD1 and P8.CG self-bump: 1.38998 Ang N7.CA and N7.CB Number of specific fragments= 1 total=2199 # 1dqpA.122.123 read from T0191.t2k.frag # found chain 1dqpA in template set T0191 122 :MDLIYNPLE 1dqpA 124 :IDEYVDSGH Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.93776 Ang P8.CB and E10.OE1 other bump:2.97362 Ang P8.CB and E10.CD neighbor-bump: 2.44866 Ang N7.CB and P8.CD neighbor-bump: 2.57144 Ang N7.OD1 and P8.CD Number of specific fragments= 1 total=2200 # 1gqeA.122.129 read from T0191.t2k.frag # found chain 1gqeA in template set T0191 122 :MDLIYNPLE 1gqeA 130 :LDIQAGSGG Fragment has 25 clashes (null) has 25 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.66789 Ang Y6.CE2 and E10.O other bump:2.41852 Ang Y6.CZ and E10.O self-bump: 1.29761 Ang E10.CA and E10.CB other bump:2.82509 Ang Y6.OH and E10.CA other bump:3.12709 Ang Y6.CE2 and E10.N other bump:2.97695 Ang Y6.CZ and E10.N other bump:2.07642 Ang Y6.OH and E10.N other bump:3.02931 Ang Y6.CZ and L9.C other bump:1.75485 Ang Y6.OH and L9.C other bump:2.16051 Ang Y6.OH and L9.O other bump:2.43567 Ang N7.ND2 and L9.CD1 other bump:2.99111 Ang N7.CG and L9.CG other bump:2.69052 Ang Y6.OH and L9.CB other bump:2.42651 Ang Y6.OH and L9.CA other bump:3.19406 Ang Y6.CZ and L9.N neighbor-bump: 2.77123 Ang N7.CB and P8.CD neighbor-bump: 2.30357 Ang N7.CA and P8.CD self-bump: 1.34688 Ang P8.N and P8.CD neighbor-bump: 1.99175 Ang N7.C and P8.CD self-bump: 2.05273 Ang P8.N and P8.CG self-bump: 2.15408 Ang P8.N and P8.CB neighbor-bump: 2.63671 Ang Y6.CD2 and N7.O neighbor-bump: 2.66394 Ang Y6.CE2 and N7.O neighbor-bump: 2.96908 Ang Y6.CD1 and N7.OD1 neighbor-bump: 2.47935 Ang Y6.CE1 and N7.OD1 Number of specific fragments= 1 total=2201 # 1fyhB.122.125 read from T0191.t2k.frag # found chain 1fyhB in template set T0191 122 :MDLIYNPLE 1fyhB 126 :IDIFHPSVF Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues self-bump: 1.3982 Ang P8.N and P8.CD other bump:2.90306 Ang M2.CG and L4.CD2 other bump:3.03373 Ang M2.SD and L4.CD2 other bump:2.77524 Ang M2.CE and L4.CD2 other bump:2.78057 Ang M2.CE and L4.CD1 Number of specific fragments= 1 total=2202 # 1juhA.122.123 read from T0191.t2k.frag # found chain 1juhA in template set T0191 122 :MDLIYNPLE 1juhA 124 :TGVIVPGGF Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.85778 Ang I5.CG2 and E10.OE1 neighbor-bump: 2.38545 Ang P8.O and L9.CG neighbor-bump: 2.80282 Ang P8.C and L9.CG neighbor-bump: 1.96681 Ang P8.O and L9.CB neighbor-bump: 2.42825 Ang P8.C and L9.CB neighbor-bump: 2.84196 Ang N7.CB and P8.CD Number of specific fragments= 1 total=2203 # 1qipA.122.125 read from T0191.t2k.frag # adding 1qipA to template set 1qipA:# found chain 1qipA in template set T0191 122 :MDLIYNPLE 1qipA 126 :HIGIAVPDV Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.63612 Ang N7.OD1 and P8.CD other bump:2.50858 Ang M2.CE and L4.CD2 other bump:2.88684 Ang M2.CE and L4.CG Number of specific fragments= 1 total=2204 # 1dqnA.123.124 read from T0191.t2k.frag # found chain 1dqnA in template set T0191 123 :DLIYNPLET 1dqnA 125 :DEYVDSGHT Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.77942 Ang P7.CB and E9.OE2 other bump:1.95555 Ang P7.CB and E9.OE1 other bump:2.69703 Ang P7.CB and E9.CD neighbor-bump: 2.39336 Ang N6.CB and P7.CD neighbor-bump: 2.33301 Ang N6.OD1 and P7.CD neighbor-bump: 2.63411 Ang N6.OD1 and P7.CG self-bump: 1.38998 Ang N6.CA and N6.CB Number of specific fragments= 1 total=2205 # 1dqpA.123.124 read from T0191.t2k.frag # found chain 1dqpA in template set T0191 123 :DLIYNPLET 1dqpA 125 :DEYVDSGHT Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.44866 Ang N6.CB and P7.CD neighbor-bump: 2.57144 Ang N6.OD1 and P7.CD Number of specific fragments= 1 total=2206 # 1gqeA.123.130 read from T0191.t2k.frag # found chain 1gqeA in template set T0191 123 :DLIYNPLET 1gqeA 131 :DIQAGSGGT Fragment has 30 clashes (null) has 30 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 3.23451 Ang E9.CG and T10.CA neighbor-bump: 2.45583 Ang E9.CB and T10.N neighbor-bump: 2.17117 Ang E9.CG and T10.N self-bump: 2.19158 Ang E9.CB and E9.C self-bump: 2.47184 Ang E9.CG and E9.C other bump:2.66789 Ang Y5.CE2 and E9.O other bump:2.41852 Ang Y5.CZ and E9.O self-bump: 1.31706 Ang E9.CA and E9.CB other bump:2.82509 Ang Y5.OH and E9.CA other bump:2.07642 Ang Y5.OH and E9.N other bump:3.12709 Ang Y5.CE2 and E9.N other bump:2.97695 Ang Y5.CZ and E9.N other bump:1.75485 Ang Y5.OH and L8.C other bump:3.02931 Ang Y5.CZ and L8.C other bump:2.16051 Ang Y5.OH and L8.O other bump:2.43567 Ang N6.ND2 and L8.CD1 other bump:2.99111 Ang N6.CG and L8.CG other bump:2.69052 Ang Y5.OH and L8.CB other bump:2.42651 Ang Y5.OH and L8.CA other bump:3.19406 Ang Y5.CZ and L8.N neighbor-bump: 1.99175 Ang N6.C and P7.CD self-bump: 1.34688 Ang P7.N and P7.CD neighbor-bump: 2.30357 Ang N6.CA and P7.CD neighbor-bump: 2.77123 Ang N6.CB and P7.CD self-bump: 2.05273 Ang P7.N and P7.CG self-bump: 2.15408 Ang P7.N and P7.CB neighbor-bump: 2.63671 Ang Y5.CD2 and N6.O neighbor-bump: 2.66394 Ang Y5.CE2 and N6.O neighbor-bump: 2.96908 Ang Y5.CD1 and N6.OD1 neighbor-bump: 2.47935 Ang Y5.CE1 and N6.OD1 Number of specific fragments= 1 total=2207 # 1qipA.123.126 read from T0191.t2k.frag # found chain 1qipA in template set T0191 123 :DLIYNPLET 1qipA 127 :IGIAVPDVY Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.63612 Ang N6.OD1 and P7.CD Number of specific fragments= 1 total=2208 # 1juhA.123.124 read from T0191.t2k.frag # found chain 1juhA in template set T0191 123 :DLIYNPLET 1juhA 125 :GVIVPGGFE Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.46249 Ang I4.CD1 and E9.OE2 neighbor-bump: 2.80282 Ang P7.C and L8.CG neighbor-bump: 2.38545 Ang P7.O and L8.CG neighbor-bump: 2.42825 Ang P7.C and L8.CB neighbor-bump: 1.96681 Ang P7.O and L8.CB neighbor-bump: 2.84196 Ang N6.CB and P7.CD Number of specific fragments= 1 total=2209 # 1bh5A.123.126 read from T0191.t2k.frag # adding 1bh5A to template set 1bh5A:Skipped atom 1406, because occupancy 1 <= existing 1 # found chain 1bh5A in template set T0191 123 :DLIYNPLET 1bh5A 127 :IGIAVPDVY Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.62205 Ang N6.OD1 and P7.CD Number of specific fragments= 1 total=2210 # 1dqnA.124.125 read from T0191.t2k.frag # found chain 1dqnA in template set T0191 124 :LIYNPLETV 1dqnA 126 :EYVDSGHTI Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.12244 Ang Y4.CE1 and V10.CG2 other bump:2.83392 Ang Y4.CZ and V10.CG2 other bump:2.68951 Ang Y4.CD1 and V10.CG2 other bump:2.77942 Ang P6.CB and E8.OE2 other bump:1.95555 Ang P6.CB and E8.OE1 other bump:2.69703 Ang P6.CB and E8.CD neighbor-bump: 2.39336 Ang N5.CB and P6.CD neighbor-bump: 2.33301 Ang N5.OD1 and P6.CD neighbor-bump: 2.63411 Ang N5.OD1 and P6.CG self-bump: 1.38998 Ang N5.CA and N5.CB Number of specific fragments= 1 total=2211 # 1dqpA.124.125 read from T0191.t2k.frag # found chain 1dqpA in template set T0191 124 :LIYNPLETV 1dqpA 126 :EYVDSGHTI Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.44866 Ang N5.CB and P6.CD neighbor-bump: 2.57144 Ang N5.OD1 and P6.CD Number of specific fragments= 1 total=2212 # 1gqeA.124.131 read from T0191.t2k.frag # found chain 1gqeA in template set T0191 124 :LIYNPLETV 1gqeA 132 :IQAGSGGTE Fragment has 37 clashes (null) has 37 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.60959 Ang Y4.CD1 and G11.CA other bump:1.60489 Ang Y4.CE1 and G11.CA other bump:2.50334 Ang Y4.CZ and G11.CA other bump:2.76783 Ang Y4.OH and G11.CA other bump:2.67505 Ang Y4.CE1 and G11.N other bump:2.93549 Ang Y4.CZ and G11.N other bump:2.58912 Ang Y4.OH and G11.N neighbor-bump: 3.23451 Ang E8.CG and T9.CA neighbor-bump: 2.45583 Ang E8.CB and T9.N neighbor-bump: 2.17117 Ang E8.CG and T9.N self-bump: 2.19158 Ang E8.CB and E8.C self-bump: 2.47184 Ang E8.CG and E8.C other bump:2.66789 Ang Y4.CE2 and E8.O other bump:2.41852 Ang Y4.CZ and E8.O self-bump: 1.31706 Ang E8.CA and E8.CB other bump:2.82509 Ang Y4.OH and E8.CA other bump:3.12708 Ang Y4.CE2 and E8.N other bump:2.97695 Ang Y4.CZ and E8.N other bump:2.07642 Ang Y4.OH and E8.N other bump:3.02931 Ang Y4.CZ and L7.C other bump:1.75485 Ang Y4.OH and L7.C other bump:2.1605 Ang Y4.OH and L7.O other bump:2.43567 Ang N5.ND2 and L7.CD1 other bump:2.99111 Ang N5.CG and L7.CG other bump:2.69052 Ang Y4.OH and L7.CB other bump:2.42651 Ang Y4.OH and L7.CA other bump:3.19406 Ang Y4.CZ and L7.N neighbor-bump: 1.99175 Ang N5.C and P6.CD self-bump: 1.34688 Ang P6.N and P6.CD neighbor-bump: 2.30357 Ang N5.CA and P6.CD neighbor-bump: 2.77123 Ang N5.CB and P6.CD self-bump: 2.05273 Ang P6.N and P6.CG self-bump: 2.15408 Ang P6.N and P6.CB neighbor-bump: 2.63671 Ang Y4.CD2 and N5.O neighbor-bump: 2.66394 Ang Y4.CE2 and N5.O neighbor-bump: 2.96908 Ang Y4.CD1 and N5.OD1 neighbor-bump: 2.47935 Ang Y4.CE1 and N5.OD1 Number of specific fragments= 1 total=2213 # 1bmtA.124.129 read from T0191.t2k.frag # adding 1bmtA to template set 1bmtA:# found chain 1bmtA in template set T0191 124 :LIYNPLETV 1bmtA 780 :LGVMVPAEK Fragment has 13 clashes (null) has 13 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.65628 Ang Y4.C and P6.CD neighbor-bump: 1.46809 Ang Y4.CE1 and N5.OD1 neighbor-bump: 1.69364 Ang Y4.CD1 and N5.OD1 neighbor-bump: 1.78075 Ang Y4.CE1 and N5.ND2 neighbor-bump: 2.32207 Ang Y4.CZ and N5.ND2 neighbor-bump: 2.54777 Ang Y4.CD1 and N5.ND2 neighbor-bump: 1.7096 Ang Y4.CE1 and N5.CG neighbor-bump: 1.96138 Ang Y4.CD1 and N5.CG neighbor-bump: 2.93014 Ang Y4.CD1 and N5.CB neighbor-bump: 3.13338 Ang I3.CG2 and Y4.CA neighbor-bump: 1.96843 Ang I3.CG2 and Y4.N self-bump: 2.39112 Ang I3.CG2 and I3.C self-bump: 1.34992 Ang I3.CA and I3.CB Number of specific fragments= 1 total=2214 # 1qipA.124.127 read from T0191.t2k.frag # found chain 1qipA in template set T0191 124 :LIYNPLETV 1qipA 128 :GIAVPDVYS Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.17747 Ang L7.CD2 and V10.CG2 other bump:2.87262 Ang L7.CD2 and V10.CB neighbor-bump: 2.63612 Ang N5.OD1 and P6.CD Number of specific fragments= 1 total=2215 # 1bh5A.124.127 read from T0191.t2k.frag # found chain 1bh5A in template set T0191 124 :LIYNPLETV 1bh5A 128 :GIAVPDVYS Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.17127 Ang L7.CD2 and V10.CG2 other bump:2.83386 Ang L7.CD2 and V10.CB neighbor-bump: 2.62205 Ang N5.OD1 and P6.CD Number of specific fragments= 1 total=2216 # 1dqnA.125.126 read from T0191.t2k.frag # found chain 1dqnA in template set T0191 125 :IYNPLETVL 1dqnA 127 :YVDSGHTIF Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.12244 Ang Y3.CE1 and V9.CG2 other bump:2.83392 Ang Y3.CZ and V9.CG2 other bump:2.68951 Ang Y3.CD1 and V9.CG2 other bump:2.77942 Ang P5.CB and E7.OE2 other bump:1.95555 Ang P5.CB and E7.OE1 other bump:2.69703 Ang P5.CB and E7.CD neighbor-bump: 2.39336 Ang N4.CB and P5.CD neighbor-bump: 2.33301 Ang N4.OD1 and P5.CD neighbor-bump: 2.63411 Ang N4.OD1 and P5.CG self-bump: 1.38998 Ang N4.CA and N4.CB Number of specific fragments= 1 total=2217 # 1dqpA.125.126 read from T0191.t2k.frag # found chain 1dqpA in template set T0191 125 :IYNPLETVL 1dqpA 127 :YVDSGHTIF Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.44866 Ang N4.CB and P5.CD neighbor-bump: 2.57144 Ang N4.OD1 and P5.CD Number of specific fragments= 1 total=2218 # 1bmtA.125.130 read from T0191.t2k.frag # found chain 1bmtA in template set T0191 125 :IYNPLETVL 1bmtA 781 :GVMVPAEKI Fragment has 13 clashes (null) has 13 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.65628 Ang Y3.C and P5.CD neighbor-bump: 1.46809 Ang Y3.CE1 and N4.OD1 neighbor-bump: 1.69364 Ang Y3.CD1 and N4.OD1 neighbor-bump: 1.78075 Ang Y3.CE1 and N4.ND2 neighbor-bump: 2.32207 Ang Y3.CZ and N4.ND2 neighbor-bump: 2.54777 Ang Y3.CD1 and N4.ND2 neighbor-bump: 1.7096 Ang Y3.CE1 and N4.CG neighbor-bump: 1.96138 Ang Y3.CD1 and N4.CG neighbor-bump: 2.93014 Ang Y3.CD1 and N4.CB neighbor-bump: 3.13338 Ang I2.CG2 and Y3.CA neighbor-bump: 1.96844 Ang I2.CG2 and Y3.N self-bump: 2.39113 Ang I2.CG2 and I2.C self-bump: 1.34992 Ang I2.CA and I2.CB Number of specific fragments= 1 total=2219 # 1qipA.125.128 read from T0191.t2k.frag # found chain 1qipA in template set T0191 125 :IYNPLETVL 1qipA 129 :IAVPDVYSA Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.17746 Ang L6.CD2 and V9.CG2 other bump:2.87262 Ang L6.CD2 and V9.CB neighbor-bump: 2.63612 Ang N4.OD1 and P5.CD Number of specific fragments= 1 total=2220 # 1bh5A.125.128 read from T0191.t2k.frag # found chain 1bh5A in template set T0191 125 :IYNPLETVL 1bh5A 129 :IAVPDVYSA Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.17127 Ang L6.CD2 and V9.CG2 other bump:2.83387 Ang L6.CD2 and V9.CB neighbor-bump: 2.62205 Ang N4.OD1 and P5.CD Number of specific fragments= 1 total=2221 # 1juhA.125.126 read from T0191.t2k.frag # found chain 1juhA in template set T0191 125 :IYNPLETVL 1juhA 127 :IVPGGFEDL Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.46249 Ang I2.CD1 and E7.OE2 neighbor-bump: 2.38545 Ang P5.O and L6.CG neighbor-bump: 2.80282 Ang P5.C and L6.CG neighbor-bump: 1.96681 Ang P5.O and L6.CB neighbor-bump: 2.42825 Ang P5.C and L6.CB neighbor-bump: 2.84196 Ang N4.CB and P5.CD Number of specific fragments= 1 total=2222 # 1dqnA.126.127 read from T0191.t2k.frag # found chain 1dqnA in template set T0191 126 :YNPLETVLL 1dqnA 128 :VDSGHTIFS Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.12243 Ang Y2.CE1 and V8.CG2 other bump:2.83392 Ang Y2.CZ and V8.CG2 other bump:2.68951 Ang Y2.CD1 and V8.CG2 other bump:2.77942 Ang P4.CB and E6.OE2 other bump:1.95555 Ang P4.CB and E6.OE1 other bump:2.69703 Ang P4.CB and E6.CD neighbor-bump: 2.39335 Ang N3.CB and P4.CD neighbor-bump: 2.333 Ang N3.OD1 and P4.CD neighbor-bump: 2.6341 Ang N3.OD1 and P4.CG self-bump: 1.38998 Ang N3.CA and N3.CB Number of specific fragments= 1 total=2223 # 1dqpA.126.127 read from T0191.t2k.frag # found chain 1dqpA in template set T0191 126 :YNPLETVLL 1dqpA 128 :VDSGHTIFS Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.44866 Ang N3.CB and P4.CD neighbor-bump: 2.57144 Ang N3.OD1 and P4.CD Number of specific fragments= 1 total=2224 # 1bmtA.126.131 read from T0191.t2k.frag # found chain 1bmtA in template set T0191 126 :YNPLETVLL 1bmtA 782 :VMVPAEKIL Fragment has 9 clashes (null) has 9 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.65628 Ang Y2.C and P4.CD neighbor-bump: 1.69364 Ang Y2.CD1 and N3.OD1 neighbor-bump: 1.46809 Ang Y2.CE1 and N3.OD1 neighbor-bump: 2.32207 Ang Y2.CZ and N3.ND2 neighbor-bump: 2.54777 Ang Y2.CD1 and N3.ND2 neighbor-bump: 1.78075 Ang Y2.CE1 and N3.ND2 neighbor-bump: 1.96139 Ang Y2.CD1 and N3.CG neighbor-bump: 1.70961 Ang Y2.CE1 and N3.CG neighbor-bump: 2.93015 Ang Y2.CD1 and N3.CB Number of specific fragments= 1 total=2225 # 1qipA.126.129 read from T0191.t2k.frag # found chain 1qipA in template set T0191 126 :YNPLETVLL 1qipA 130 :AVPDVYSAC Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.17746 Ang L5.CD2 and V8.CG2 other bump:2.87262 Ang L5.CD2 and V8.CB neighbor-bump: 2.63613 Ang N3.OD1 and P4.CD Number of specific fragments= 1 total=2226 # 1bh5A.126.129 read from T0191.t2k.frag # found chain 1bh5A in template set T0191 126 :YNPLETVLL 1bh5A 130 :AVPDVYSAC Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.17127 Ang L5.CD2 and V8.CG2 other bump:2.83387 Ang L5.CD2 and V8.CB neighbor-bump: 2.62204 Ang N3.OD1 and P4.CD Number of specific fragments= 1 total=2227 # 1b24A.126.130 read from T0191.t2k.frag # adding 1b24A to template set 1b24A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # found chain 1b24A in template set T0191 126 :YNPLETVLL 1b24A 131 :NKALLEIVS Fragment has 8 clashes (null) has 8 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:3.08633 Ang Y2.CD1 and P4.CD self-bump: 1.3902 Ang P4.N and P4.CD neighbor-bump: 2.63005 Ang N3.N and P4.CD neighbor-bump: 1.98573 Ang N3.ND2 and P4.CD other bump:2.72424 Ang Y2.OH and P4.CB other bump:2.66078 Ang Y2.CZ and P4.CB other bump:3.08278 Ang Y2.CE2 and P4.CB self-bump: 1.39264 Ang N3.CA and N3.CB Number of specific fragments= 1 total=2228 # 1dqnA.127.128 read from T0191.t2k.frag # found chain 1dqnA in template set T0191 127 :NPLETVLLK 1dqnA 129 :DSGHTIFSI Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.77942 Ang P3.CB and E5.OE2 other bump:1.95555 Ang P3.CB and E5.OE1 other bump:2.69703 Ang P3.CB and E5.CD neighbor-bump: 2.39335 Ang N2.CB and P3.CD neighbor-bump: 2.333 Ang N2.OD1 and P3.CD neighbor-bump: 2.6341 Ang N2.OD1 and P3.CG self-bump: 1.38998 Ang N2.CA and N2.CB Number of specific fragments= 1 total=2229 # 1dqpA.127.128 read from T0191.t2k.frag # found chain 1dqpA in template set T0191 127 :NPLETVLLK 1dqpA 129 :DSGHTIFSI Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.44867 Ang N2.CB and P3.CD neighbor-bump: 2.57145 Ang N2.OD1 and P3.CD Number of specific fragments= 1 total=2230 # 1bmtA.127.132 read from T0191.t2k.frag # found chain 1bmtA in template set T0191 127 :NPLETVLLK 1bmtA 783 :MVPAEKILR Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.65629 Ang G1.C and P3.CD Number of specific fragments= 1 total=2231 # 1qipA.127.130 read from T0191.t2k.frag # found chain 1qipA in template set T0191 127 :NPLETVLLK 1qipA 131 :VPDVYSACK Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.17746 Ang L4.CD2 and V7.CG2 other bump:2.87262 Ang L4.CD2 and V7.CB neighbor-bump: 2.63612 Ang N2.OD1 and P3.CD Number of specific fragments= 1 total=2232 # 1bh5A.127.130 read from T0191.t2k.frag # found chain 1bh5A in template set T0191 127 :NPLETVLLK 1bh5A 131 :VPDVYSACK Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.17127 Ang L4.CD2 and V7.CG2 other bump:2.83387 Ang L4.CD2 and V7.CB neighbor-bump: 2.62204 Ang N2.OD1 and P3.CD Number of specific fragments= 1 total=2233 # 1b24A.127.131 read from T0191.t2k.frag # found chain 1b24A in template set T0191 127 :NPLETVLLK 1b24A 132 :KALLEIVSR Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.63005 Ang N2.N and P3.CD self-bump: 1.39019 Ang P3.N and P3.CD Number of specific fragments= 1 total=2234 # 1dqnA.128.129 read from T0191.t2k.frag # found chain 1dqnA in template set T0191 128 :PLETVLLKE 1dqnA 130 :SGHTIFSIQ Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.77941 Ang P2.CB and E4.OE2 other bump:1.95555 Ang P2.CB and E4.OE1 other bump:2.69703 Ang P2.CB and E4.CD Number of specific fragments= 1 total=2235 # 1bmtA.128.133 read from T0191.t2k.frag # found chain 1bmtA in template set T0191 128 :PLETVLLKE 1bmtA 784 :VPAEKILRT Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2236 # 1dqpA.128.129 read from T0191.t2k.frag # found chain 1dqpA in template set T0191 128 :PLETVLLKE 1dqpA 130 :SGHTIFSIQ Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2237 # 1b24A.128.132 read from T0191.t2k.frag # found chain 1b24A in template set T0191 128 :PLETVLLKE 1b24A 133 :ALLEIVSRW Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues self-bump: 1.3902 Ang P2.N and P2.CD Number of specific fragments= 1 total=2238 # 1qipA.128.131 read from T0191.t2k.frag # found chain 1qipA in template set T0191 128 :PLETVLLKE 1qipA 132 :PDVYSACKR Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.17746 Ang L3.CD2 and V6.CG2 other bump:2.87262 Ang L3.CD2 and V6.CB Number of specific fragments= 1 total=2239 # 1gdoA.128.101 read from T0191.t2k.frag # adding 1gdoA to template set 1gdoA:# found chain 1gdoA in template set T0191 128 :PLETVLLKE 1gdoA 102 :ENHEPLREE Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2240 # 1dqnA.129.130 read from T0191.t2k.frag # found chain 1dqnA in template set T0191 129 :LETVLLKEA 1dqnA 131 :GHTIFSIQE Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2241 # 1bmtA.129.134 read from T0191.t2k.frag # found chain 1bmtA in template set T0191 129 :LETVLLKEA 1bmtA 785 :PAEKILRTA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2242 # 1dqpA.129.130 read from T0191.t2k.frag # found chain 1dqpA in template set T0191 129 :LETVLLKEA 1dqpA 131 :GHTIFSIQE Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.20987 Ang G1.O and L2.CG neighbor-bump: 2.62501 Ang G1.C and L2.CG neighbor-bump: 2.05932 Ang G1.O and L2.CB neighbor-bump: 2.50679 Ang G1.C and L2.CB Number of specific fragments= 1 total=2243 # 1b24A.129.133 read from T0191.t2k.frag # found chain 1b24A in template set T0191 129 :LETVLLKEA 1b24A 134 :LLEIVSRWL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2244 # 1qipA.129.132 read from T0191.t2k.frag # found chain 1qipA in template set T0191 129 :LETVLLKEA 1qipA 133 :DVYSACKRF Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.17744 Ang L2.CD2 and V5.CG2 other bump:2.87259 Ang L2.CD2 and V5.CB Number of specific fragments= 1 total=2245 # 1gdoA.129.102 read from T0191.t2k.frag # found chain 1gdoA in template set T0191 129 :LETVLLKEA 1gdoA 103 :NHEPLREEL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2246 # 1bmtA.130.135 read from T0191.t2k.frag # found chain 1bmtA in template set T0191 130 :ETVLLKEAK 1bmtA 786 :AEKILRTAK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2247 # 1dqnA.130.131 read from T0191.t2k.frag # found chain 1dqnA in template set T0191 130 :ETVLLKEAK 1dqnA 132 :HTIFSIQEQ Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2248 # 1dqpA.130.131 read from T0191.t2k.frag # found chain 1dqpA in template set T0191 130 :ETVLLKEAK 1dqpA 132 :HTIFSIQEQ Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2249 # 1b24A.130.134 read from T0191.t2k.frag # found chain 1b24A in template set T0191 130 :ETVLLKEAK 1b24A 135 :LEIVSRWLN Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2250 # 1gdoA.130.103 read from T0191.t2k.frag # found chain 1gdoA in template set T0191 130 :ETVLLKEAK 1gdoA 104 :HEPLREELK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2251 # 1qipA.130.133 read from T0191.t2k.frag # found chain 1qipA in template set T0191 130 :ETVLLKEAK 1qipA 134 :VYSACKRFE Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2252 # 1bmtA.131.136 read from T0191.t2k.frag # found chain 1bmtA in template set T0191 131 :TVLLKEAKK 1bmtA 787 :EKILRTAKE Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2253 # 1b24A.131.135 read from T0191.t2k.frag # found chain 1b24A in template set T0191 131 :TVLLKEAKK 1b24A 136 :EIVSRWLNN Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2254 # 1dqnA.131.132 read from T0191.t2k.frag # found chain 1dqnA in template set T0191 131 :TVLLKEAKK 1dqnA 133 :TIFSIQEQI Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2255 # 1dqpA.131.132 read from T0191.t2k.frag # found chain 1dqpA in template set T0191 131 :TVLLKEAKK 1dqpA 133 :TIFSIQEQI Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2256 # 1qipA.131.134 read from T0191.t2k.frag # found chain 1qipA in template set T0191 131 :TVLLKEAKK 1qipA 135 :YSACKRFEE Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2257 # 1gdoA.131.104 read from T0191.t2k.frag # found chain 1gdoA in template set T0191 131 :TVLLKEAKK 1gdoA 105 :EPLREELKA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2258 # 1bmtA.132.137 read from T0191.t2k.frag # found chain 1bmtA in template set T0191 132 :VLLKEAKKV 1bmtA 788 :KILRTAKEV Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.79922 Ang K5.CE and K9.NZ Number of specific fragments= 1 total=2259 # 1b24A.132.136 read from T0191.t2k.frag # found chain 1b24A in template set T0191 132 :VLLKEAKKV 1b24A 137 :IVSRWLNNL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2260 # 1dqnA.132.133 read from T0191.t2k.frag # found chain 1dqnA in template set T0191 132 :VLLKEAKKV 1dqnA 134 :IFSIQEQIK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2261 # 1dqpA.132.133 read from T0191.t2k.frag # found chain 1dqpA in template set T0191 132 :VLLKEAKKV 1dqpA 134 :IFSIQEQIK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2262 # 1qipA.132.135 read from T0191.t2k.frag # found chain 1qipA in template set T0191 132 :VLLKEAKKV 1qipA 136 :SACKRFEEL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2263 # 1bh5A.132.135 read from T0191.t2k.frag # found chain 1bh5A in template set T0191 132 :VLLKEAKKV 1bh5A 136 :SACKRFEEL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2264 # 1bmtA.133.138 read from T0191.t2k.frag # found chain 1bmtA in template set T0191 133 :LLKEAKKVN 1bmtA 789 :ILRTAKEVN Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.79922 Ang K4.CE and K8.NZ Number of specific fragments= 1 total=2265 # 1b24A.133.137 read from T0191.t2k.frag # found chain 1b24A in template set T0191 133 :LLKEAKKVN 1b24A 138 :VSRWLNNLG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2266 # 1dqnA.133.134 read from T0191.t2k.frag # found chain 1dqnA in template set T0191 133 :LLKEAKKVN 1dqnA 135 :FSIQEQIKH Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2267 # 1dqpA.133.134 read from T0191.t2k.frag # found chain 1dqpA in template set T0191 133 :LLKEAKKVN 1dqpA 135 :FSIQEQIKH Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2268 # 1qipA.133.136 read from T0191.t2k.frag # found chain 1qipA in template set T0191 133 :LLKEAKKVN 1qipA 137 :ACKRFEELG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2269 # 1bh5A.133.136 read from T0191.t2k.frag # found chain 1bh5A in template set T0191 133 :LLKEAKKVN 1bh5A 137 :ACKRFEELG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2270 # 1bmtA.134.139 read from T0191.t2k.frag # found chain 1bmtA in template set T0191 134 :LKEAKKVNA 1bmtA 790 :LRTAKEVNA Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.79922 Ang K3.CE and K7.NZ Number of specific fragments= 1 total=2271 # 1b24A.134.138 read from T0191.t2k.frag # found chain 1b24A in template set T0191 134 :LKEAKKVNA 1b24A 139 :SRWLNNLGV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2272 # 1qipA.134.137 read from T0191.t2k.frag # found chain 1qipA in template set T0191 134 :LKEAKKVNA 1qipA 138 :CKRFEELGV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2273 # 1dqnA.134.135 read from T0191.t2k.frag # found chain 1dqnA in template set T0191 134 :LKEAKKVNA 1dqnA 136 :SIQEQIKHA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2274 # 1dqpA.134.135 read from T0191.t2k.frag # found chain 1dqpA in template set T0191 134 :LKEAKKVNA 1dqpA 136 :SIQEQIKHA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2275 # 1ff9A.134.108 read from T0191.t2k.frag # found chain 1ff9A in template set T0191 134 :LKEAKKVNA 1ff9A 109 :DQAAKDAGI Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.65915 Ang L2.CD2 and K6.NZ other bump:2.90007 Ang L2.CD2 and K6.CE Number of specific fragments= 1 total=2276 # 1bmtA.135.140 read from T0191.t2k.frag # found chain 1bmtA in template set T0191 135 :KEAKKVNAK 1bmtA 791 :RTAKEVNAD Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.79921 Ang K2.CE and K6.NZ Number of specific fragments= 1 total=2277 # 1b24A.135.139 read from T0191.t2k.frag # found chain 1b24A in template set T0191 135 :KEAKKVNAK 1b24A 140 :RWLNNLGVR Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2278 # 1qipA.135.138 read from T0191.t2k.frag # found chain 1qipA in template set T0191 135 :KEAKKVNAK 1qipA 139 :KRFEELGVK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2279 # 1dqnA.135.136 read from T0191.t2k.frag # found chain 1dqnA in template set T0191 135 :KEAKKVNAK 1dqnA 137 :IQEQIKHAK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2280 # 1ff9A.135.109 read from T0191.t2k.frag # found chain 1ff9A in template set T0191 135 :KEAKKVNAK 1ff9A 110 :QAAKDAGIT Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2281 # 1bh5A.135.138 read from T0191.t2k.frag # found chain 1bh5A in template set T0191 135 :KEAKKVNAK 1bh5A 139 :KRFEELGVK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2282 # 1b24A.136.140 read from T0191.t2k.frag # found chain 1b24A in template set T0191 136 :EAKKVNAKT 1b24A 141 :WLNNLGVRN Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2283 # 1qipA.136.139 read from T0191.t2k.frag # found chain 1qipA in template set T0191 136 :EAKKVNAKT 1qipA 140 :RFEELGVKF Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2284 # 1bmtA.136.141 read from T0191.t2k.frag # found chain 1bmtA in template set T0191 136 :EAKKVNAKT 1bmtA 792 :TAKEVNADL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2285 # 1dqnA.136.137 read from T0191.t2k.frag # found chain 1dqnA in template set T0191 136 :EAKKVNAKT 1dqnA 138 :QEQIKHAKI Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2286 # 1ff9A.136.110 read from T0191.t2k.frag # found chain 1ff9A in template set T0191 136 :EAKKVNAKT 1ff9A 111 :AAKDAGITV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2287 # 1bh5A.136.139 read from T0191.t2k.frag # found chain 1bh5A in template set T0191 136 :EAKKVNAKT 1bh5A 140 :RFEELGVKF Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2288 # 1b24A.137.141 read from T0191.t2k.frag # found chain 1b24A in template set T0191 137 :AKKVNAKTI 1b24A 142 :LNNLGVRNT Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2289 # 1qipA.137.140 read from T0191.t2k.frag # found chain 1qipA in template set T0191 137 :AKKVNAKTI 1qipA 141 :FEELGVKFV Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues self-bump: 1.3918 Ang I10.CA and I10.CB Number of specific fragments= 1 total=2290 # 1gci.137.139 read from T0191.t2k.frag # found chain 1gci in training set T0191 137 :AKKVNAKTI 1gci 142 :ATSRGVLVV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2291 # 1ff9A.137.111 read from T0191.t2k.frag # found chain 1ff9A in template set T0191 137 :AKKVNAKTI 1ff9A 112 :AKDAGITVM Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2292 # 1he2A.137.138 read from T0191.t2k.frag # adding 1he2A to template set 1he2A:Skipped atom 57, because occupancy 0.41 <= existing 0.590001 Skipped atom 58, because occupancy 0.41 <= existing 0.590001 Skipped atom 59, because occupancy 0.41 <= existing 0.590001 Skipped atom 60, because occupancy 0.41 <= existing 0.590001 Skipped atom 61, because occupancy 0.41 <= existing 0.590001 Skipped atom 95, because occupancy 0.48 <= existing 0.520001 Skipped atom 96, because occupancy 0.48 <= existing 0.520001 Skipped atom 97, because occupancy 0.48 <= existing 0.520001 Skipped atom 98, because occupancy 0.48 <= existing 0.520001 Skipped atom 99, because occupancy 0.48 <= existing 0.520001 Skipped atom 642, because occupancy 0.32 <= existing 0.680001 Skipped atom 643, because occupancy 0.32 <= existing 0.680001 Skipped atom 1068, because occupancy 0.35 <= existing 0.640001 Skipped atom 1069, because occupancy 0.35 <= existing 0.640001 Skipped atom 1070, because occupancy 0.35 <= existing 0.640001 Skipped atom 1541, because occupancy 0.33 <= existing 0.670001 Skipped atom 1542, because occupancy 0.33 <= existing 0.670001 Skipped atom 1543, because occupancy 0.33 <= existing 0.670001 Skipped atom 1544, because occupancy 0.33 <= existing 0.670001 Skipped atom 2148, because occupancy 0.32 <= existing 0.680001 Skipped atom 2149, because occupancy 0.32 <= existing 0.680001 Skipped atom 2150, because occupancy 0.32 <= existing 0.680001 Skipped atom 2151, because occupancy 0.32 <= existing 0.680001 Skipped atom 2352, because occupancy 0.43 <= existing 0.570001 Skipped atom 2353, because occupancy 0.43 <= existing 0.570001 Skipped atom 2354, because occupancy 0.43 <= existing 0.570001 Skipped atom 2355, because occupancy 0.43 <= existing 0.570001 Skipped atom 2389, because occupancy 0.23 <= existing 0.770001 Skipped atom 2565, because occupancy 0.42 <= existing 0.580001 Skipped atom 2566, because occupancy 0.42 <= existing 0.580001 Skipped atom 2567, because occupancy 0.42 <= existing 0.580001 Skipped atom 2568, because occupancy 0.42 <= existing 0.580001 Skipped atom 2569, because occupancy 0.42 <= existing 0.580001 Skipped atom 2570, because occupancy 0.42 <= existing 0.580001 Skipped atom 2571, because occupancy 0.42 <= existing 0.580001 Skipped atom 2652, because occupancy 0.2 <= existing 0.800001 Skipped atom 2653, because occupancy 0.2 <= existing 0.800001 Skipped atom 2654, because occupancy 0.2 <= existing 0.800001 Skipped atom 2691, because occupancy 0.46 <= existing 0.540001 Skipped atom 2692, because occupancy 0.46 <= existing 0.540001 Skipped atom 2826, because occupancy 0.39 <= existing 0.610001 Skipped atom 2827, because occupancy 0.39 <= existing 0.610001 Skipped atom 2828, because occupancy 0.39 <= existing 0.610001 # found chain 1he2A in template set T0191 137 :AKKVNAKTI 1he2A 139 :LRESGLKYV Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.24173 Ang G1.O and V5.CG2 Number of specific fragments= 1 total=2293 # 1bh5A.137.140 read from T0191.t2k.frag # found chain 1bh5A in template set T0191 137 :AKKVNAKTI 1bh5A 141 :FEELGVKFV Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues self-bump: 1.38792 Ang I10.CA and I10.CB Number of specific fragments= 1 total=2294 # 1b24A.138.142 read from T0191.t2k.frag # found chain 1b24A in template set T0191 138 :KKVNAKTIN 1b24A 143 :NNLGVRNTI Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2295 # 1gci.138.140 read from T0191.t2k.frag # found chain 1gci in training set T0191 138 :KKVNAKTIN 1gci 143 :TSRGVLVVA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2296 # 1he2A.138.139 read from T0191.t2k.frag # found chain 1he2A in template set T0191 138 :KKVNAKTIN 1he2A 140 :RESGLKYVA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2297 # 1qipA.138.141 read from T0191.t2k.frag # found chain 1qipA in template set T0191 138 :KKVNAKTIN 1qipA 142 :EELGVKFVK Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues self-bump: 1.3918 Ang I9.CA and I9.CB Number of specific fragments= 1 total=2298 # 1fjgP.138.59 read from T0191.t2k.frag # adding 1fjgP to template set 1fjgP:# found chain 1fjgP in template set T0191 138 :KKVNAKTIN 1fjgP 60 :LSVGAQPTD Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2299 # 1jw9B.138.142 read from T0191.t2k.frag # found chain 1jw9B in template set T0191 138 :KKVNAKTIN 1jw9B 143 :FAAKVPLVS Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2300 # 1gci.139.141 read from T0191.t2k.frag # found chain 1gci in training set T0191 139 :KVNAKTING 1gci 144 :SRGVLVVAA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2301 # 1b24A.139.143 read from T0191.t2k.frag # found chain 1b24A in template set T0191 139 :KVNAKTING 1b24A 144 :NLGVRNTIH Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2302 # 1fjgP.139.60 read from T0191.t2k.frag # found chain 1fjgP in template set T0191 139 :KVNAKTING 1fjgP 61 :SVGAQPTDT Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2303 # 1hy3A.139.144 read from T0191.t2k.frag # found chain 1hy3A in template set T0191 139 :KVNAKTING 1hy3A 145 :VAGHPNPGS Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2304 # 1jw9B.139.143 read from T0191.t2k.frag # found chain 1jw9B in template set T0191 139 :KVNAKTING 1jw9B 144 :AAKVPLVSG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2305 # 1he2A.139.140 read from T0191.t2k.frag # found chain 1he2A in template set T0191 139 :KVNAKTING 1he2A 141 :ESGLKYVAV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2306 # 1gci.140.142 read from T0191.t2k.frag # found chain 1gci in training set T0191 140 :VNAKTINGL 1gci 145 :RGVLVVAAS Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2307 # 1fjgP.140.61 read from T0191.t2k.frag # found chain 1fjgP in template set T0191 140 :VNAKTINGL 1fjgP 62 :VGAQPTDTA Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.83543 Ang T6.CG2 and G11.CA other bump:2.32386 Ang T6.CG2 and G11.N other bump:2.94054 Ang T6.CG2 and L10.C other bump:2.66533 Ang I7.CG1 and L10.CD1 other bump:2.30538 Ang I7.CD1 and L10.CD1 other bump:2.96603 Ang I7.CG1 and L10.CG other bump:2.34663 Ang I7.CD1 and L10.CG Number of specific fragments= 1 total=2308 # 1hy3A.140.145 read from T0191.t2k.frag # found chain 1hy3A in template set T0191 140 :VNAKTINGL 1hy3A 146 :AGHPNPGSF Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2309 # 1b24A.140.144 read from T0191.t2k.frag # found chain 1b24A in template set T0191 140 :VNAKTINGL 1b24A 145 :LGVRNTIHL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2310 # 1a8rA.140.142 read from T0191.t2k.frag # adding 1a8rA to template set 1a8rA:# found chain 1a8rA in template set T0191 140 :VNAKTINGL 1a8rA 143 :FFAQRPQVQ Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.27039 Ang T6.CG2 and N8.OD1 Number of specific fragments= 1 total=2311 # 1jw9B.140.144 read from T0191.t2k.frag # found chain 1jw9B in template set T0191 140 :VNAKTINGL 1jw9B 145 :AKVPLVSGA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2312 # 1gci.141.143 read from T0191.t2k.frag # found chain 1gci in training set T0191 141 :NAKTINGLG 1gci 146 :GVLVVAASG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2313 # 1hy3A.141.146 read from T0191.t2k.frag # found chain 1hy3A in template set T0191 141 :NAKTINGLG 1hy3A 147 :GHPNPGSFP Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2314 # 1a8rA.141.143 read from T0191.t2k.frag # found chain 1a8rA in template set T0191 141 :NAKTINGLG 1a8rA 144 :FAQRPQVQE Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.27039 Ang T5.CG2 and N7.OD1 Number of specific fragments= 1 total=2315 # 1fjgP.141.62 read from T0191.t2k.frag # found chain 1fjgP in template set T0191 141 :NAKTINGLG 1fjgP 63 :GAQPTDTAR Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.83543 Ang T5.CG2 and G10.CA other bump:2.32386 Ang T5.CG2 and G10.N other bump:2.94054 Ang T5.CG2 and L9.C other bump:2.66532 Ang I6.CG1 and L9.CD1 other bump:2.30538 Ang I6.CD1 and L9.CD1 other bump:2.96602 Ang I6.CG1 and L9.CG other bump:2.34662 Ang I6.CD1 and L9.CG Number of specific fragments= 1 total=2316 # 1dowA.141.141 read from T0191.t2k.frag # adding 1dowA to template set 1dowA:Skipped atom 31, because occupancy 0.5 <= existing 0.500001 Skipped atom 33, because occupancy 0.5 <= existing 0.500001 Skipped atom 101, because occupancy 0.5 <= existing 0.500001 Skipped atom 103, because occupancy 0.5 <= existing 0.500001 Skipped atom 105, because occupancy 0.5 <= existing 0.500001 Skipped atom 107, because occupancy 0.5 <= existing 0.500001 Skipped atom 171, because occupancy 0.5 <= existing 0.500001 Skipped atom 173, because occupancy 0.5 <= existing 0.500001 Skipped atom 175, because occupancy 0.5 <= existing 0.500001 Skipped atom 177, because occupancy 0.5 <= existing 0.500001 Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 400, because occupancy 0.5 <= existing 0.500001 Skipped atom 446, because occupancy 0.5 <= existing 0.500001 Skipped atom 448, because occupancy 0.5 <= existing 0.500001 Skipped atom 450, because occupancy 0.5 <= existing 0.500001 Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 727, because occupancy 0.5 <= existing 0.500001 Skipped atom 729, because occupancy 0.5 <= existing 0.500001 Skipped atom 731, because occupancy 0.5 <= existing 0.500001 Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 1454, because occupancy 0.5 <= existing 0.500001 Skipped atom 1456, because occupancy 0.5 <= existing 0.500001 Skipped atom 1458, because occupancy 0.5 <= existing 0.500001 # found chain 1dowA in template set T0191 141 :NAKTINGLG 1dowA 198 :LKDVGNRDQ Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2317 # 1bia.141.141 read from T0191.t2k.frag # found chain 1bia in template set T0191 143 :KTINGLG 1bia 144 :AAAIGLS Fragment has 12 clashes (null) has 12 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 9 residues other bump:3.0805 Ang T3.CG2 and L7.CA other bump:2.60444 Ang T3.CG2 and L7.N other bump:2.29646 Ang I4.O and L7.N neighbor-bump: 2.26282 Ang N5.O and G6.C neighbor-bump: 2.66017 Ang N5.C and G6.C neighbor-bump: 2.64044 Ang I4.C and N5.C neighbor-bump: 2.34472 Ang I4.O and N5.C neighbor-bump: 2.67646 Ang I4.CG2 and N5.N self-bump: 1.36279 Ang I4.CA and I4.CB neighbor-bump: 1.96808 Ang K2.O and T3.OG1 neighbor-bump: 2.74439 Ang K2.C and T3.OG1 self-bump: 1.38619 Ang T3.CA and T3.CB Number of specific fragments= 1 total=2318 # 1hy3A.142.147 read from T0191.t2k.frag # found chain 1hy3A in template set T0191 142 :AKTINGLGM 1hy3A 148 :HPNPGSFPE Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2319 # 1a8rA.142.144 read from T0191.t2k.frag # found chain 1a8rA in template set T0191 142 :AKTINGLGM 1a8rA 145 :AQRPQVQER Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.27039 Ang T4.CG2 and N6.OD1 Number of specific fragments= 1 total=2320 # 1lckA.142.144 read from T0191.t2k.frag # adding 1lckA to template set 1lckA:# found chain 1lckA in template set T0191 142 :AKTINGLGM 1lckA 196 :RITFPGLHE Fragment has 8 clashes (null) has 8 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.6425 Ang I5.CD1 and G11.CA other bump:2.91241 Ang I5.CG2 and G11.N other bump:1.65343 Ang N6.CG and M10.CE other bump:2.01011 Ang N6.ND2 and M10.CE other bump:1.40247 Ang N6.OD1 and M10.CE other bump:3.02057 Ang N6.ND2 and M10.SD other bump:3.09316 Ang N6.OD1 and M10.SD other bump:2.48188 Ang I5.CG2 and G7.O Number of specific fragments= 1 total=2321 # 1gci.142.144 read from T0191.t2k.frag # found chain 1gci in training set T0191 142 :AKTINGLGM 1gci 147 :VLVVAASGN Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2322 # 3stdA.142.144 read from T0191.t2k.frag # adding 3stdA to template set 3stdA:# found chain 3stdA in template set T0191 142 :AKTINGLGM 3stdA 152 :RWGEFDFDR Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.93669 Ang T4.CB and L8.CB other bump:2.58394 Ang T4.CG2 and L8.CB other bump:2.19587 Ang T4.OG1 and L8.CB other bump:2.90756 Ang T4.CG2 and L8.N Number of specific fragments= 1 total=2323 # 1bia.142.142 read from T0191.t2k.frag # found chain 1bia in template set T0191 143 :KTINGLGM 1bia 144 :AAAIGLSL Fragment has 12 clashes (null) has 12 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 10 residues other bump:3.0805 Ang T3.CG2 and L7.CA other bump:2.29646 Ang I4.O and L7.N other bump:2.60444 Ang T3.CG2 and L7.N neighbor-bump: 2.26282 Ang N5.O and G6.C neighbor-bump: 2.66017 Ang N5.C and G6.C neighbor-bump: 2.34472 Ang I4.O and N5.C neighbor-bump: 2.64044 Ang I4.C and N5.C neighbor-bump: 2.67646 Ang I4.CG2 and N5.N self-bump: 1.36279 Ang I4.CA and I4.CB neighbor-bump: 1.96808 Ang K2.O and T3.OG1 neighbor-bump: 2.74439 Ang K2.C and T3.OG1 self-bump: 1.38619 Ang T3.CA and T3.CB Number of specific fragments= 1 total=2324 # 3stdA.143.145 read from T0191.t2k.frag # found chain 3stdA in template set T0191 143 :KTINGLGML 3stdA 153 :WGEFDFDRI Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.93669 Ang T3.CB and L7.CB other bump:2.58394 Ang T3.CG2 and L7.CB other bump:2.19587 Ang T3.OG1 and L7.CB other bump:2.90756 Ang T3.CG2 and L7.N Number of specific fragments= 1 total=2325 # 1hy3A.143.148 read from T0191.t2k.frag # found chain 1hy3A in template set T0191 143 :KTINGLGML 1hy3A 149 :PNPGSFPEF Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.49722 Ang I4.CG1 and L10.CD1 other bump:2.19064 Ang I4.CD1 and L10.CD1 other bump:2.82462 Ang I4.CG1 and L10.CG other bump:2.50597 Ang I4.CD1 and L10.CG other bump:2.96121 Ang I4.CG1 and L10.CB Number of specific fragments= 1 total=2326 # 1a8rA.143.145 read from T0191.t2k.frag # found chain 1a8rA in template set T0191 143 :KTINGLGML 1a8rA 146 :QRPQVQERL Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.27041 Ang T3.CG2 and N5.OD1 Number of specific fragments= 1 total=2327 # 1lckA.143.145 read from T0191.t2k.frag # found chain 1lckA in template set T0191 143 :KTINGLGML 1lckA 197 :ITFPGLHEL Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.50332 Ang I4.CD1 and L10.CG other bump:2.43189 Ang I4.CD1 and L10.CB other bump:2.6425 Ang I4.CD1 and L10.CA other bump:2.91241 Ang I4.CG2 and L10.N other bump:1.65342 Ang N5.CG and M9.CE other bump:2.01011 Ang N5.ND2 and M9.CE other bump:1.40247 Ang N5.OD1 and M9.CE other bump:3.02057 Ang N5.ND2 and M9.SD other bump:3.09315 Ang N5.OD1 and M9.SD other bump:2.48188 Ang I4.CG2 and G6.O Number of specific fragments= 1 total=2328 # 1bia.143.143 read from T0191.t2k.frag # found chain 1bia in template set T0191 143 :KTINGLGML 1bia 144 :AAAIGLSLV Fragment has 12 clashes (null) has 12 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:3.0805 Ang T3.CG2 and L7.CA other bump:2.29646 Ang I4.O and L7.N other bump:2.60444 Ang T3.CG2 and L7.N neighbor-bump: 2.26282 Ang N5.O and G6.C neighbor-bump: 2.66017 Ang N5.C and G6.C neighbor-bump: 2.64044 Ang I4.C and N5.C neighbor-bump: 2.34472 Ang I4.O and N5.C neighbor-bump: 2.67646 Ang I4.CG2 and N5.N self-bump: 1.36279 Ang I4.CA and I4.CB neighbor-bump: 1.96808 Ang K2.O and T3.OG1 neighbor-bump: 2.74439 Ang K2.C and T3.OG1 self-bump: 1.38619 Ang T3.CA and T3.CB Number of specific fragments= 1 total=2329 # 1pbv.143.153 read from T0191.t2k.frag # found chain 1pbv in training set T0191 143 :KTINGLGML 1pbv 205 :RDKPGLERF Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2330 # 3stdA.144.146 read from T0191.t2k.frag # found chain 3stdA in template set T0191 144 :TINGLGMLI 3stdA 154 :GEFDFDRIF Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:3.09447 Ang T2.CG2 and L6.CG other bump:2.89401 Ang T2.CB and L6.CB other bump:1.94952 Ang T2.CG2 and L6.CB other bump:3.01831 Ang T2.CG2 and L6.CA Number of specific fragments= 1 total=2331 # 1a8rA.144.146 read from T0191.t2k.frag # found chain 1a8rA in template set T0191 144 :TINGLGMLI 1a8rA 147 :RPQVQERLT Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.2704 Ang T2.CG2 and N4.OD1 Number of specific fragments= 1 total=2332 # 1hy3A.144.149 read from T0191.t2k.frag # found chain 1hy3A in template set T0191 144 :TINGLGMLI 1hy3A 150 :NPGSFPEFV Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.49722 Ang I3.CG1 and L9.CD1 other bump:2.19064 Ang I3.CD1 and L9.CD1 other bump:2.82462 Ang I3.CG1 and L9.CG other bump:2.50597 Ang I3.CD1 and L9.CG other bump:2.96121 Ang I3.CG1 and L9.CB Number of specific fragments= 1 total=2333 # 1bia.144.144 read from T0191.t2k.frag # found chain 1bia in template set T0191 144 :TINGLGMLI 1bia 145 :AAIGLSLVI Fragment has 12 clashes (null) has 12 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:3.0805 Ang T2.CG2 and L6.CA other bump:2.29646 Ang I3.O and L6.N other bump:2.60444 Ang T2.CG2 and L6.N neighbor-bump: 2.26282 Ang N4.O and G5.C neighbor-bump: 2.66017 Ang N4.C and G5.C neighbor-bump: 2.34472 Ang I3.O and N4.C neighbor-bump: 2.64044 Ang I3.C and N4.C neighbor-bump: 2.67646 Ang I3.CG2 and N4.N self-bump: 1.36279 Ang I3.CA and I3.CB neighbor-bump: 2.74439 Ang G1.C and T2.OG1 neighbor-bump: 1.96807 Ang G1.O and T2.OG1 self-bump: 1.38619 Ang T2.CA and T2.CB Number of specific fragments= 1 total=2334 # 1lckA.144.146 read from T0191.t2k.frag # found chain 1lckA in template set T0191 144 :TINGLGMLI 1lckA 198 :TFPGLHELV Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.50332 Ang I3.CD1 and L9.CG other bump:2.43189 Ang I3.CD1 and L9.CB other bump:2.6425 Ang I3.CD1 and L9.CA other bump:2.91241 Ang I3.CG2 and L9.N other bump:1.65342 Ang N4.CG and M8.CE other bump:2.01011 Ang N4.ND2 and M8.CE other bump:1.40247 Ang N4.OD1 and M8.CE other bump:3.02057 Ang N4.ND2 and M8.SD other bump:3.09315 Ang N4.OD1 and M8.SD other bump:2.48188 Ang I3.CG2 and G5.O Number of specific fragments= 1 total=2335 # 1dowA.144.144 read from T0191.t2k.frag # found chain 1dowA in template set T0191 144 :TINGLGMLI 1dowA 201 :VGNRDQMAA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2336 # 3stdA.145.147 read from T0191.t2k.frag # found chain 3stdA in template set T0191 145 :INGLGMLIY 3stdA 155 :EFDFDRIFE Fragment has 22 clashes (null) has 22 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.97145 Ang M7.CG and Y10.OH other bump:1.10109 Ang M7.SD and Y10.OH other bump:2.61376 Ang M7.CA and Y10.CZ other bump:2.89308 Ang M7.CB and Y10.CZ other bump:2.60406 Ang M7.CG and Y10.CZ other bump:1.48944 Ang M7.SD and Y10.CZ other bump:2.62233 Ang M7.CE and Y10.CZ other bump:2.54546 Ang M7.SD and Y10.CE2 other bump:1.89788 Ang M7.CA and Y10.CE1 other bump:2.12004 Ang M7.CB and Y10.CE1 other bump:2.5381 Ang M7.CG and Y10.CE1 other bump:2.15769 Ang M7.SD and Y10.CE1 other bump:2.56755 Ang M7.CE and Y10.CE1 other bump:2.71528 Ang M7.C and Y10.CE1 other bump:2.71807 Ang M7.CA and Y10.CD1 other bump:2.25834 Ang M7.O and Y10.CD1 other bump:2.8047 Ang M7.C and Y10.CD1 neighbor-bump: 2.97615 Ang I2.CG2 and N3.CA neighbor-bump: 2.46884 Ang I2.CB and N3.N neighbor-bump: 1.75275 Ang I2.CG2 and N3.N self-bump: 2.33386 Ang I2.CG2 and I2.C self-bump: 1.29013 Ang I2.CA and I2.CB Number of specific fragments= 1 total=2337 # 1a8rA.145.147 read from T0191.t2k.frag # found chain 1a8rA in template set T0191 145 :INGLGMLIY 1a8rA 148 :PQVQERLTQ Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2338 # 1hy3A.145.150 read from T0191.t2k.frag # found chain 1hy3A in template set T0191 145 :INGLGMLIY 1hy3A 151 :PGSFPEFVE Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.63504 Ang L5.CD1 and I9.CD1 Number of specific fragments= 1 total=2339 # 1bia.145.145 read from T0191.t2k.frag # found chain 1bia in template set T0191 145 :INGLGMLIY 1bia 146 :AIGLSLVIG Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.29646 Ang I2.O and L5.N neighbor-bump: 2.26282 Ang N3.O and G4.C neighbor-bump: 2.66017 Ang N3.C and G4.C neighbor-bump: 2.34472 Ang I2.O and N3.C neighbor-bump: 2.64044 Ang I2.C and N3.C neighbor-bump: 2.67645 Ang I2.CG2 and N3.N self-bump: 1.36278 Ang I2.CA and I2.CB Number of specific fragments= 1 total=2340 # 1lckA.145.147 read from T0191.t2k.frag # found chain 1lckA in template set T0191 145 :INGLGMLIY 1lckA 199 :FPGLHELVR Fragment has 16 clashes (null) has 16 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:3.05304 Ang M7.CB and Y10.CE2 other bump:3.01853 Ang M7.CA and Y10.CE2 other bump:2.89892 Ang M7.O and Y10.CE2 other bump:2.72605 Ang M7.CA and Y10.CD2 other bump:2.48351 Ang M7.O and Y10.CD2 other bump:2.97545 Ang M7.C and Y10.CD2 other bump:2.50331 Ang I2.CD1 and L8.CG other bump:2.43189 Ang I2.CD1 and L8.CB other bump:2.64252 Ang I2.CD1 and L8.CA other bump:2.91241 Ang I2.CG2 and L8.N other bump:1.65345 Ang N3.CG and M7.CE other bump:2.01015 Ang N3.ND2 and M7.CE other bump:1.40246 Ang N3.OD1 and M7.CE other bump:3.02061 Ang N3.ND2 and M7.SD other bump:3.09315 Ang N3.OD1 and M7.SD other bump:2.48187 Ang I2.CG2 and G4.O Number of specific fragments= 1 total=2341 # 1qqfA.145.152 read from T0191.t2k.frag # adding 1qqfA to template set 1qqfA:Bad short name: OD for alphabet: pdb_atoms Skipped atom 285, because occupancy 0.5 <= existing 0.500001 Skipped atom 287, because occupancy 0.5 <= existing 0.500001 Skipped atom 289, because occupancy 0.5 <= existing 0.500001 Skipped atom 291, because occupancy 0.5 <= existing 0.500001 Skipped atom 303, because occupancy 0.5 <= existing 0.500001 Skipped atom 305, because occupancy 0.5 <= existing 0.500001 Skipped atom 307, because occupancy 0.5 <= existing 0.500001 Skipped atom 665, because occupancy 0.5 <= existing 0.500001 Skipped atom 667, because occupancy 0.5 <= existing 0.500001 Skipped atom 669, because occupancy 0.5 <= existing 0.500001 Skipped atom 1664, because occupancy 0.5 <= existing 0.500001 Skipped atom 1666, because occupancy 0.5 <= existing 0.500001 Skipped atom 1668, because occupancy 0.5 <= existing 0.500001 Skipped atom 1670, because occupancy 0.5 <= existing 0.500001 Skipped atom 1838, because occupancy 0.5 <= existing 0.500001 Skipped atom 1840, because occupancy 0.5 <= existing 0.500001 Skipped atom 1842, because occupancy 0.5 <= existing 0.500001 # found chain 1qqfA in template set T0191 145 :INGLGMLIY 1qqfA 1162 :VNSLPGSIN Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2342 # 3stdA.146.148 read from T0191.t2k.frag # found chain 3stdA in template set T0191 146 :NGLGMLIYQ 3stdA 156 :FDFDRIFED Fragment has 17 clashes (null) has 17 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.97145 Ang M6.CG and Y9.OH other bump:1.1011 Ang M6.SD and Y9.OH other bump:2.61376 Ang M6.CA and Y9.CZ other bump:2.89308 Ang M6.CB and Y9.CZ other bump:2.60406 Ang M6.CG and Y9.CZ other bump:1.48945 Ang M6.SD and Y9.CZ other bump:2.62233 Ang M6.CE and Y9.CZ other bump:2.54546 Ang M6.SD and Y9.CE2 other bump:1.89789 Ang M6.CA and Y9.CE1 other bump:2.12005 Ang M6.CB and Y9.CE1 other bump:2.53811 Ang M6.CG and Y9.CE1 other bump:2.1577 Ang M6.SD and Y9.CE1 other bump:2.71528 Ang M6.C and Y9.CE1 other bump:2.56755 Ang M6.CE and Y9.CE1 other bump:2.71807 Ang M6.CA and Y9.CD1 other bump:2.25834 Ang M6.O and Y9.CD1 other bump:2.8047 Ang M6.C and Y9.CD1 Number of specific fragments= 1 total=2343 # 1a8rA.146.148 read from T0191.t2k.frag # found chain 1a8rA in template set T0191 146 :NGLGMLIYQ 1a8rA 149 :QVQERLTQQ Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2344 # 1bia.146.146 read from T0191.t2k.frag # found chain 1bia in template set T0191 146 :NGLGMLIYQ 1bia 147 :IGLSLVIGI Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.29646 Ang G1.O and L4.N neighbor-bump: 2.66017 Ang N2.C and G3.C neighbor-bump: 2.26282 Ang N2.O and G3.C neighbor-bump: 2.34472 Ang G1.O and N2.C neighbor-bump: 2.64044 Ang G1.C and N2.C Number of specific fragments= 1 total=2345 # 1ekqA.146.147 read from T0191.t2k.frag # adding 1ekqA to template set 1ekqA:# found chain 1ekqA in template set T0191 146 :NGLGMLIYQ 1ekqA 148 :GDIIRLAQQ Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2346 # 1hy3A.146.151 read from T0191.t2k.frag # found chain 1hy3A in template set T0191 146 :NGLGMLIYQ 1hy3A 152 :GSFPEFVEK Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.63504 Ang L4.CD1 and I8.CD1 Number of specific fragments= 1 total=2347 # 1dowA.146.146 read from T0191.t2k.frag # found chain 1dowA in template set T0191 146 :NGLGMLIYQ 1dowA 203 :NRDQMAAAR Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2348 # 3stdA.147.149 read from T0191.t2k.frag # found chain 3stdA in template set T0191 147 :GLGMLIYQG 3stdA 157 :DFDRIFEDG Fragment has 17 clashes (null) has 17 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.97145 Ang M5.CG and Y8.OH other bump:1.1011 Ang M5.SD and Y8.OH other bump:2.61376 Ang M5.CA and Y8.CZ other bump:2.89308 Ang M5.CB and Y8.CZ other bump:2.60406 Ang M5.CG and Y8.CZ other bump:1.48945 Ang M5.SD and Y8.CZ other bump:2.62233 Ang M5.CE and Y8.CZ other bump:2.54546 Ang M5.SD and Y8.CE2 other bump:1.89789 Ang M5.CA and Y8.CE1 other bump:2.12005 Ang M5.CB and Y8.CE1 other bump:2.53811 Ang M5.CG and Y8.CE1 other bump:2.1577 Ang M5.SD and Y8.CE1 other bump:2.71528 Ang M5.C and Y8.CE1 other bump:2.56755 Ang M5.CE and Y8.CE1 other bump:2.71807 Ang M5.CA and Y8.CD1 other bump:2.25834 Ang M5.O and Y8.CD1 other bump:2.8047 Ang M5.C and Y8.CD1 Number of specific fragments= 1 total=2349 # 1a8rA.147.149 read from T0191.t2k.frag # found chain 1a8rA in template set T0191 147 :GLGMLIYQG 1a8rA 150 :VQERLTQQI Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2350 # 1bia.147.147 read from T0191.t2k.frag # found chain 1bia in template set T0191 147 :GLGMLIYQG 1bia 148 :GLSLVIGIV Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.26282 Ang G1.O and G2.C neighbor-bump: 2.66017 Ang G1.C and G2.C Number of specific fragments= 1 total=2351 # 1ekqA.147.148 read from T0191.t2k.frag # found chain 1ekqA in template set T0191 147 :GLGMLIYQG 1ekqA 149 :DIIRLAQQA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2352 # 1c3qA.147.148 read from T0191.t2k.frag # adding 1c3qA to template set 1c3qA:# found chain 1c3qA in template set T0191 147 :GLGMLIYQG 1c3qA 149 :DIIRLAQQA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2353 # 1dowA.147.147 read from T0191.t2k.frag # found chain 1dowA in template set T0191 147 :GLGMLIYQG 1dowA 204 :RDQMAAARG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2354 # 3stdA.148.150 read from T0191.t2k.frag # found chain 3stdA in template set T0191 148 :LGMLIYQGA 3stdA 158 :FDRIFEDGR Fragment has 17 clashes (null) has 17 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.97145 Ang M4.CG and Y7.OH other bump:1.1011 Ang M4.SD and Y7.OH other bump:2.61376 Ang M4.CA and Y7.CZ other bump:2.89308 Ang M4.CB and Y7.CZ other bump:2.60406 Ang M4.CG and Y7.CZ other bump:1.48945 Ang M4.SD and Y7.CZ other bump:2.62233 Ang M4.CE and Y7.CZ other bump:2.54546 Ang M4.SD and Y7.CE2 other bump:1.89789 Ang M4.CA and Y7.CE1 other bump:2.12005 Ang M4.CB and Y7.CE1 other bump:2.53811 Ang M4.CG and Y7.CE1 other bump:2.1577 Ang M4.SD and Y7.CE1 other bump:2.71528 Ang M4.C and Y7.CE1 other bump:2.56755 Ang M4.CE and Y7.CE1 other bump:2.71807 Ang M4.CA and Y7.CD1 other bump:2.25834 Ang M4.O and Y7.CD1 other bump:2.8047 Ang M4.C and Y7.CD1 Number of specific fragments= 1 total=2355 # 1a8rA.148.150 read from T0191.t2k.frag # found chain 1a8rA in template set T0191 148 :LGMLIYQGA 1a8rA 151 :QERLTQQIL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2356 # 1bia.148.148 read from T0191.t2k.frag # found chain 1bia in template set T0191 148 :LGMLIYQGA 1bia 149 :LSLVIGIVM Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2357 # 1ekqA.148.149 read from T0191.t2k.frag # found chain 1ekqA in template set T0191 148 :LGMLIYQGA 1ekqA 150 :IIRLAQQAA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2358 # 1c3qA.148.149 read from T0191.t2k.frag # found chain 1c3qA in template set T0191 148 :LGMLIYQGA 1c3qA 150 :IIRLAQQAA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2359 # 1dowA.148.148 read from T0191.t2k.frag # found chain 1dowA in template set T0191 148 :LGMLIYQGA 1dowA 205 :DQMAAARGI Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2360 # 3stdA.149.151 read from T0191.t2k.frag # found chain 3stdA in template set T0191 149 :GMLIYQGAV 3stdA 159 :DRIFEDGRE Fragment has 17 clashes (null) has 17 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.97145 Ang M3.CG and Y6.OH other bump:1.1011 Ang M3.SD and Y6.OH other bump:2.89308 Ang M3.CB and Y6.CZ other bump:2.60406 Ang M3.CG and Y6.CZ other bump:1.48945 Ang M3.SD and Y6.CZ other bump:2.62233 Ang M3.CE and Y6.CZ other bump:2.61376 Ang M3.CA and Y6.CZ other bump:2.54546 Ang M3.SD and Y6.CE2 other bump:2.12005 Ang M3.CB and Y6.CE1 other bump:2.53811 Ang M3.CG and Y6.CE1 other bump:2.1577 Ang M3.SD and Y6.CE1 other bump:2.56755 Ang M3.CE and Y6.CE1 other bump:1.89789 Ang M3.CA and Y6.CE1 other bump:2.71528 Ang M3.C and Y6.CE1 other bump:2.71807 Ang M3.CA and Y6.CD1 other bump:2.25834 Ang M3.O and Y6.CD1 other bump:2.8047 Ang M3.C and Y6.CD1 Number of specific fragments= 1 total=2361 # 1a8rA.149.151 read from T0191.t2k.frag # found chain 1a8rA in template set T0191 149 :GMLIYQGAV 1a8rA 152 :ERLTQQILI Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2362 # 1bia.149.149 read from T0191.t2k.frag # found chain 1bia in template set T0191 149 :GMLIYQGAV 1bia 150 :SLVIGIVMA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2363 # 1ekqA.149.150 read from T0191.t2k.frag # found chain 1ekqA in template set T0191 149 :GMLIYQGAV 1ekqA 151 :IRLAQQAAQ Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2364 # 1dowA.149.149 read from T0191.t2k.frag # found chain 1dowA in template set T0191 149 :GMLIYQGAV 1dowA 206 :QMAAARGIL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2365 # 1c3qA.149.150 read from T0191.t2k.frag # found chain 1c3qA in template set T0191 149 :GMLIYQGAV 1c3qA 151 :IRLAQQAAQ Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2366 # 3stdA.150.152 read from T0191.t2k.frag # found chain 3stdA in template set T0191 150 :MLIYQGAVA 3stdA 160 :RIFEDGRET Fragment has 17 clashes (null) has 17 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.97146 Ang M2.CG and Y5.OH other bump:1.10109 Ang M2.SD and Y5.OH other bump:2.89308 Ang M2.CB and Y5.CZ other bump:2.60406 Ang M2.CG and Y5.CZ other bump:1.48945 Ang M2.SD and Y5.CZ other bump:2.61376 Ang M2.CA and Y5.CZ other bump:2.62233 Ang M2.CE and Y5.CZ other bump:2.54547 Ang M2.SD and Y5.CE2 other bump:2.12005 Ang M2.CB and Y5.CE1 other bump:2.53811 Ang M2.CG and Y5.CE1 other bump:2.1577 Ang M2.SD and Y5.CE1 other bump:1.89789 Ang M2.CA and Y5.CE1 other bump:2.71528 Ang M2.C and Y5.CE1 other bump:2.56755 Ang M2.CE and Y5.CE1 other bump:2.71807 Ang M2.CA and Y5.CD1 other bump:2.25834 Ang M2.O and Y5.CD1 other bump:2.8047 Ang M2.C and Y5.CD1 Number of specific fragments= 1 total=2367 # 1a8rA.150.152 read from T0191.t2k.frag # found chain 1a8rA in template set T0191 150 :MLIYQGAVA 1a8rA 153 :RLTQQILIA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2368 # 1bia.150.150 read from T0191.t2k.frag # found chain 1bia in template set T0191 150 :MLIYQGAVA 1bia 151 :LVIGIVMAE Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2369 # 1ekqA.150.151 read from T0191.t2k.frag # found chain 1ekqA in template set T0191 150 :MLIYQGAVA 1ekqA 152 :RLAQQAAQK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2370 # 1dowA.150.150 read from T0191.t2k.frag # found chain 1dowA in template set T0191 150 :MLIYQGAVA 1dowA 207 :MAAARGILQ Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2371 # 1c3qA.150.151 read from T0191.t2k.frag # found chain 1c3qA in template set T0191 150 :MLIYQGAVA 1c3qA 152 :RLAQQAAQK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2372 # 3stdA.151.153 read from T0191.t2k.frag # found chain 3stdA in template set T0191 151 :LIYQGAVAF 3stdA 161 :IFEDGRETF Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.71528 Ang G1.C and Y4.CE1 other bump:2.25834 Ang G1.O and Y4.CD1 other bump:2.8047 Ang G1.C and Y4.CD1 Number of specific fragments= 1 total=2373 # 1a8rA.151.153 read from T0191.t2k.frag # found chain 1a8rA in template set T0191 151 :LIYQGAVAF 1a8rA 154 :LTQQILIAL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2374 # 1bia.151.151 read from T0191.t2k.frag # found chain 1bia in template set T0191 151 :LIYQGAVAF 1bia 152 :VIGIVMAEV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2375 # 1dowA.151.151 read from T0191.t2k.frag # found chain 1dowA in template set T0191 151 :LIYQGAVAF 1dowA 208 :AAARGILQK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2376 # 1jt6A.151.153 read from T0191.t2k.frag # adding 1jt6A to template set 1jt6A:# found chain 1jt6A in template set T0191 151 :LIYQGAVAF 1jt6A 154 :NAVNGIVTF Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2377 # 1ekqA.151.152 read from T0191.t2k.frag # found chain 1ekqA in template set T0191 151 :LIYQGAVAF 1ekqA 153 :LAQQAAQKL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=2378 # command:# Prefix for output files set to # command:# Printing 119 template chains to Template.atoms # Printed template library # command:# Prefix for output files set to decoys/ # command:CPU_time= 534520 msec, elapsed time= 565098 msec) # command:# Setting InsertAlignment to 0.5 # Setting OneRotamer to 0.01 # Setting ClashingRotamer to 0.5 # Setting InsertFragment to 5 # Setting CrossAndInsert to 5 # Setting CrossOver to 0 # Setting TwoFragment to 10 # Setting InsertSpecificFragment to 8 # Setting ReduceBreak to 1 # Setting CloseGap to 0.2 # Setting ReduceClash to 5 # Setting ReduceConstraint to 5 # Setting JiggleSubtree to 0.03 # Setting OptSubtree to 0.01 # Setting InsertSSBond to 0 # Setting ImproveSSBond to 0 # Initial Method pseudocounts set to # InsertAlignment 0.5 # InsertSpecificFragment 8 # InsertFragment 5 # TwoFragment 10 # CrossOver 0 # CrossAndInsert 5 # ReduceClash 5 # OneRotamer 0.01 # ClashingRotamer 0.5 # ReduceBreak 1 # CloseGap 0.2 # JiggleSubtree 0.03 # OptSubtree 0.01 # ReduceConstraint 5 # InsertSSBond 0 # ImproveSSBond 0 # command:# naming current conformation T0191.try1 # command:# OptConform to optimize cost = # ( 0.2 * gen6.5(6.5) + 1 * wet6.5(6.5, /log(length)) + 3 * dry5(5) + 11 * dry6.5(6.5) + 4 * dry8(8) + 1 * dry12(12) + 0.5 * phobic_fit + 0.2 * sidechain + 1.5 * clashes + -0.2 * sidechain_clashes + 0.5 * backbone_clashes + 10 * break + 1 * pred_alpha2 + 0.1 * constraints + 1 * contact_order ) # Will do 1 iterations of optimization # iteration 0 # filling pool to have 40 conformations # best score in initial pool out of 40: T0191.try1-al4 at pool[5] 69.6655 cost/residue, 152 clashes 0.315372 breaks # optimizing backbone with 40 conformations in pool # doing 200 generations, with 200 new conformations in each generation. # keep at most 16 conformations from old pool # generation 1: best score out of 40: T0191.try1-al8 69.2514 cost/residue, 146 clashes 0.242832 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 5 ## InsertFragment 9 ## TwoFragment 5 ## CrossOver 0 ## CrossAndInsert 0 ## ReduceClash 8 ## OneRotamer 0 ## ClashingRotamer 0 ## ReduceBreak 0 ## CloseGap 0 ## JiggleSubtree 0 ## OptSubtree 0 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # generation 2: best score out of 40: T0191.try1-al8 69.2514 cost/residue, 146 clashes 0.242832 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 9 ## InsertFragment 18 ## TwoFragment 8 ## CrossOver 0 ## CrossAndInsert 3 ## ReduceClash 11 ## OneRotamer 0 ## ClashingRotamer 1 ## ReduceBreak 0 ## CloseGap 0 ## JiggleSubtree 1 ## OptSubtree 0 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # generation 3: best score out of 40: T0191.try1-al8 68.9541 cost/residue, 146 clashes 0.240492 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 12 ## InsertFragment 28 ## TwoFragment 8 ## CrossOver 0 ## CrossAndInsert 8 ## ReduceClash 17 ## OneRotamer 0 ## ClashingRotamer 1 ## ReduceBreak 0 ## CloseGap 0 ## JiggleSubtree 1 ## OptSubtree 0 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # generation 4: best score out of 40: T0191.try1-al8 68.9541 cost/residue, 146 clashes 0.240492 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 20 ## InsertFragment 32 ## TwoFragment 12 ## CrossOver 0 ## CrossAndInsert 10 ## ReduceClash 22 ## OneRotamer 0 ## ClashingRotamer 1 ## ReduceBreak 0 ## CloseGap 1 ## JiggleSubtree 1 ## OptSubtree 0 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # generation 5: best score out of 40: T0191.try1-al8 68.9541 cost/residue, 146 clashes 0.240492 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 23 ## InsertFragment 41 ## TwoFragment 15 ## CrossOver 0 ## CrossAndInsert 13 ## ReduceClash 26 ## OneRotamer 0 ## ClashingRotamer 2 ## ReduceBreak 0 ## CloseGap 2 ## JiggleSubtree 1 ## OptSubtree 0 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # generation 6: best score out of 40: T0191.try1-al8 68.8029 cost/residue, 140 clashes 0.240492 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 24 ## InsertFragment 50 ## TwoFragment 17 ## CrossOver 0 ## CrossAndInsert 19 ## ReduceClash 29 ## OneRotamer 0 ## ClashingRotamer 2 ## ReduceBreak 0 ## CloseGap 4 ## JiggleSubtree 2 ## OptSubtree 0 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # generation 7: best score out of 40: T0191.try1-al8 68.8029 cost/residue, 140 clashes 0.240492 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 25 ## InsertFragment 57 ## TwoFragment 21 ## CrossOver 0 ## CrossAndInsert 25 ## ReduceClash 34 ## OneRotamer 0 ## ClashingRotamer 2 ## ReduceBreak 0 ## CloseGap 5 ## JiggleSubtree 2 ## OptSubtree 0 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 140 # generation 8: best score out of 40: T0191.try1-al8 68.8029 cost/residue, 140 clashes 0.240492 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 28 ## InsertFragment 63 ## TwoFragment 23 ## CrossOver 0 ## CrossAndInsert 29 ## ReduceClash 42 ## OneRotamer 0 ## ClashingRotamer 2 ## ReduceBreak 0 ## CloseGap 5 ## JiggleSubtree 3 ## OptSubtree 0 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # generation 9: best score out of 40: T0191.try1-al8 68.8029 cost/residue, 140 clashes 0.240492 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 31 ## InsertFragment 71 ## TwoFragment 26 ## CrossOver 0 ## CrossAndInsert 30 ## ReduceClash 50 ## OneRotamer 0 ## ClashingRotamer 2 ## ReduceBreak 0 ## CloseGap 6 ## JiggleSubtree 3 ## OptSubtree 0 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # generation 10: best score out of 40: T0191.try1-al8 68.8029 cost/residue, 140 clashes 0.240492 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 34 ## InsertFragment 80 ## TwoFragment 26 ## CrossOver 0 ## CrossAndInsert 35 ## ReduceClash 52 ## OneRotamer 0 ## ClashingRotamer 2 ## ReduceBreak 0 ## CloseGap 11 ## JiggleSubtree 3 ## OptSubtree 0 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # generation 11: best score out of 40: T0191.try1-al8 68.7559 cost/residue, 167 clashes 0.240492 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 35 ## InsertFragment 89 ## TwoFragment 28 ## CrossOver 0 ## CrossAndInsert 39 ## ReduceClash 57 ## OneRotamer 0 ## ClashingRotamer 2 ## ReduceBreak 0 ## CloseGap 14 ## JiggleSubtree 3 ## OptSubtree 0 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # generation 12: best score out of 40: T0191.try1-al8 68.6227 cost/residue, 172 clashes 0.240492 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 36 ## InsertFragment 99 ## TwoFragment 29 ## CrossOver 0 ## CrossAndInsert 44 ## ReduceClash 61 ## OneRotamer 0 ## ClashingRotamer 2 ## ReduceBreak 0 ## CloseGap 17 ## JiggleSubtree 3 ## OptSubtree 0 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # generation 13: best score out of 40: T0191.try1-al8 68.6227 cost/residue, 172 clashes 0.240492 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 38 ## InsertFragment 104 ## TwoFragment 30 ## CrossOver 0 ## CrossAndInsert 47 ## ReduceClash 68 ## OneRotamer 0 ## ClashingRotamer 2 ## ReduceBreak 0 ## CloseGap 23 ## JiggleSubtree 3 ## OptSubtree 0 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 64 # generation 14: best score out of 40: T0191.try1-al8 68.6211 cost/residue, 168 clashes 0.239959 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 39 ## InsertFragment 108 ## TwoFragment 31 ## CrossOver 0 ## CrossAndInsert 49 ## ReduceClash 79 ## OneRotamer 0 ## ClashingRotamer 2 ## ReduceBreak 0 ## CloseGap 28 ## JiggleSubtree 3 ## OptSubtree 0 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 140 # generation 15: best score out of 40: T0191.try1-al8 68.5742 cost/residue, 243 clashes 0.240492 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 41 ## InsertFragment 114 ## TwoFragment 34 ## CrossOver 0 ## CrossAndInsert 54 ## ReduceClash 85 ## OneRotamer 0 ## ClashingRotamer 2 ## ReduceBreak 0 ## CloseGap 30 ## JiggleSubtree 3 ## OptSubtree 0 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # generation 16: best score out of 40: T0191.try1-al8 68.5742 cost/residue, 243 clashes 0.240492 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 43 ## InsertFragment 122 ## TwoFragment 36 ## CrossOver 0 ## CrossAndInsert 60 ## ReduceClash 88 ## OneRotamer 0 ## ClashingRotamer 2 ## ReduceBreak 0 ## CloseGap 32 ## JiggleSubtree 4 ## OptSubtree 0 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # generation 17: best score out of 40: T0191.try1-al8 68.5341 cost/residue, 181 clashes 0.232096 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 43 ## InsertFragment 131 ## TwoFragment 36 ## CrossOver 0 ## CrossAndInsert 63 ## ReduceClash 95 ## OneRotamer 0 ## ClashingRotamer 2 ## ReduceBreak 0 ## CloseGap 36 ## JiggleSubtree 5 ## OptSubtree 0 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # generation 18: best score out of 40: T0191.try1-al8 68.4954 cost/residue, 177 clashes 0.232096 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 45 ## InsertFragment 141 ## TwoFragment 38 ## CrossOver 0 ## CrossAndInsert 64 ## ReduceClash 101 ## OneRotamer 0 ## ClashingRotamer 2 ## ReduceBreak 0 ## CloseGap 38 ## JiggleSubtree 6 ## OptSubtree 0 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 64 # generation 19: best score out of 40: T0191.try1-al8 68.4954 cost/residue, 177 clashes 0.232096 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 49 ## InsertFragment 146 ## TwoFragment 40 ## CrossOver 0 ## CrossAndInsert 67 ## ReduceClash 106 ## OneRotamer 0 ## ClashingRotamer 2 ## ReduceBreak 0 ## CloseGap 43 ## JiggleSubtree 6 ## OptSubtree 0 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # generation 20: best score out of 40: T0191.try1-al8 68.4954 cost/residue, 177 clashes 0.232096 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 53 ## InsertFragment 149 ## TwoFragment 41 ## CrossOver 0 ## CrossAndInsert 67 ## ReduceClash 114 ## OneRotamer 0 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 48 ## JiggleSubtree 8 ## OptSubtree 0 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # generation 21: best score out of 40: T0191.try1-al8 68.4954 cost/residue, 177 clashes 0.232096 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 55 ## InsertFragment 156 ## TwoFragment 43 ## CrossOver 0 ## CrossAndInsert 70 ## ReduceClash 118 ## OneRotamer 0 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 54 ## JiggleSubtree 8 ## OptSubtree 0 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 64 # generation 22: best score out of 40: T0191.try1-al8 68.4954 cost/residue, 177 clashes 0.232096 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 55 ## InsertFragment 161 ## TwoFragment 45 ## CrossOver 0 ## CrossAndInsert 70 ## ReduceClash 127 ## OneRotamer 0 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 62 ## JiggleSubtree 8 ## OptSubtree 0 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 140 # generation 23: best score out of 40: T0191.try1-al8 68.3226 cost/residue, 175 clashes 0.232096 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 57 ## InsertFragment 166 ## TwoFragment 45 ## CrossOver 0 ## CrossAndInsert 75 ## ReduceClash 130 ## OneRotamer 0 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 70 ## JiggleSubtree 9 ## OptSubtree 0 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 140 # generation 24: best score out of 40: T0191.try1-al8 68.2738 cost/residue, 166 clashes 0.232096 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 58 ## InsertFragment 173 ## TwoFragment 46 ## CrossOver 0 ## CrossAndInsert 76 ## ReduceClash 136 ## OneRotamer 0 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 78 ## JiggleSubtree 9 ## OptSubtree 0 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # generation 25: best score out of 40: T0191.try1-al8 68.2738 cost/residue, 166 clashes 0.232096 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 61 ## InsertFragment 176 ## TwoFragment 48 ## CrossOver 0 ## CrossAndInsert 77 ## ReduceClash 140 ## OneRotamer 0 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 87 ## JiggleSubtree 11 ## OptSubtree 0 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 140 # generation 26: best score out of 40: T0191.try1-al8 68.2738 cost/residue, 166 clashes 0.232096 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 62 ## InsertFragment 183 ## TwoFragment 48 ## CrossOver 0 ## CrossAndInsert 80 ## ReduceClash 145 ## OneRotamer 0 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 94 ## JiggleSubtree 12 ## OptSubtree 0 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # generation 27: best score out of 40: T0191.try1-al8 68.2738 cost/residue, 166 clashes 0.232096 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 62 ## InsertFragment 187 ## TwoFragment 51 ## CrossOver 0 ## CrossAndInsert 80 ## ReduceClash 150 ## OneRotamer 0 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 104 ## JiggleSubtree 14 ## OptSubtree 0 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # generation 28: best score out of 40: T0191.try1-al8 68.2738 cost/residue, 166 clashes 0.232096 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 62 ## InsertFragment 197 ## TwoFragment 52 ## CrossOver 0 ## CrossAndInsert 83 ## ReduceClash 151 ## OneRotamer 0 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 113 ## JiggleSubtree 14 ## OptSubtree 0 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # generation 29: best score out of 40: T0191.try1-al8 68.2738 cost/residue, 166 clashes 0.232096 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 62 ## InsertFragment 203 ## TwoFragment 52 ## CrossOver 0 ## CrossAndInsert 84 ## ReduceClash 155 ## OneRotamer 0 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 124 ## JiggleSubtree 16 ## OptSubtree 0 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 140 # generation 30: best score out of 40: T0191.try1-al8 68.253 cost/residue, 169 clashes 0.232052 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 63 ## InsertFragment 211 ## TwoFragment 53 ## CrossOver 0 ## CrossAndInsert 87 ## ReduceClash 158 ## OneRotamer 0 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 131 ## JiggleSubtree 17 ## OptSubtree 0 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # generation 31: best score out of 40: T0191.try1-al8 68.253 cost/residue, 169 clashes 0.232052 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 63 ## InsertFragment 216 ## TwoFragment 53 ## CrossOver 0 ## CrossAndInsert 88 ## ReduceClash 168 ## OneRotamer 0 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 138 ## JiggleSubtree 18 ## OptSubtree 0 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # generation 32: best score out of 40: T0191.try1-al8 68.253 cost/residue, 169 clashes 0.232052 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 63 ## InsertFragment 223 ## TwoFragment 54 ## CrossOver 0 ## CrossAndInsert 89 ## ReduceClash 173 ## OneRotamer 0 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 145 ## JiggleSubtree 21 ## OptSubtree 0 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # generation 33: best score out of 40: T0191.try1-al8 68.253 cost/residue, 169 clashes 0.232052 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 63 ## InsertFragment 230 ## TwoFragment 55 ## CrossOver 0 ## CrossAndInsert 92 ## ReduceClash 178 ## OneRotamer 0 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 153 ## JiggleSubtree 21 ## OptSubtree 0 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 140 # generation 34: best score out of 40: T0191.try1-al8 68.253 cost/residue, 169 clashes 0.232052 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 64 ## InsertFragment 239 ## TwoFragment 55 ## CrossOver 0 ## CrossAndInsert 95 ## ReduceClash 183 ## OneRotamer 0 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 158 ## JiggleSubtree 22 ## OptSubtree 0 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 64 # generation 35: best score out of 40: T0191.try1-al8 68.148 cost/residue, 166 clashes 0.232052 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 64 ## InsertFragment 246 ## TwoFragment 55 ## CrossOver 0 ## CrossAndInsert 96 ## ReduceClash 189 ## OneRotamer 0 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 164 ## JiggleSubtree 26 ## OptSubtree 0 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # generation 36: best score out of 40: T0191.try1-al8 68.148 cost/residue, 166 clashes 0.232052 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 64 ## InsertFragment 248 ## TwoFragment 55 ## CrossOver 0 ## CrossAndInsert 100 ## ReduceClash 192 ## OneRotamer 0 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 176 ## JiggleSubtree 29 ## OptSubtree 0 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 64 # generation 37: best score out of 40: T0191.try1-al8 68.1478 cost/residue, 166 clashes 0.232036 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 66 ## InsertFragment 253 ## TwoFragment 55 ## CrossOver 0 ## CrossAndInsert 103 ## ReduceClash 197 ## OneRotamer 0 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 184 ## JiggleSubtree 30 ## OptSubtree 0 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 140 # generation 38: best score out of 40: T0191.try1-al8 68.1478 cost/residue, 166 clashes 0.232029 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 66 ## InsertFragment 256 ## TwoFragment 55 ## CrossOver 0 ## CrossAndInsert 105 ## ReduceClash 204 ## OneRotamer 0 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 195 ## JiggleSubtree 31 ## OptSubtree 0 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 64 # generation 39: best score out of 40: T0191.try1-al8 68.1478 cost/residue, 166 clashes 0.232029 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 67 ## InsertFragment 262 ## TwoFragment 55 ## CrossOver 0 ## CrossAndInsert 110 ## ReduceClash 205 ## OneRotamer 0 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 205 ## JiggleSubtree 32 ## OptSubtree 0 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 140 # generation 40: best score out of 40: T0191.try1-al8 68.1237 cost/residue, 167 clashes 0.232029 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 68 ## InsertFragment 265 ## TwoFragment 55 ## CrossOver 0 ## CrossAndInsert 110 ## ReduceClash 207 ## OneRotamer 0 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 220 ## JiggleSubtree 35 ## OptSubtree 0 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 140 # generation 41: best score out of 40: T0191.try1-al8 68.1237 cost/residue, 167 clashes 0.232029 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 68 ## InsertFragment 272 ## TwoFragment 56 ## CrossOver 0 ## CrossAndInsert 110 ## ReduceClash 214 ## OneRotamer 0 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 227 ## JiggleSubtree 37 ## OptSubtree 0 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 140 # generation 42: best score out of 40: T0191.try1-al8 68.1237 cost/residue, 167 clashes 0.232029 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 69 ## InsertFragment 275 ## TwoFragment 56 ## CrossOver 0 ## CrossAndInsert 114 ## ReduceClash 215 ## OneRotamer 0 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 238 ## JiggleSubtree 41 ## OptSubtree 0 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # generation 43: best score out of 40: T0191.try1-al8 68.1237 cost/residue, 167 clashes 0.232029 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 69 ## InsertFragment 276 ## TwoFragment 56 ## CrossOver 0 ## CrossAndInsert 116 ## ReduceClash 219 ## OneRotamer 0 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 250 ## JiggleSubtree 46 ## OptSubtree 0 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # generation 44: best score out of 40: T0191.try1-al8 68.053 cost/residue, 187 clashes 0.232024 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 69 ## InsertFragment 280 ## TwoFragment 57 ## CrossOver 0 ## CrossAndInsert 117 ## ReduceClash 219 ## OneRotamer 0 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 263 ## JiggleSubtree 51 ## OptSubtree 0 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 140 # generation 45: best score out of 40: T0191.try1-al8 68.053 cost/residue, 187 clashes 0.232024 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 69 ## InsertFragment 284 ## TwoFragment 58 ## CrossOver 0 ## CrossAndInsert 117 ## ReduceClash 220 ## OneRotamer 0 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 278 ## JiggleSubtree 54 ## OptSubtree 0 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 64 # Removing break before 140 # generation 46: best score out of 40: T0191.try1-al8 68.053 cost/residue, 187 clashes 0.232024 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 69 ## InsertFragment 291 ## TwoFragment 58 ## CrossOver 0 ## CrossAndInsert 118 ## ReduceClash 223 ## OneRotamer 0 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 288 ## JiggleSubtree 57 ## OptSubtree 0 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # generation 47: best score out of 40: T0191.try1-al8 67.9881 cost/residue, 163 clashes 0.232029 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 70 ## InsertFragment 294 ## TwoFragment 58 ## CrossOver 0 ## CrossAndInsert 120 ## ReduceClash 224 ## OneRotamer 1 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 301 ## JiggleSubtree 60 ## OptSubtree 0 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 64 # Removing break before 140 # generation 48: best score out of 40: T0191.try1-al8 67.9881 cost/residue, 163 clashes 0.232024 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 71 ## InsertFragment 296 ## TwoFragment 58 ## CrossOver 0 ## CrossAndInsert 124 ## ReduceClash 225 ## OneRotamer 2 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 313 ## JiggleSubtree 63 ## OptSubtree 0 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 64 # Removing break before 140 # generation 49: best score out of 40: T0191.try1-al8 67.9881 cost/residue, 163 clashes 0.232024 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 71 ## InsertFragment 300 ## TwoFragment 58 ## CrossOver 0 ## CrossAndInsert 124 ## ReduceClash 226 ## OneRotamer 4 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 326 ## JiggleSubtree 66 ## OptSubtree 1 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 140 # generation 50: best score out of 40: T0191.try1-al8 67.9881 cost/residue, 163 clashes 0.232024 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 71 ## InsertFragment 300 ## TwoFragment 58 ## CrossOver 0 ## CrossAndInsert 124 ## ReduceClash 227 ## OneRotamer 4 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 342 ## JiggleSubtree 73 ## OptSubtree 1 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 140 # generation 51: best score out of 40: T0191.try1-al8 67.9866 cost/residue, 162 clashes 0.232029 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 72 ## InsertFragment 302 ## TwoFragment 58 ## CrossOver 0 ## CrossAndInsert 126 ## ReduceClash 227 ## OneRotamer 4 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 355 ## JiggleSubtree 79 ## OptSubtree 1 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 140 # Removing break before 140 # generation 52: best score out of 40: T0191.try1-al8 67.9866 cost/residue, 162 clashes 0.232029 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 73 ## InsertFragment 306 ## TwoFragment 58 ## CrossOver 0 ## CrossAndInsert 126 ## ReduceClash 229 ## OneRotamer 4 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 365 ## JiggleSubtree 86 ## OptSubtree 1 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # generation 53: best score out of 40: T0191.try1-al8 67.9865 cost/residue, 162 clashes 0.232024 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 73 ## InsertFragment 308 ## TwoFragment 58 ## CrossOver 0 ## CrossAndInsert 127 ## ReduceClash 233 ## OneRotamer 4 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 376 ## JiggleSubtree 92 ## OptSubtree 1 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 64 # generation 54: best score out of 40: T0191.try1-al8 67.8527 cost/residue, 164 clashes 0.232024 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 73 ## InsertFragment 310 ## TwoFragment 58 ## CrossOver 0 ## CrossAndInsert 128 ## ReduceClash 234 ## OneRotamer 4 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 391 ## JiggleSubtree 97 ## OptSubtree 1 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # generation 55: best score out of 40: T0191.try1-al8 67.8527 cost/residue, 164 clashes 0.232024 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 74 ## InsertFragment 312 ## TwoFragment 58 ## CrossOver 0 ## CrossAndInsert 133 ## ReduceClash 235 ## OneRotamer 4 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 401 ## JiggleSubtree 102 ## OptSubtree 1 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # generation 56: best score out of 40: T0191.try1-al8 67.8526 cost/residue, 164 clashes 0.232024 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 74 ## InsertFragment 316 ## TwoFragment 58 ## CrossOver 0 ## CrossAndInsert 134 ## ReduceClash 235 ## OneRotamer 5 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 414 ## JiggleSubtree 107 ## OptSubtree 1 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 140 # generation 57: best score out of 40: T0191.try1-al8 67.8526 cost/residue, 164 clashes 0.232024 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 74 ## InsertFragment 317 ## TwoFragment 58 ## CrossOver 0 ## CrossAndInsert 135 ## ReduceClash 236 ## OneRotamer 5 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 426 ## JiggleSubtree 116 ## OptSubtree 1 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 140 # Removing break before 140 # Removing break before 140 # Removing break before 140 # generation 58: best score out of 40: T0191.try1-al8 67.8526 cost/residue, 164 clashes 0.232024 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 74 ## InsertFragment 319 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 136 ## ReduceClash 237 ## OneRotamer 5 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 438 ## JiggleSubtree 123 ## OptSubtree 1 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # generation 59: best score out of 40: T0191.try1-al8 67.8526 cost/residue, 164 clashes 0.232024 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 75 ## InsertFragment 323 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 137 ## ReduceClash 238 ## OneRotamer 5 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 451 ## JiggleSubtree 126 ## OptSubtree 2 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 140 # Removing break before 140 # Removing break before 140 # generation 60: best score out of 40: T0191.try1-al8 67.8526 cost/residue, 164 clashes 0.232024 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 75 ## InsertFragment 323 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 138 ## ReduceClash 238 ## OneRotamer 5 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 465 ## JiggleSubtree 135 ## OptSubtree 2 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # generation 61: best score out of 40: T0191.try1-al8 67.8526 cost/residue, 164 clashes 0.232024 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 75 ## InsertFragment 323 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 139 ## ReduceClash 238 ## OneRotamer 5 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 475 ## JiggleSubtree 147 ## OptSubtree 3 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 140 # Removing break before 64 # generation 62: best score out of 40: T0191.try1-al8 67.8526 cost/residue, 164 clashes 0.232024 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 75 ## InsertFragment 323 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 139 ## ReduceClash 238 ## OneRotamer 5 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 487 ## JiggleSubtree 159 ## OptSubtree 3 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 140 # Removing break before 140 # jumping subtree containing (T0191)R111 jump= -0.574445 0.680152 -0.396204 0.224565 -35.3589 -77.946 2.34442 # Removing break before 64 # Removing break before 140 # Removing break before 140 # generation 63: best score out of 40: T0191.try1-al8 67.8218 cost/residue, 163 clashes 0.232024 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 75 ## InsertFragment 323 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 140 ## ReduceClash 238 ## OneRotamer 5 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 495 ## JiggleSubtree 173 ## OptSubtree 4 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 140 # generation 64: best score out of 40: T0191.try1-al8 67.8218 cost/residue, 163 clashes 0.232024 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 75 ## InsertFragment 323 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 140 ## ReduceClash 239 ## OneRotamer 5 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 505 ## JiggleSubtree 186 ## OptSubtree 4 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # generation 65: best score out of 40: T0191.try1-al8 67.8218 cost/residue, 163 clashes 0.232024 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 75 ## InsertFragment 324 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 140 ## ReduceClash 239 ## OneRotamer 5 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 516 ## JiggleSubtree 196 ## OptSubtree 6 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 140 # generation 66: best score out of 40: T0191.try1-al8 67.8217 cost/residue, 163 clashes 0.232024 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 75 ## InsertFragment 324 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 140 ## ReduceClash 239 ## OneRotamer 5 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 530 ## JiggleSubtree 206 ## OptSubtree 6 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # generation 67: best score out of 40: T0191.try1-al8 67.8217 cost/residue, 163 clashes 0.232024 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 324 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 140 ## ReduceClash 240 ## OneRotamer 5 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 540 ## JiggleSubtree 217 ## OptSubtree 6 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 140 # Removing break before 64 # generation 68: best score out of 40: T0191.try1-al8 67.8072 cost/residue, 210 clashes 0.238995 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 325 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 141 ## ReduceClash 240 ## OneRotamer 5 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 547 ## JiggleSubtree 232 ## OptSubtree 6 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 64 # Removing break before 64 # Removing break before 140 # generation 69: best score out of 40: T0191.try1-al8 67.8072 cost/residue, 210 clashes 0.238995 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 325 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 141 ## ReduceClash 240 ## OneRotamer 5 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 555 ## JiggleSubtree 248 ## OptSubtree 6 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 64 # generation 70: best score out of 40: T0191.try1-al8 67.8072 cost/residue, 210 clashes 0.238995 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 325 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 141 ## ReduceClash 240 ## OneRotamer 5 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 568 ## JiggleSubtree 259 ## OptSubtree 6 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 140 # Removing break before 140 # Removing break before 140 # Removing break before 140 # Removing break before 64 # Removing break before 140 # generation 71: best score out of 40: T0191.try1-al8 67.8072 cost/residue, 210 clashes 0.238995 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 325 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 141 ## ReduceClash 240 ## OneRotamer 5 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 577 ## JiggleSubtree 273 ## OptSubtree 7 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 140 # Removing break before 140 # Removing break before 64 # Removing break before 140 # Removing break before 140 # generation 72: best score out of 40: T0191.try1-al8 67.8071 cost/residue, 210 clashes 0.238995 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 325 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 141 ## ReduceClash 240 ## OneRotamer 5 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 589 ## JiggleSubtree 284 ## OptSubtree 8 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 140 # generation 73: best score out of 40: T0191.try1-al8 67.7792 cost/residue, 210 clashes 0.238724 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 325 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 141 ## ReduceClash 241 ## OneRotamer 5 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 595 ## JiggleSubtree 301 ## OptSubtree 8 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 140 # Removing break before 140 # generation 74: best score out of 40: T0191.try1-al8 67.7792 cost/residue, 210 clashes 0.238724 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 326 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 142 ## ReduceClash 241 ## OneRotamer 5 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 602 ## JiggleSubtree 314 ## OptSubtree 10 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 140 # Removing break before 140 # Removing break before 140 # Removing break before 140 # generation 75: best score out of 40: T0191.try1-al8 67.7792 cost/residue, 210 clashes 0.238724 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 326 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 142 ## ReduceClash 241 ## OneRotamer 5 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 615 ## JiggleSubtree 324 ## OptSubtree 11 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 140 # Removing break before 140 # Removing break before 140 # generation 76: best score out of 40: T0191.try1-al8 67.7791 cost/residue, 210 clashes 0.238724 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 326 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 142 ## ReduceClash 241 ## OneRotamer 5 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 622 ## JiggleSubtree 341 ## OptSubtree 12 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 64 # generation 77: best score out of 40: T0191.try1-al8 67.7791 cost/residue, 210 clashes 0.238724 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 326 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 142 ## ReduceClash 241 ## OneRotamer 5 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 630 ## JiggleSubtree 356 ## OptSubtree 13 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 64 # Removing break before 64 # generation 78: best score out of 40: T0191.try1-al8 67.7791 cost/residue, 210 clashes 0.238724 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 326 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 142 ## ReduceClash 241 ## OneRotamer 5 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 636 ## JiggleSubtree 373 ## OptSubtree 14 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 140 # Removing break before 64 # generation 79: best score out of 40: T0191.try1-al8 67.7752 cost/residue, 210 clashes 0.238724 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 326 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 142 ## ReduceClash 241 ## OneRotamer 6 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 640 ## JiggleSubtree 391 ## OptSubtree 15 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # jumping subtree containing (T0191)Y201 jump= 0.832364 0.480323 -0.275685 0.021411 13.3544 6.60093 67.9407 # Removing break before 140 # generation 80: best score out of 40: T0191.try1-al8 67.7601 cost/residue, 209 clashes 0.238724 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 328 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 142 ## ReduceClash 241 ## OneRotamer 6 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 643 ## JiggleSubtree 409 ## OptSubtree 16 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 140 # Removing break before 64 # generation 81: best score out of 40: T0191.try1-al8 67.7601 cost/residue, 209 clashes 0.238724 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 328 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 142 ## ReduceClash 241 ## OneRotamer 6 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 647 ## JiggleSubtree 429 ## OptSubtree 16 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 140 # Removing break before 140 # Removing break before 140 # generation 82: best score out of 40: T0191.try1-al8 67.758 cost/residue, 210 clashes 0.247368 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 329 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 142 ## ReduceClash 241 ## OneRotamer 6 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 652 ## JiggleSubtree 447 ## OptSubtree 16 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 140 # Removing break before 140 # Removing break before 140 # generation 83: best score out of 40: T0191.try1-al8 67.758 cost/residue, 210 clashes 0.247368 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 329 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 142 ## ReduceClash 241 ## OneRotamer 6 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 658 ## JiggleSubtree 464 ## OptSubtree 17 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # jumping subtree containing (T0191)R111 jump= -0.978815 0.023757 0.0913022 0.181717 9.80798 -27.8175 19.3444 # generation 84: best score out of 40: T0191.try1-al8 67.7339 cost/residue, 213 clashes 0.236516 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 329 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 142 ## ReduceClash 241 ## OneRotamer 6 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 666 ## JiggleSubtree 480 ## OptSubtree 17 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # generation 85: best score out of 40: T0191.try1-al8 67.7339 cost/residue, 213 clashes 0.236516 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 329 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 142 ## ReduceClash 241 ## OneRotamer 6 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 670 ## JiggleSubtree 500 ## OptSubtree 18 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 140 # generation 86: best score out of 40: T0191.try1-al8 67.7339 cost/residue, 213 clashes 0.236516 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 329 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 142 ## ReduceClash 241 ## OneRotamer 6 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 678 ## JiggleSubtree 516 ## OptSubtree 18 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 141 # Removing break before 141 # generation 87: best score out of 40: T0191.try1-al8 67.7338 cost/residue, 213 clashes 0.236516 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 329 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 142 ## ReduceClash 241 ## OneRotamer 6 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 682 ## JiggleSubtree 536 ## OptSubtree 18 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # generation 88: best score out of 40: T0191.try1-al8 67.7338 cost/residue, 213 clashes 0.236516 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 329 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 142 ## ReduceClash 241 ## OneRotamer 6 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 689 ## JiggleSubtree 553 ## OptSubtree 18 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # generation 89: best score out of 40: T0191.try1-al8 67.7337 cost/residue, 213 clashes 0.236516 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 329 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 142 ## ReduceClash 241 ## OneRotamer 6 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 692 ## JiggleSubtree 572 ## OptSubtree 20 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 141 # Removing break before 141 # Removing break before 141 # generation 90: best score out of 40: T0191.try1-al8 67.6666 cost/residue, 219 clashes 0.232608 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 330 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 142 ## ReduceClash 241 ## OneRotamer 6 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 702 ## JiggleSubtree 584 ## OptSubtree 21 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 141 # generation 91: best score out of 40: T0191.try1-al8 67.6665 cost/residue, 219 clashes 0.232608 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 331 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 143 ## ReduceClash 241 ## OneRotamer 6 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 708 ## JiggleSubtree 599 ## OptSubtree 22 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 141 # Removing break before 141 # generation 92: best score out of 40: T0191.try1-al8 67.6664 cost/residue, 219 clashes 0.232609 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 331 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 143 ## ReduceClash 242 ## OneRotamer 6 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 715 ## JiggleSubtree 614 ## OptSubtree 23 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 141 # Removing break before 141 # Removing break before 141 # generation 93: best score out of 40: T0191.try1-al8 67.6627 cost/residue, 222 clashes 0.232346 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 331 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 143 ## ReduceClash 242 ## OneRotamer 6 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 721 ## JiggleSubtree 632 ## OptSubtree 23 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 141 # jumping subtree containing (T0191)I225 jump= -0.999394 0.0200611 0.0122604 -0.0256859 5.35329 -17.6155 2.34593 # Removing break before 141 # Removing break before 141 # generation 94: best score out of 40: T0191.try1-al8 67.6618 cost/residue, 224 clashes 0.243585 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 332 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 143 ## ReduceClash 243 ## OneRotamer 6 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 724 ## JiggleSubtree 651 ## OptSubtree 23 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 141 # Removing break before 141 # generation 95: best score out of 40: T0191.try1-al8 67.6618 cost/residue, 224 clashes 0.243585 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 332 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 143 ## ReduceClash 243 ## OneRotamer 6 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 731 ## JiggleSubtree 667 ## OptSubtree 24 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # generation 96: best score out of 40: T0191.try1-al8 67.6617 cost/residue, 224 clashes 0.243585 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 332 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 143 ## ReduceClash 243 ## OneRotamer 6 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 732 ## JiggleSubtree 689 ## OptSubtree 26 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 141 # Removing break before 141 # Removing break before 113 # generation 97: best score out of 40: T0191.try1-al8 67.573 cost/residue, 224 clashes 0.239305 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 332 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 143 ## ReduceClash 244 ## OneRotamer 6 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 733 ## JiggleSubtree 710 ## OptSubtree 27 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 141 # Removing break before 141 # generation 98: best score out of 40: T0191.try1-al8 67.5729 cost/residue, 224 clashes 0.239305 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 332 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 143 ## ReduceClash 244 ## OneRotamer 6 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 740 ## JiggleSubtree 726 ## OptSubtree 28 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 141 # generation 99: best score out of 40: T0191.try1-al8 67.5692 cost/residue, 227 clashes 0.239043 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 332 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 143 ## ReduceClash 244 ## OneRotamer 6 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 746 ## JiggleSubtree 750 ## OptSubtree 28 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # generation 100: best score out of 40: T0191.try1-al8 67.5691 cost/residue, 227 clashes 0.239043 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 332 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 143 ## ReduceClash 244 ## OneRotamer 6 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 752 ## JiggleSubtree 767 ## OptSubtree 29 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 113 # Removing break before 113 # Removing break before 63 # generation 101: best score out of 40: T0191.try1-al8 67.54 cost/residue, 224 clashes 0.239305 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 333 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 143 ## ReduceClash 244 ## OneRotamer 6 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 757 ## JiggleSubtree 784 ## OptSubtree 30 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 141 # Removing break before 141 # generation 102: best score out of 40: T0191.try1-al8 67.4822 cost/residue, 227 clashes 0.239043 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 334 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 143 ## ReduceClash 244 ## OneRotamer 6 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 759 ## JiggleSubtree 807 ## OptSubtree 30 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 63 # generation 103: best score out of 40: T0191.try1-al8 67.482 cost/residue, 227 clashes 0.239042 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 334 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 143 ## ReduceClash 244 ## OneRotamer 7 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 764 ## JiggleSubtree 827 ## OptSubtree 30 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 141 # generation 104: best score out of 40: T0191.try1-al8 67.482 cost/residue, 227 clashes 0.239042 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 334 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 143 ## ReduceClash 244 ## OneRotamer 7 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 769 ## JiggleSubtree 851 ## OptSubtree 31 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # generation 105: best score out of 40: T0191.try1-al8 67.4819 cost/residue, 227 clashes 0.239043 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 334 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 143 ## ReduceClash 244 ## OneRotamer 7 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 771 ## JiggleSubtree 872 ## OptSubtree 32 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 141 # generation 106: best score out of 40: T0191.try1-al8 67.4819 cost/residue, 227 clashes 0.239043 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 334 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 143 ## ReduceClash 244 ## OneRotamer 7 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 774 ## JiggleSubtree 893 ## OptSubtree 32 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # generation 107: best score out of 40: T0191.try1-al8 67.4817 cost/residue, 227 clashes 0.239043 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 334 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 143 ## ReduceClash 244 ## OneRotamer 7 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 776 ## JiggleSubtree 915 ## OptSubtree 32 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 63 # generation 108: best score out of 40: T0191.try1-al8 67.4817 cost/residue, 227 clashes 0.239042 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 334 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 143 ## ReduceClash 244 ## OneRotamer 7 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 778 ## JiggleSubtree 937 ## OptSubtree 32 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # generation 109: best score out of 40: T0191.try1-al8 67.4168 cost/residue, 230 clashes 0.239042 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 335 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 143 ## ReduceClash 244 ## OneRotamer 7 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 782 ## JiggleSubtree 954 ## OptSubtree 34 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 141 # Removing break before 63 # Removing break before 141 # generation 110: best score out of 40: T0191.try1-al8 67.4167 cost/residue, 230 clashes 0.239043 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 335 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 143 ## ReduceClash 244 ## OneRotamer 8 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 789 ## JiggleSubtree 969 ## OptSubtree 35 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 141 # generation 111: best score out of 40: T0191.try1-al8 67.4167 cost/residue, 230 clashes 0.239042 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 335 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 143 ## ReduceClash 244 ## OneRotamer 8 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 792 ## JiggleSubtree 995 ## OptSubtree 35 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 141 # generation 112: best score out of 40: T0191.try1-al8 67.4165 cost/residue, 230 clashes 0.239043 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 335 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 143 ## ReduceClash 244 ## OneRotamer 8 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 792 ## JiggleSubtree 1019 ## OptSubtree 35 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 113 # Removing break before 141 # generation 113: best score out of 40: T0191.try1-al8 67.4165 cost/residue, 230 clashes 0.239043 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 335 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 143 ## ReduceClash 244 ## OneRotamer 8 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 798 ## JiggleSubtree 1037 ## OptSubtree 35 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 141 # jumping subtree containing (T0191)D187 jump= -0.981992 0.0641021 0.177263 0.0126653 2.63827 -7.2402 23.9828 # generation 114: best score out of 40: T0191.try1-al8 67.4164 cost/residue, 230 clashes 0.239043 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 335 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 143 ## ReduceClash 244 ## OneRotamer 8 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 803 ## JiggleSubtree 1053 ## OptSubtree 38 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 113 # Removing break before 141 # generation 115: best score out of 40: T0191.try1-al8 67.4164 cost/residue, 230 clashes 0.239043 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 335 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 143 ## ReduceClash 244 ## OneRotamer 8 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 804 ## JiggleSubtree 1076 ## OptSubtree 38 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # generation 116: best score out of 40: T0191.try1-al8 67.4164 cost/residue, 230 clashes 0.239043 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 335 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 143 ## ReduceClash 244 ## OneRotamer 8 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 811 ## JiggleSubtree 1093 ## OptSubtree 38 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 141 # Removing break before 63 # Removing break before 141 # generation 117: best score out of 40: T0191.try1-al8 67.4163 cost/residue, 230 clashes 0.239043 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 335 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 143 ## ReduceClash 244 ## OneRotamer 8 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 814 ## JiggleSubtree 1114 ## OptSubtree 38 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 63 # generation 118: best score out of 40: T0191.try1-al8 67.4163 cost/residue, 230 clashes 0.239043 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 335 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 143 ## ReduceClash 244 ## OneRotamer 8 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 817 ## JiggleSubtree 1135 ## OptSubtree 38 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 141 # jumping subtree containing (T0191)R111 jump= 0.934907 0.307182 -0.0769358 0.160216 -31.8162 82.1375 100.322 # generation 119: best score out of 40: T0191.try1-al8 67.4163 cost/residue, 230 clashes 0.239043 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 335 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 143 ## ReduceClash 244 ## OneRotamer 8 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 825 ## JiggleSubtree 1151 ## OptSubtree 38 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 141 # jumping subtree containing (T0191)A242 jump= 0.508913 0.144304 0.179411 0.829455 -258.3 -103.168 55.8559 # jumping subtree containing (T0191)R111 jump= 0.738029 -0.576498 -0.20608 -0.283714 2.17875 -138.369 80.9712 # generation 120: best score out of 40: T0191.try1-al8 67.4161 cost/residue, 230 clashes 0.239043 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 335 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 143 ## ReduceClash 244 ## OneRotamer 8 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 829 ## JiggleSubtree 1171 ## OptSubtree 38 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 141 # Removing break before 113 # generation 121: best score out of 40: T0191.try1-al8 67.4161 cost/residue, 230 clashes 0.239043 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 335 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 143 ## ReduceClash 244 ## OneRotamer 8 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 833 ## JiggleSubtree 1191 ## OptSubtree 38 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 63 # generation 122: best score out of 40: T0191.try1-al8 67.4161 cost/residue, 230 clashes 0.239043 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 335 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 143 ## ReduceClash 244 ## OneRotamer 8 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 837 ## JiggleSubtree 1209 ## OptSubtree 40 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 113 # generation 123: best score out of 40: T0191.try1-al8 67.4161 cost/residue, 230 clashes 0.239043 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 335 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 143 ## ReduceClash 244 ## OneRotamer 8 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 841 ## JiggleSubtree 1228 ## OptSubtree 41 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 141 # generation 124: best score out of 40: T0191.try1-al8 67.4161 cost/residue, 230 clashes 0.239043 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 335 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 143 ## ReduceClash 244 ## OneRotamer 8 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 847 ## JiggleSubtree 1246 ## OptSubtree 41 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 63 # generation 125: best score out of 40: T0191.try1-al8 67.416 cost/residue, 230 clashes 0.239043 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 335 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 143 ## ReduceClash 244 ## OneRotamer 9 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 851 ## JiggleSubtree 1264 ## OptSubtree 42 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 141 # Removing break before 63 # Removing break before 141 # generation 126: best score out of 40: T0191.try1-al8 67.416 cost/residue, 230 clashes 0.239043 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 335 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 143 ## ReduceClash 244 ## OneRotamer 9 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 858 ## JiggleSubtree 1279 ## OptSubtree 44 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 141 # generation 127: best score out of 40: T0191.try1-al8 67.416 cost/residue, 230 clashes 0.239043 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 335 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 143 ## ReduceClash 244 ## OneRotamer 9 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 863 ## JiggleSubtree 1296 ## OptSubtree 46 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 141 # Removing break before 113 # Removing break before 141 # Removing break before 141 # generation 128: best score out of 40: T0191.try1-al8 67.416 cost/residue, 230 clashes 0.239043 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 335 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 143 ## ReduceClash 244 ## OneRotamer 9 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 872 ## JiggleSubtree 1310 ## OptSubtree 47 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 63 # generation 129: best score out of 40: T0191.try1-al8 67.416 cost/residue, 230 clashes 0.239043 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 335 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 143 ## ReduceClash 244 ## OneRotamer 9 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 884 ## JiggleSubtree 1320 ## OptSubtree 49 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # generation 130: best score out of 40: T0191.try1-al8 67.416 cost/residue, 230 clashes 0.239043 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 335 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 143 ## ReduceClash 244 ## OneRotamer 9 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 889 ## JiggleSubtree 1337 ## OptSubtree 51 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 141 # generation 131: best score out of 40: T0191.try1-al8 67.416 cost/residue, 230 clashes 0.239043 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 335 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 143 ## ReduceClash 244 ## OneRotamer 9 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 895 ## JiggleSubtree 1353 ## OptSubtree 53 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 63 # Removing break before 63 # generation 132: best score out of 40: T0191.try1-al8 67.416 cost/residue, 230 clashes 0.239043 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 335 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 143 ## ReduceClash 244 ## OneRotamer 9 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 900 ## JiggleSubtree 1370 ## OptSubtree 55 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # jumping subtree containing (T0191)K214 jump= 0.982575 -0.00947691 -0.181347 0.0396199 25.0773 -1.23565 35.3954 # Removing break before 113 # Removing break before 141 # generation 133: best score out of 40: T0191.try1-al8 67.416 cost/residue, 230 clashes 0.239043 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 335 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 143 ## ReduceClash 244 ## OneRotamer 9 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 910 ## JiggleSubtree 1384 ## OptSubtree 55 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 141 # Removing break before 113 # Removing break before 141 # Removing break before 141 # Removing break before 141 # generation 134: best score out of 40: T0191.try1-al8 67.416 cost/residue, 230 clashes 0.239043 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 335 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 143 ## ReduceClash 244 ## OneRotamer 9 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 919 ## JiggleSubtree 1399 ## OptSubtree 55 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 113 # Removing break before 141 # jumping subtree containing (T0191)R111 jump= -0.256564 -0.479782 -0.699426 -0.463452 -181.907 -113.687 331.629 # Removing break before 141 # generation 135: best score out of 40: T0191.try1-al8 67.416 cost/residue, 230 clashes 0.239043 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 335 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 143 ## ReduceClash 244 ## OneRotamer 9 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 926 ## JiggleSubtree 1416 ## OptSubtree 55 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # generation 136: best score out of 40: T0191.try1-al8 67.3582 cost/residue, 230 clashes 0.239043 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 335 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 145 ## ReduceClash 244 ## OneRotamer 9 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 936 ## JiggleSubtree 1427 ## OptSubtree 56 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 141 # generation 137: best score out of 40: T0191.try1-al8 67.3337 cost/residue, 230 clashes 0.239043 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 335 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 146 ## ReduceClash 244 ## OneRotamer 9 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 941 ## JiggleSubtree 1445 ## OptSubtree 56 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 113 # Removing break before 141 # jumping subtree containing (T0191)A143 jump= -0.690523 0.0203285 -0.489286 0.53232 -103.322 -102.015 -81.2133 # Removing break before 141 # Removing break before 141 # generation 138: best score out of 40: T0191.try1-al8 67.3336 cost/residue, 230 clashes 0.239043 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 335 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 146 ## ReduceClash 244 ## OneRotamer 9 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 944 ## JiggleSubtree 1471 ## OptSubtree 59 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 141 # Removing break before 141 # generation 139: best score out of 40: T0191.try1-al8 67.3336 cost/residue, 230 clashes 0.239043 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 335 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 146 ## ReduceClash 244 ## OneRotamer 9 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 947 ## JiggleSubtree 1497 ## OptSubtree 60 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # jumping subtree containing (T0191)L248 jump= -0.75195 0.215275 0.418259 0.46183 78.5149 -207.152 135.465 # Removing break before 141 # Removing break before 63 # Removing break before 141 # Removing break before 141 # Removing break before 141 # generation 140: best score out of 40: T0191.try1-al8 67.3335 cost/residue, 230 clashes 0.239043 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 335 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 146 ## ReduceClash 244 ## OneRotamer 9 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 952 ## JiggleSubtree 1515 ## OptSubtree 61 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 141 # Removing break before 141 # generation 141: best score out of 40: T0191.try1-al8 67.3335 cost/residue, 230 clashes 0.239043 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 335 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 146 ## ReduceClash 244 ## OneRotamer 9 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 956 ## JiggleSubtree 1534 ## OptSubtree 62 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 113 # Removing break before 63 # generation 142: best score out of 40: T0191.try1-al8 67.3335 cost/residue, 230 clashes 0.239043 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 335 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 146 ## ReduceClash 244 ## OneRotamer 9 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 960 ## JiggleSubtree 1552 ## OptSubtree 64 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 141 # generation 143: best score out of 40: T0191.try1-al8 67.3335 cost/residue, 230 clashes 0.239043 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 335 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 146 ## ReduceClash 244 ## OneRotamer 9 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 965 ## JiggleSubtree 1571 ## OptSubtree 64 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 63 # generation 144: best score out of 40: T0191.try1-al8 67.3335 cost/residue, 230 clashes 0.239043 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 335 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 146 ## ReduceClash 244 ## OneRotamer 9 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 967 ## JiggleSubtree 1592 ## OptSubtree 65 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 141 # Removing break before 141 # generation 145: best score out of 40: T0191.try1-al8 67.3335 cost/residue, 230 clashes 0.239043 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 335 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 146 ## ReduceClash 244 ## OneRotamer 9 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 969 ## JiggleSubtree 1613 ## OptSubtree 66 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 141 # generation 146: best score out of 40: T0191.try1-al8 67.3313 cost/residue, 230 clashes 0.238088 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 336 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 146 ## ReduceClash 244 ## OneRotamer 9 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 975 ## JiggleSubtree 1630 ## OptSubtree 66 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 63 # generation 147: best score out of 40: T0191.try1-al8 67.3311 cost/residue, 230 clashes 0.238089 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 336 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 146 ## ReduceClash 244 ## OneRotamer 9 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 979 ## JiggleSubtree 1650 ## OptSubtree 66 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # generation 148: best score out of 40: T0191.try1-al8 67.3311 cost/residue, 230 clashes 0.238089 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 336 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 146 ## ReduceClash 244 ## OneRotamer 9 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 981 ## JiggleSubtree 1679 ## OptSubtree 67 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # jumping subtree containing (T0191)R111 jump= -0.648724 -0.332232 -0.301664 -0.614637 -302.733 -16.4756 143.344 # jumping subtree containing (T0191)I193 jump= 0.599143 0.512987 0.611308 0.0646107 -108.846 55.823 189.303 # Removing break before 63 # generation 149: best score out of 40: T0191.try1-al8 67.331 cost/residue, 230 clashes 0.238088 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 336 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 146 ## ReduceClash 244 ## OneRotamer 9 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 986 ## JiggleSubtree 1699 ## OptSubtree 68 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 141 # Removing break before 113 # generation 150: best score out of 40: T0191.try1-al8 67.331 cost/residue, 230 clashes 0.238088 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 336 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 146 ## ReduceClash 244 ## OneRotamer 9 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 992 ## JiggleSubtree 1717 ## OptSubtree 68 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 141 # Removing break before 63 # generation 151: best score out of 40: T0191.try1-al8 67.331 cost/residue, 230 clashes 0.238088 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 336 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 146 ## ReduceClash 244 ## OneRotamer 9 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 997 ## JiggleSubtree 1736 ## OptSubtree 68 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 63 # generation 152: best score out of 40: T0191.try1-al8 67.331 cost/residue, 230 clashes 0.238088 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 336 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 146 ## ReduceClash 244 ## OneRotamer 9 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 1003 ## JiggleSubtree 1753 ## OptSubtree 69 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 63 # generation 153: best score out of 40: T0191.try1-al8 67.331 cost/residue, 230 clashes 0.238088 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 336 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 146 ## ReduceClash 244 ## OneRotamer 9 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 1010 ## JiggleSubtree 1770 ## OptSubtree 69 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 63 # Removing break before 141 # Removing break before 63 # Removing break before 141 # generation 154: best score out of 40: T0191.try1-al8 67.331 cost/residue, 230 clashes 0.238088 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 336 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 146 ## ReduceClash 244 ## OneRotamer 9 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 1017 ## JiggleSubtree 1785 ## OptSubtree 71 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 141 # generation 155: best score out of 40: T0191.try1-al8 67.3308 cost/residue, 230 clashes 0.238088 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 336 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 146 ## ReduceClash 244 ## OneRotamer 9 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 1019 ## JiggleSubtree 1806 ## OptSubtree 72 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # jumping subtree containing (T0191)L248 jump= 0.62569 0.636142 -0.425524 -0.150879 32.0799 -100.183 291.938 # Removing break before 141 # generation 156: best score out of 40: T0191.try1-al8 67.3308 cost/residue, 230 clashes 0.238088 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 336 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 146 ## ReduceClash 244 ## OneRotamer 9 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 1023 ## JiggleSubtree 1826 ## OptSubtree 72 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 141 # generation 157: best score out of 40: T0191.try1-al8 67.3308 cost/residue, 230 clashes 0.238088 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 336 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 146 ## ReduceClash 244 ## OneRotamer 9 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 1031 ## JiggleSubtree 1842 ## OptSubtree 72 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 63 # Removing break before 141 # generation 158: best score out of 40: T0191.try1-al8 67.3308 cost/residue, 230 clashes 0.238088 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 336 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 146 ## ReduceClash 244 ## OneRotamer 9 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 1040 ## JiggleSubtree 1857 ## OptSubtree 72 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 63 # generation 159: best score out of 40: T0191.try1-al8 67.3306 cost/residue, 230 clashes 0.238088 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 336 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 146 ## ReduceClash 244 ## OneRotamer 9 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 1046 ## JiggleSubtree 1875 ## OptSubtree 72 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # jumping subtree containing (T0191)N146 jump= 0.948892 -0.0660262 0.303279 -0.0571479 -91.541 -23.1333 -63.3957 # Removing break before 63 # generation 160: best score out of 40: T0191.try1-al8 67.3306 cost/residue, 230 clashes 0.238088 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 336 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 146 ## ReduceClash 244 ## OneRotamer 9 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 1050 ## JiggleSubtree 1894 ## OptSubtree 73 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 63 # generation 161: best score out of 40: T0191.try1-al8 67.3306 cost/residue, 230 clashes 0.238088 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 336 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 146 ## ReduceClash 244 ## OneRotamer 9 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 1059 ## JiggleSubtree 1909 ## OptSubtree 73 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # jumping subtree containing (T0191)N227 jump= -0.0275248 0.755121 0.20583 -0.621827 73.267 -224.555 26.4276 # Removing break before 141 # Removing break before 141 # Removing break before 63 # generation 162: best score out of 40: T0191.try1-al8 67.3306 cost/residue, 230 clashes 0.238088 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 336 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 146 ## ReduceClash 244 ## OneRotamer 9 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 1067 ## JiggleSubtree 1925 ## OptSubtree 73 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 63 # Removing break before 63 # jumping subtree containing (T0191)I193 jump= -0.792525 0.391238 0.460101 0.0845179 144.974 -157.015 105.773 # generation 163: best score out of 40: T0191.try1-al8 67.3306 cost/residue, 230 clashes 0.238088 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 336 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 146 ## ReduceClash 244 ## OneRotamer 9 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 1079 ## JiggleSubtree 1936 ## OptSubtree 74 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 141 # jumping subtree containing (T0191)E164 jump= -0.215707 -0.00695207 -0.963982 -0.155439 -316.348 -53.7199 295.595 # Removing break before 113 # generation 164: best score out of 40: T0191.try1-al8 67.3306 cost/residue, 230 clashes 0.238088 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 336 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 146 ## ReduceClash 244 ## OneRotamer 9 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 1088 ## JiggleSubtree 1951 ## OptSubtree 74 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # generation 165: best score out of 40: T0191.try1-al8 67.3074 cost/residue, 225 clashes 0.238088 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 336 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 146 ## ReduceClash 244 ## OneRotamer 11 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 1096 ## JiggleSubtree 1964 ## OptSubtree 75 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 141 # Removing break before 63 # generation 166: best score out of 40: T0191.try1-al8 67.3074 cost/residue, 225 clashes 0.238088 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 337 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 146 ## ReduceClash 244 ## OneRotamer 11 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 1102 ## JiggleSubtree 1981 ## OptSubtree 75 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # generation 167: best score out of 40: T0191.try1-al8 67.3074 cost/residue, 225 clashes 0.238088 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 337 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 146 ## ReduceClash 244 ## OneRotamer 11 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 1108 ## JiggleSubtree 2009 ## OptSubtree 75 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 141 # Removing break before 141 # Removing break before 63 # generation 168: best score out of 40: T0191.try1-al8 67.3074 cost/residue, 225 clashes 0.238088 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 337 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 146 ## ReduceClash 244 ## OneRotamer 11 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 1115 ## JiggleSubtree 2026 ## OptSubtree 75 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # jumping subtree containing (T0191)L248 jump= 0.696311 -0.122112 -0.702696 0.0803607 31.2865 47.5932 217.706 # generation 169: best score out of 40: T0191.try1-al8 67.3073 cost/residue, 225 clashes 0.238088 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 337 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 146 ## ReduceClash 244 ## OneRotamer 11 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 1122 ## JiggleSubtree 2043 ## OptSubtree 75 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 141 # generation 170: best score out of 40: T0191.try1-al8 67.3071 cost/residue, 225 clashes 0.238087 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 337 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 146 ## ReduceClash 244 ## OneRotamer 12 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 1129 ## JiggleSubtree 2057 ## OptSubtree 77 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 63 # Removing break before 141 # jumping subtree containing (T0191)N227 jump= -0.0610061 0.123747 0.446284 -0.884192 -251.505 -163.623 -130.928 # Removing break before 113 # generation 171: best score out of 40: T0191.try1-al8 67.3071 cost/residue, 225 clashes 0.238087 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 337 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 146 ## ReduceClash 244 ## OneRotamer 12 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 1135 ## JiggleSubtree 2074 ## OptSubtree 78 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 141 # Removing break before 63 # jumping subtree containing (T0191)R111 jump= -0.867224 -0.140052 -0.0779126 -0.47142 -259.983 23.185 76.3727 # generation 172: best score out of 40: T0191.try1-al8 67.3071 cost/residue, 225 clashes 0.238087 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 337 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 146 ## ReduceClash 244 ## OneRotamer 12 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 1149 ## JiggleSubtree 2084 ## OptSubtree 78 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 141 # generation 173: best score out of 40: T0191.try1-al8 67.3071 cost/residue, 225 clashes 0.238087 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 337 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 146 ## ReduceClash 244 ## OneRotamer 12 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 1158 ## JiggleSubtree 2099 ## OptSubtree 78 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 141 # Removing break before 113 # Removing break before 63 # generation 174: best score out of 40: T0191.try1-al8 67.284 cost/residue, 224 clashes 0.238088 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 337 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 147 ## ReduceClash 244 ## OneRotamer 12 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 1167 ## JiggleSubtree 2113 ## OptSubtree 78 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 141 # jumping subtree containing (T0191)N227 jump= -0.0371153 0.186232 0.812679 -0.550901 -159.876 59.3788 21.487 # generation 175: best score out of 40: T0191.try1-al8 67.2832 cost/residue, 224 clashes 0.238088 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 337 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 147 ## ReduceClash 244 ## OneRotamer 12 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 1177 ## JiggleSubtree 2127 ## OptSubtree 78 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # jumping subtree containing (T0191)N146 jump= -0.0422175 -0.313316 -0.827656 0.463719 -100.372 78.1169 44.6599 # Removing break before 141 # generation 176: best score out of 40: T0191.try1-al8 67.2832 cost/residue, 224 clashes 0.238087 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 337 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 147 ## ReduceClash 244 ## OneRotamer 12 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 1179 ## JiggleSubtree 2157 ## OptSubtree 79 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # jumping subtree containing (T0191)N227 jump= 0.254565 0.55682 0.770107 0.179119 -130.502 27.3062 364.759 # Removing break before 141 # generation 177: best score out of 40: T0191.try1-al8 67.2824 cost/residue, 224 clashes 0.238088 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 337 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 147 ## ReduceClash 244 ## OneRotamer 12 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 1182 ## JiggleSubtree 2181 ## OptSubtree 79 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # generation 178: best score out of 40: T0191.try1-al8 67.2824 cost/residue, 224 clashes 0.238088 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 337 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 147 ## ReduceClash 244 ## OneRotamer 12 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 1189 ## JiggleSubtree 2197 ## OptSubtree 80 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 141 # jumping subtree containing (T0191)N146 jump= -0.0653819 0.949163 0.0675829 -0.300411 70.4817 -378.678 161.599 # Removing break before 141 # generation 179: best score out of 40: T0191.try1-al8 67.2824 cost/residue, 224 clashes 0.238088 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 337 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 147 ## ReduceClash 244 ## OneRotamer 12 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 1202 ## JiggleSubtree 2207 ## OptSubtree 81 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 63 # generation 180: best score out of 40: T0191.try1-al8 67.2679 cost/residue, 224 clashes 0.239076 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 338 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 147 ## ReduceClash 245 ## OneRotamer 12 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 1210 ## JiggleSubtree 2221 ## OptSubtree 81 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 141 # Removing break before 63 # Removing break before 141 # generation 181: best score out of 40: T0191.try1-al8 67.2678 cost/residue, 224 clashes 0.239076 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 338 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 147 ## ReduceClash 245 ## OneRotamer 12 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 1217 ## JiggleSubtree 2238 ## OptSubtree 81 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 63 # Removing break before 141 # Removing break before 141 # Removing break before 141 # Removing break before 141 # generation 182: best score out of 40: T0191.try1-al8 67.2671 cost/residue, 224 clashes 0.239075 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 338 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 147 ## ReduceClash 245 ## OneRotamer 12 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 1221 ## JiggleSubtree 2266 ## OptSubtree 82 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # generation 183: best score out of 40: T0191.try1-al8 67.2671 cost/residue, 224 clashes 0.239076 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 338 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 147 ## ReduceClash 245 ## OneRotamer 12 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 1225 ## JiggleSubtree 2285 ## OptSubtree 83 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 141 # Removing break before 141 # Removing break before 141 # Removing break before 63 # generation 184: best score out of 40: T0191.try1-al8 67.2163 cost/residue, 217 clashes 0.239076 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 338 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 147 ## ReduceClash 245 ## OneRotamer 14 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 1232 ## JiggleSubtree 2300 ## OptSubtree 83 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 141 # Removing break before 63 # generation 185: best score out of 40: T0191.try1-al8 67.2163 cost/residue, 217 clashes 0.239076 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 338 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 147 ## ReduceClash 245 ## OneRotamer 14 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 1241 ## JiggleSubtree 2315 ## OptSubtree 83 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # generation 186: best score out of 40: T0191.try1-al8 67.2163 cost/residue, 217 clashes 0.239076 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 338 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 147 ## ReduceClash 245 ## OneRotamer 14 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 1245 ## JiggleSubtree 2346 ## OptSubtree 83 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 141 # Removing break before 141 # Removing break before 63 # generation 187: best score out of 40: T0191.try1-al8 67.2163 cost/residue, 217 clashes 0.239076 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 338 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 147 ## ReduceClash 245 ## OneRotamer 14 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 1248 ## JiggleSubtree 2367 ## OptSubtree 83 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 141 # jumping subtree containing (T0191)R111 jump= -0.431492 0.785733 -0.0837857 -0.435222 -65.007 -401.85 -18.3459 # Removing break before 141 # generation 188: best score out of 40: T0191.try1-al8 67.2148 cost/residue, 217 clashes 0.239076 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 338 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 147 ## ReduceClash 245 ## OneRotamer 15 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 1260 ## JiggleSubtree 2377 ## OptSubtree 84 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 141 # Removing break before 63 # generation 189: best score out of 40: T0191.try1-al8 67.2148 cost/residue, 217 clashes 0.239076 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 338 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 147 ## ReduceClash 245 ## OneRotamer 15 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 1272 ## JiggleSubtree 2389 ## OptSubtree 84 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 141 # Removing break before 141 # generation 190: best score out of 40: T0191.try1-al8 67.2148 cost/residue, 217 clashes 0.239076 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 338 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 147 ## ReduceClash 245 ## OneRotamer 15 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 1277 ## JiggleSubtree 2407 ## OptSubtree 85 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 113 # generation 191: best score out of 40: T0191.try1-al8 67.2148 cost/residue, 217 clashes 0.239076 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 338 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 147 ## ReduceClash 245 ## OneRotamer 15 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 1284 ## JiggleSubtree 2423 ## OptSubtree 86 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 141 # generation 192: best score out of 40: T0191.try1-al8 67.2148 cost/residue, 217 clashes 0.239075 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 338 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 147 ## ReduceClash 245 ## OneRotamer 15 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 1294 ## JiggleSubtree 2437 ## OptSubtree 86 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # generation 193: best score out of 40: T0191.try1-al8 67.2142 cost/residue, 217 clashes 0.239076 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 338 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 147 ## ReduceClash 245 ## OneRotamer 15 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 1303 ## JiggleSubtree 2452 ## OptSubtree 86 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # generation 194: best score out of 40: T0191.try1-al8 67.2142 cost/residue, 217 clashes 0.239076 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 338 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 147 ## ReduceClash 245 ## OneRotamer 15 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 1311 ## JiggleSubtree 2468 ## OptSubtree 86 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 141 # Removing break before 141 # Removing break before 141 # generation 195: best score out of 40: T0191.try1-al8 67.2142 cost/residue, 217 clashes 0.239076 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 338 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 147 ## ReduceClash 245 ## OneRotamer 15 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 1322 ## JiggleSubtree 2480 ## OptSubtree 87 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 141 # Removing break before 113 # Removing break before 141 # generation 196: best score out of 40: T0191.try1-al8 67.2142 cost/residue, 217 clashes 0.239076 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 338 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 147 ## ReduceClash 245 ## OneRotamer 15 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 1335 ## JiggleSubtree 2491 ## OptSubtree 87 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # generation 197: best score out of 40: T0191.try1-al8 67.2142 cost/residue, 217 clashes 0.239076 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 338 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 147 ## ReduceClash 245 ## OneRotamer 15 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 1345 ## JiggleSubtree 2505 ## OptSubtree 87 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 113 # Removing break before 113 # generation 198: best score out of 40: T0191.try1-al8 67.2142 cost/residue, 217 clashes 0.239076 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 338 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 147 ## ReduceClash 245 ## OneRotamer 15 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 1352 ## JiggleSubtree 2521 ## OptSubtree 88 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # generation 199: best score out of 40: T0191.try1-al8 67.2134 cost/residue, 217 clashes 0.239075 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 338 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 147 ## ReduceClash 245 ## OneRotamer 15 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 1365 ## JiggleSubtree 2531 ## OptSubtree 89 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # Removing break before 141 # generation 200: best score out of 40: T0191.try1-al8 67.2134 cost/residue, 217 clashes 0.239075 breaks # Cumulative usage by method: ## InsertAlignment 0 ## InsertSpecificFragment 77 ## InsertFragment 338 ## TwoFragment 59 ## CrossOver 0 ## CrossAndInsert 147 ## ReduceClash 245 ## OneRotamer 15 ## ClashingRotamer 3 ## ReduceBreak 0 ## CloseGap 1374 ## JiggleSubtree 2545 ## OptSubtree 90 ## ReduceConstraint 0 ## InsertSSBond 0 ## ImproveSSBond 0 # command:# naming current conformation T0191.try1-opt # command:# command:# request to SCWRL produces command: scwrl -i /projects/compbio/tmp/to_scwrl_1031980791.pdb -s /projects/compbio/tmp/to_scwrl_1031980791.seq -o /projects/compbio/tmp/from_scwrl_1031980791.pdb -a /projects/compbio/tmp/from_scwrl_1031980791_a.pdb -b /projects/compbio/tmp/from_scwrl_1031980791_b.pdb > /projects/compbio/tmp/scwrl_1031980791.log # conformation set from SCWRL output # command:# naming current conformation T0191.try1-opt-scwrl # command:# command:# CostConform T0191.try1-opt-scwrl costs 68.9468 T0191.try1-opt costs 67.2166 T0191.try1 costs 69.6655 T0191.try1-al10 costs 69.6655 T0191.try1-al10 costs 69.6655 T0191.try1-al8 costs 69.6655 T0191.try1-al8 costs 69.6655 T0191.try1-al6 costs 69.6655 T0191.try1-al6 costs 69.6655 T0191.try1-al4 costs 69.6655 T0191.try1-al4 costs 69.6655 T0191.try1-al2 costs 69.6655 T0191.try1-al2 costs 69.6655 T0191.try1-start costs 69.6655 T0191.try1-start costs 69.6655 T0191.rand costs 114.365 # command:CPU_time= 1.44726e+06 msec, elapsed time= 5.77833e+06 msec) # command: