CASP5 Target T0191
-
1. Protein Name
- Shikimate 5-dehydrogenase
-
2. Organism Name
- Methanococcus jannaschii
-
3. Number of amino acids (approx)
- 282
-
4. Accession number
- Q58484
-
5. Sequence Database
- Swiss-prot
-
6. Amino acid sequence
-
MINAKTKVIGLIGHPVEHSFSPIMHNAAFKDKGLNYVYVAFDVLPENLKYVIDGAKALGI
VGFNVTIPHKIEIMKYLDEIDKDAQLIGAVNTIKIEDGKAIGYNTDGIGARMALEEEIGR
VKDKNIVIYGAGGAARAVAFELAKDNNIIIANRTVEKAEALAKEIAEKLNKKFGEEVKFS
GLDVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLREDMVVMDLIYNPLETVLLKEAKKV
NAKTINGLGMLIYQGAVAFKIWTGVEPNIEVMKNAIIDKITK
-
7. Additional Information
- 28 % ID to 1GPJ (43/151 residues).
Single domain or a compact two domain structure.
pH of crystallization 7.1
NADP cofactor
-
8. X-ray structure
- yes
-
9. Current state of the experimental work
- 99% of the model is traced and built;
refinement is in progress.
-
10. Interpretable map?
- yes
-
11. Estimated date of chain tracing completion
- August 2002
-
12. Estimated date of public release of structure
- CASP Evaluation
-
13. Name
- unavailable until after public release of structure
Related Files
Template Sequence file
Template PDB file