CASP5 Target T0190

1. Protein Name: Transthyretin-related protein
2. Organism Name: E. coli
3. Number of amino acids (approx): 114
4. Accession number: p76341
5. Sequence Database: Swiss-prot
6. Amino acid sequence: AQQNILSVHILNQQTGKPAADVTVTLEKKADNGWLQLNTAKTDKDGRIKALWPEQTATTG
DYRVVFKTGDYFKKQNLESFFPEIPVEFHINKVNEHYHVPLLLSQYGYSTYRGS
7. Additional Information: The protein is tetrameric. The function is unknown. It probably functions as a transport protein but we don't know for what ligand.
8. X-ray structure: yes
9. Current state of the experimental work: We have solved the structure at 1.65 Å resolution using molecular replacement. The current R factor/ Rfree is 24%/29%. We see good electron density for most amino acids.
We do not expect to go public in 2-3 months.
10. Interpretable map?: yes
11. Estimated date of chain tracing completion: Done
12. Estimated date of public release of structure: 1 November, maybe later...
13. Name: unavailable until after public release of structure