CASP5 Target T0188
-
1. Protein Name
- TM1816
-
2. Organism Name
- Thermotoga maritima
-
3. Number of amino acids (approx)
- 124
-
4. Accession number
-
5. Sequence Database
- T. maritima genomic database
-
6. Amino acid sequence
-
MIIAIPVSENRGKDSPISEHFGRAPYFAFVKVKNNAIADISVEENPLAQDHVHGAVPNFV
KEKGAELVIVRGIGRRAIAAFEAMGVKVIKGASGTVEEVVNQYLSGQLKDSDYEVHDHHH
HEHH
-
7. Additional Information
- Joint Center for Structural Genomics target TM1816
follow links at www.jcsg.org
-
8. X-ray structure
- yes
-
9. Current state of the experimental work
- refinement in progress
-
10. Interpretable map?
- yes
-
11. Estimated date of chain tracing completion
- completed
-
12. Estimated date of public release of structure
- mid September
-
13. Name
- unavailable until after public release of structure
Related Files
Template Sequence file
Template PDB file