(c) 1992-2000 Regents of the University of California, Santa Cruz
Sequence Alignment and Modeling Software System
http://www.cse.ucsc.edu/research/compbio/sam.html
Citations (SAM, SAM-T99, HMMs)
- R. Hughey, A. Krogh, Hidden Markov models for sequence analysis: Extension and analysis of the basic method, CABIOS 12:95-107, 1996.
- K. Karplus, C. Barrett, R. Hughey, Hidden Markov models for detecting remote protein homologies, Bioinformatics 14(10):846-856, 1998.
- A. Krogh et al., Hidden Markov models in computational biology: Applications to protein modeling, JMB 235:1501-1531, Feb 1994.
Sequence numbers correspond to the following labels:
-
- T0185 TM0231, T. maritima
-
- gi|15643003|ref|NP_228045.1|_351:400 (NC_000853) UDP-N-acetylmuramate--alanine ligase [Thermotoga maritima]
- gi|6919931sp|Q9WY73|MURC_THEMA UDP-N-acetylmuramate--alanine ligase (UDP-N-acetylmuramoyl-L-alanine synthetase)
- gi|7437954|pir||A72402 UDP-N-acetylmuramate--alanine ligase - Thermotoga maritima (strain MSB8)
- gi|4980729|gb|AAD35322.1|AE001707_9 (AE001707) UDP-N-acetylmuramate--alanine ligase [Thermotoga maritima]
10 20 30 40 50
| | | | |
1 SRLEREDGNFAKALQLADEVVVTEVYDAFEEKKNGISGKMIWDSLKSLGK
2 SRLEREDGNFAKALQLADEVVVTEVYDAFEEKKNGISGKMIWDSLKSLGK