(c) 1992-2000 Regents of the University of California, Santa Cruz
Sequence Alignment and Modeling Software System
http://www.cse.ucsc.edu/research/compbio/sam.html
Citations (SAM, SAM-T99, HMMs)
- R. Hughey, A. Krogh, Hidden Markov models for sequence analysis: Extension and analysis of the basic method, CABIOS 12:95-107, 1996.
- K. Karplus, C. Barrett, R. Hughey, Hidden Markov models for detecting remote protein homologies, Bioinformatics 14(10):846-856, 1998.
- A. Krogh et al., Hidden Markov models in computational biology: Applications to protein modeling, JMB 235:1501-1531, Feb 1994.
Sequence numbers correspond to the following labels:
-
- T0180 Hypothetical protein MTH467, M. thermoautotrophicum
-
- gi|15678495|ref|NP_275610.1|_1:53 (NC_000916) unknown [Methanothermobacter thermautotrophicus] [Methanothermobacter thermautotrophicus str. Delta H]
- gi|7482575|pir||B69161 hypothetical protein MTH467 - Methanobacterium thermoautotrophicum (strain Delta H)
- gi|2621536|gb|AAB84973.1| (AE000831) unknown [Methanothermobacter thermautotrophicus str. Delta H]
10 20 30 40 50
| | | | |
1 MVGRRPGGGLKDTKPVVVRLYPDEIEALKSRVPANTSMSAYIRRIILNHLEDD
2 MVGRRPGGGLKDTKPVVVRLYPDEIEALKSRVPANTSMSAYIRRIILNHLEDD