CASP5 Target T0180

1. Protein Name: Hypothetical protein MTH467
2. Organism Name: Methanobacterium thermoautotrophicum
3. Number of amino acids (approx): 53
4. Accession number: O26567
5. Sequence Database: Swiss-prot
6. Amino acid sequence: MVGRRPGGGLKDTKPVVVRLYPDEIEALKSRVPANTSMSAYIRRIILNHLEDD
7. Additional Information: Northeast Structural Genomics Consortium target TR5; forms a dimer
8. X-ray structure: no
9. Current state of the experimental work: Determination of structure is excpected to be completed
by the end of September, 2002
10. Interpretable map?: yes
11. Estimated date of chain tracing completion: Done
12. Estimated date of public release of structure: October 1, 2002
13. Name: unavailable until after public release of structure