CASP5 Target T0179
-
1. Protein Name
- Spermidine synthase homolog
-
2. Organism Name
- Bacillus subtilis
-
3. Number of amino acids (approx)
- 276
-
4. Accession number
- P70998
-
5. Sequence Database
- Swiss-prot
-
6. Amino acid sequence
-
MSELWYTEKQTKNFGITMKVNKTLHTEQTEFQHLEMVETEEFGNMLFLDGMVMTSEKDEF
VYHEMVAHVPLFTHPNPEHVLVVGGGDGGVIREILKHPSVKKATLVDIDGKVIEYSKKFL
PSIAGKLDDPRVDVQVDDGFMHIAKSENQYDVIMVDSTEPVGPAVNLFTKGFYAGIAKAL
KEDGIFVAQTDNPWFTPELITNVQRDVKEIFPITKLYTANIPTYPSGLWTFTIGSKKYDP
LAVEDSRFFDIETKYYTKDIHKAAFVLPKFVSDLIK
-
7. Additional Information
-
Northeast Structural Genomics Consortium target SR2
-
8. X-ray structure
- yes
-
9. Current state of the experimental work
-
Determination of structure is excpected to be completed
by the end of September, 2002
-
10. Interpretable map?
- yes
-
11. Estimated date of chain tracing completion
- Done
-
12. Estimated date of public release of structure
- October 1, 2002
-
13. Name
- unavailable until after public release of structure
Related Files
Template Sequence file
Template PDB file