CASP5 Target T0173
-
1. Protein Name
- Mycothiol deacetylase
-
2. Organism Name
- Mycobacterium tuberculosis
-
3. Number of amino acids (approx)
- 303
-
4. Accession number
- NC_000962
-
5. Sequence Database
- Genbank
-
6. Amino acid sequence
-
MSETPRLLFVHAHPDDESLSNGATIAHYTSRGAQVHVVTCTLGEEGEVIGDRWAQLTADHADQLGGYRIGELTAALRALGVSAPIYLGGAGRWRDSGMAGTD
QRSQRRFVDADPRQTVGALVAIIRELRPHVVVTYDPNGGYGHPDHVHTHTVTTAAVAAAGVGSGTADHPGDPWTVPKFYWTVLGLSALISGARALVPDDLRP
EWVLPRADEIAFGYSDDGIDAVVEADEQARAAKVAALAAHATQVVVGPTGRAAALSNNLALPILADEHYVLAGGSAGARDERGWETDLLAGLGFTASGT
-
7. Additional Information
- Gene Rv1170 from TB
Chain breaks present
crystalized as monomer, dimer in solution
Crystal pH = 8.0
-
8. X-ray structure
- yes
-
9. Current state of the experimental work
- Refined model, x-ray structure
-
10. Interpretable map?
- yes
-
11. Estimated date of chain tracing completion
- done
-
12. Estimated date of public release of structure
- not set, writing publication
-
13. Name
- unavailable until after public release of structure
Related Files
Template Sequence file
Template PDB file