CASP5 Target T0170
-
1. Protein Name
- FF domain of HYPA/FBP11
-
2. Organism Name
- Homo sapiens
-
3. Number of amino acids (approx)
- 69
-
4. Accession number
- AAC27506
-
5. Sequence Database
- Genbank
-
6. Amino acid sequence
-
QPAKKTYTWNTKEEAKQAFKELLKEKRVPSNASWEQAMKMIINDPRYSALANLSEKKQAFNAYKVQTEK
-
7. Additional Information
-
NMR structure at pH 6.5, monomeric, no disulphides linkages
-
8. X-ray structure
- no
-
9. Current state of the experimental work
-
Structure is completed, paper is in the press
-
10. Interpretable map?
- yes
-
11. Estimated date of chain tracing completion
- Done
-
12. Estimated date of public release of structure
- End of September, 2002
-
13. Name
- unavailable until after public release of structure
Related Files
Template Sequence file
Template PDB file