CASP5 Target T0164

1. Protein Name: C20
2. Organism Name: Chicken
3. Number of amino acids (approx): 166
4. Accession number
5. Sequence Database
6. Amino acid sequence: NSTDVEETLKRIQNND
PDLEEVNLNNIMNIPVPTLKACAEALKTNTYVKKFSIVGTRSNDPVAFALAEMLKVNNTL
KSLNVESNFISGSGILALVEALQSNTSLIELRIDNQSQPLGNNVEMEIANMLEKNTTLLK
FGYHFTQQGPRLRASNAMMNNNDLVRKRRL
7. Additional Information: This sequence corresponds to a structural domain located at residues 179-344 in the full length protein (accession number Q91006 in TrEMBL). However, the residue 216 (full length numbering) in Q91006 is Leu, while our structure has Cys in this position (as in Q9DEA6/TrEMBL).
8. X-ray structure: yes
9. Current state of the experimental work: structure determined.
10. Interpretable map?: yes
11. Estimated date of chain tracing completion: done
12. Estimated date of public release of structure: September,2002
13. Name: unavailable until after public release of structure