CASP5 Target T0160
-
1. Protein Name
- VAP-A
-
2. Organism Name
- Rat
-
3. Number of amino acids (approx)
- 128
-
4. Accession number
-
5. Sequence Database
-
6. Amino acid sequence
-
GSHMAKHEQILVLDPPSDLKFKGPFTDVVTTNLKLQNPSDRKVCFKVKTTAPRRYCVRPN
SGVIDPGSIVYVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNISDMEAVWKEAKPDELMDS
KPRCVFEM
-
7. Additional Information
-
This domain is monomeric in solution and is highly resistant to proteolysis.
Can concentrate to higher than 100 mg/mL in H2O.
-
8. X-ray structure
- yes
-
9. Current state of the experimental work
-
Have tons of protein and Se-Met protein. Have MAD dataset to
1.6A and have phases and initial model in hand.
-
10. Interpretable map?
- yes
-
11. Estimated date of chain tracing completion
- July 25 2002
-
12. Estimated date of public release of structure
- September 25 2002
-
13. Name
- unavailable until after public release of structure
Related Files
Template Sequence file
Template PDB file