# command:# Seed set to 1030697016 # command:# Prefix for input files set to # command:# reading script from file define-score.script # Prefix for input files set to /projects/kestrel/users/karplus/burial/undertaker/atoms-inputs/ # reading monomeric-50pc.atoms # After reading monomeric-50pc.atoms have 448 chains in training database # 111547 residues have no bad marker # 670 residues lack atoms needed to compute omega # 322 residues have cis peptide # number of each bad type: # NON_STANDARD_RESIDUE 6 # HAS_OXT 325 # TOO_MANY_ATOMS 1 # TOO_FEW_ATOMS 523 # HAS_UNKNOWN_ATOMS 2 # HAS_DUPLICATE_ATOMS 0 # CHAIN_BREAK_BEFORE 208 # NON_PLANAR_PEPTIDE 28 # Note: may sum to more than number of residues, # because one residue may have multiple problems # Reading rotamer library from monomeric-50pc.rot # Prefix for input files set to /projects/kestrel/users/karplus/burial/undertaker/spots/ # ReadAtomType pdb-name.types Read AtomType pdb-name with 37 types. # ReadClashTable pdb-atom-name.clash # Read ClashTable pdb-atom-name Reading spots from monomeric-50pc-dry-5.spot. Read prototypes from /projects/kestrel/users/karplus/burial/undertaker/spots/../normalize_prototypes/prototypes # reading histogram from smoothed-monomeric-50pc-dry-5.hist # created burial cost function dry5 with radius 5 Reading spots from monomeric-50pc-wet-6.5.spot. Read prototypes from /projects/kestrel/users/karplus/burial/undertaker/spots/../normalize_prototypes/prototypes # reading histogram from smoothed-monomeric-50pc-wet-6.5.hist # created burial cost function wet6.5 with radius 6.5 Reading spots from monomeric-50pc-dry-6.5.spot. Read prototypes from /projects/kestrel/users/karplus/burial/undertaker/spots/../normalize_prototypes/prototypes # reading histogram from smoothed-monomeric-50pc-dry-6.5.hist # created burial cost function dry6.5 with radius 6.5 Reading spots from monomeric-50pc-generic-6.5.spot. Read prototypes from /projects/kestrel/users/karplus/burial/undertaker/spots/../normalize_prototypes/prototypes # reading histogram from smoothed-monomeric-50pc-generic-6.5.hist # created burial cost function gen6.5 with radius 6.5 Reading spots from monomeric-50pc-dry-8.spot. Read prototypes from /projects/kestrel/users/karplus/burial/undertaker/spots/../normalize_prototypes/prototypes # reading histogram from smoothed-monomeric-50pc-dry-8.hist # created burial cost function dry8 with radius 8 Reading spots from monomeric-50pc-dry-10.spot. Read prototypes from /projects/kestrel/users/karplus/burial/undertaker/spots/../normalize_prototypes/prototypes # reading histogram from smoothed-monomeric-50pc-dry-10.hist # created burial cost function dry10 with radius 10 Reading spots from monomeric-50pc-dry-12.spot. Read prototypes from /projects/kestrel/users/karplus/burial/undertaker/spots/../normalize_prototypes/prototypes # reading histogram from smoothed-monomeric-50pc-dry-12.hist # created burial cost function dry12 with radius 12 # reading histogram from monomeric-smoothed-alpha.hist # created alpha cost function alpha with offset 0 and 360 bins # reading histogram from monomeric-smoothed-alpha-1.hist # created alpha cost function alpha_prev with offset -1 and 360 bins CPU_time= 10760 msec, elapsed time= 12049.5 msec) # Prefix for input files set to # Reading target chain from PDB file T0159.blank.pdb Read PDB file T0159.blank.pdb as target. Have 151 residues and 1181 atoms. # No conformations to remove in PopConform # Prefix for input files set to /projects/compbio/lib/alphabet/ # Read 3 alphabets from alpha.alphabet # Prefix for input files set to # reading predictions from T0159.t2k.alpha.rdb # created predicted alpha cost function pred_alpha2 with 360 bins # SetCost created cost = # ( 0.2 * gen6.5(6.5) + 0.5 * wet6.5(6.5, /log(length)) + 1 * dry5(5) + 8 * dry6.5(6.5) + 4 * dry8(8) + 1 * dry12(12) + 0.3 * phobic_fit + 0.2 * sidechain + 1 * clashes + -0.2 * sidechain_clashes + 0.5 * backbone_clashes + 5 * break + 0.03 * constraints + 1 * pred_alpha2 + 1 * contact_order ) # command:CPU_time= 15180 msec, elapsed time= 16560.4 msec) # command:# Making generic fragment library # fragment library contains # type length num_fragments num_indexes_used # n-terminus 1 407 20 (100%) # n-terminus 2 408 196 (49%) # middle 1 109496 20 (100%) # middle 2 108592 400 (100%) # middle 3 107719 7822 (97.775%) # middle 4 106865 64233 (40.1456%) # c-terminus 1 408 20 (100%) # c-terminus 2 406 227 (56.75%) # ss-bonds 409 # command:CPU_time= 20150 msec, elapsed time= 21527 msec) # command:# Prefix for input files set to # command:# Reading fragments from alignment file # T0159 read from T0159.t2k-2track-undertaker.a2m # command:# Prefix for input files set to # command:# reading script from file T0159.t2k.undertaker-align.script # Reading fragments from alignment file # T0159 read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1kq3A/T0159-1kq3A-2track-protein-STR-local-adpstyle1.pw.a2m.gz # 1kq3A read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1kq3A/T0159-1kq3A-2track-protein-STR-local-adpstyle1.pw.a2m.gz # adding 1kq3A to template set 1kq3A:# found chain 1kq3A in template set T0159 79 :TVTHNQGNYAAMMADTISRYKEGKPVFYYT 1kq3A 84 :DVVVGIGGGKTLDTAKAVAYKLKKPVVIVP Fragment has 66 clashes (null) has 66 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 32 residues other bump:2.62226 Ang SD(88) at 23.3895 23.2617 16.5851 in (null):M-9999 (12) and OG1(241) at 23.6394 25.805 15.9973 in (null):T-9999 (30) other bump:2.30233 Ang CA(114) at 20.93 15.257 12.461 in (null):T-9999 (16) and OH(222) at 20.6057 16.9838 10.9732 in (null):Y-9999 (28) other bump:2.66629 Ang CG1(198) at 18.955 17.949 9.115 in (null):V-9999 (26) and OH(222) at 20.6057 16.9838 10.9732 in (null):Y-9999 (28) other bump:2.80166 Ang CG2(116) at 22.9422 15.438 10.9638 in (null):T-9999 (16) and OH(222) at 20.6057 16.9838 10.9732 in (null):Y-9999 (28) other bump:2.47852 Ang CB(115) at 22.3466 15.8251 12.3033 in (null):T-9999 (16) and OH(222) at 20.6057 16.9838 10.9732 in (null):Y-9999 (28) other bump:2.16977 Ang OG1(117) at 22.2403 17.2738 12.3702 in (null):T-9999 (16) and OH(222) at 20.6057 16.9838 10.9732 in (null):Y-9999 (28) other bump:3.09062 Ang CZ(140) at 17.5683 17.9782 11.9253 in (null):R-9999 (19) and CZ(221) at 20.5826 18.3081 11.3277 in (null):Y-9999 (28) other bump:2.00606 Ang NH2(142) at 18.7743 18.4787 12.1792 in (null):R-9999 (19) and CZ(221) at 20.5826 18.3081 11.3277 in (null):Y-9999 (28) other bump:2.77022 Ang CG1(198) at 18.955 17.949 9.115 in (null):V-9999 (26) and CZ(221) at 20.5826 18.3081 11.3277 in (null):Y-9999 (28) other bump:2.21463 Ang OG1(117) at 22.2403 17.2738 12.3702 in (null):T-9999 (16) and CZ(221) at 20.5826 18.3081 11.3277 in (null):Y-9999 (28) other bump:2.66822 Ang NH2(142) at 18.7743 18.4787 12.1792 in (null):R-9999 (19) and CE2(220) at 20.5385 19.3083 10.3574 in (null):Y-9999 (28) other bump:2.42868 Ang CG1(198) at 18.955 17.949 9.115 in (null):V-9999 (26) and CE2(220) at 20.5385 19.3083 10.3574 in (null):Y-9999 (28) other bump:1.92198 Ang NH2(142) at 18.7743 18.4787 12.1792 in (null):R-9999 (19) and CE1(219) at 20.6269 18.6276 12.6689 in (null):Y-9999 (28) other bump:2.1272 Ang OG1(117) at 22.2403 17.2738 12.3702 in (null):T-9999 (16) and CE1(219) at 20.6269 18.6276 12.6689 in (null):Y-9999 (28) other bump:2.53202 Ang NH2(142) at 18.7743 18.4787 12.1792 in (null):R-9999 (19) and CD1(217) at 20.6331 19.96 13.0519 in (null):Y-9999 (28) other bump:2.90832 Ang ND1(28) at 14.5355 22.9569 14.5365 in (null):H-9999 (4) and CD2(207) at 14.5901 24.6241 12.1541 in (null):F-9999 (27) other bump:2.27733 Ang CD(138) at 16.152 16.5439 10.4906 in (null):R-9999 (19) and CG2(199) at 17.769 17.909 11.332 in (null):V-9999 (26) other bump:0.939629 Ang NE(139) at 17.4062 17.1677 10.8828 in (null):R-9999 (19) and CG2(199) at 17.769 17.909 11.332 in (null):V-9999 (26) other bump:0.630083 Ang CZ(140) at 17.5683 17.9782 11.9253 in (null):R-9999 (19) and CG2(199) at 17.769 17.909 11.332 in (null):V-9999 (26) other bump:1.88519 Ang NH1(141) at 16.5406 18.3101 12.7046 in (null):R-9999 (19) and CG2(199) at 17.769 17.909 11.332 in (null):V-9999 (26) other bump:1.43282 Ang NH2(142) at 18.7743 18.4787 12.1792 in (null):R-9999 (19) and CG2(199) at 17.769 17.909 11.332 in (null):V-9999 (26) other bump:2.4768 Ang NE(139) at 17.4062 17.1677 10.8828 in (null):R-9999 (19) and CG1(198) at 18.955 17.949 9.115 in (null):V-9999 (26) other bump:3.11491 Ang NH2(142) at 18.7743 18.4787 12.1792 in (null):R-9999 (19) and CG1(198) at 18.955 17.949 9.115 in (null):V-9999 (26) other bump:1.95889 Ang CD(138) at 16.152 16.5439 10.4906 in (null):R-9999 (19) and CB(197) at 17.643 17.631 9.833 in (null):V-9999 (26) other bump:1.17171 Ang NE(139) at 17.4062 17.1677 10.8828 in (null):R-9999 (19) and CB(197) at 17.643 17.631 9.833 in (null):V-9999 (26) other bump:2.12218 Ang CZ(140) at 17.5683 17.9782 11.9253 in (null):R-9999 (19) and CB(197) at 17.643 17.631 9.833 in (null):V-9999 (26) other bump:2.73919 Ang NH2(142) at 18.7743 18.4787 12.1792 in (null):R-9999 (19) and CB(197) at 17.643 17.631 9.833 in (null):V-9999 (26) other bump:2.28534 Ang CD(138) at 16.152 16.5439 10.4906 in (null):R-9999 (19) and CA(196) at 16.456 18.421 9.223 in (null):V-9999 (26) other bump:2.28664 Ang NE(139) at 17.4062 17.1677 10.8828 in (null):R-9999 (19) and CA(196) at 16.456 18.421 9.223 in (null):V-9999 (26) other bump:2.95561 Ang CZ(140) at 17.5683 17.9782 11.9253 in (null):R-9999 (19) and CA(196) at 16.456 18.421 9.223 in (null):V-9999 (26) other bump:2.96518 Ang CD(138) at 16.152 16.5439 10.4906 in (null):R-9999 (19) and N(195) at 16.192 17.942 7.876 in (null):V-9999 (26) other bump:3.06575 Ang CD(138) at 16.152 16.5439 10.4906 in (null):R-9999 (19) and C(194) at 15.169 17.113 7.643 in (null):P-9999 (25) other bump:2.62864 Ang CD(138) at 16.152 16.5439 10.4906 in (null):R-9999 (19) and O(193) at 14.391 16.731 8.548 in (null):P-9999 (25) other bump:2.74244 Ang C(22) at 13.81 18.134 12.521 in (null):T-9999 (3) and NH1(141) at 16.5406 18.3101 12.7046 in (null):R-9999 (19) other bump:1.94507 Ang OG1(20) at 14.9815 15.544 11.6795 in (null):T-9999 (3) and CD(138) at 16.152 16.5439 10.4906 in (null):R-9999 (19) other bump:2.76438 Ang CB(18) at 13.8169 15.5846 12.5118 in (null):T-9999 (3) and CG(137) at 16.053 15.0903 10.9635 in (null):R-9999 (19) other bump:1.36621 Ang OG1(20) at 14.9815 15.544 11.6795 in (null):T-9999 (3) and CG(137) at 16.053 15.0903 10.9635 in (null):R-9999 (19) other bump:2.79949 Ang C(32) at 15.17 19.649 15.44 in (null):H-9999 (4) and OD2(110) at 17.3963 18.8669 16.9463 in (null):D-9999 (15) other bump:2.29285 Ang N(33) at 16.334 20.291 15.497 in (null):N-9999 (5) and OD2(110) at 17.3963 18.8669 16.9463 in (null):D-9999 (15) other bump:1.43991 Ang CA(34) at 17.174 20.264 16.678 in (null):N-9999 (5) and OD2(110) at 17.3963 18.8669 16.9463 in (null):D-9999 (15) other bump:2.84107 Ang C(40) at 17.334 21.699 17.163 in (null):N-9999 (5) and OD2(110) at 17.3963 18.8669 16.9463 in (null):D-9999 (15) other bump:1.50544 Ang CB(35) at 18.5461 19.6559 16.3792 in (null):N-9999 (5) and OD2(110) at 17.3963 18.8669 16.9463 in (null):D-9999 (15) other bump:2.36949 Ang CG(36) at 19.4551 19.8469 17.5907 in (null):N-9999 (5) and OD2(110) at 17.3963 18.8669 16.9463 in (null):D-9999 (15) other bump:2.65479 Ang CA(34) at 17.174 20.264 16.678 in (null):N-9999 (5) and CG(108) at 17.5914 17.644 16.7747 in (null):D-9999 (15) other bump:2.26178 Ang CB(35) at 18.5461 19.6559 16.3792 in (null):N-9999 (5) and CG(108) at 17.5914 17.644 16.7747 in (null):D-9999 (15) other bump:2.99868 Ang CG(36) at 19.4551 19.8469 17.5907 in (null):N-9999 (5) and CG(108) at 17.5914 17.644 16.7747 in (null):D-9999 (15) other bump:2.61992 Ang CB(35) at 18.5461 19.6559 16.3792 in (null):N-9999 (5) and CB(107) at 18.259 17.2097 15.4861 in (null):D-9999 (15) other bump:3.27647 Ang CE1(68) at 29.3618 19.3339 17.0427 in (null):Y-9999 (9) and SD(96) at 27.9406 16.4666 17.7454 in (null):M-9999 (13) other bump:2.7058 Ang OH(71) at 30.3085 17.1746 16.644 in (null):Y-9999 (9) and SD(96) at 27.9406 16.4666 17.7454 in (null):M-9999 (13) other bump:2.94077 Ang CD2(67) at 28.7179 18.5844 19.6319 in (null):Y-9999 (9) and SD(96) at 27.9406 16.4666 17.7454 in (null):M-9999 (13) other bump:2.15978 Ang CE2(69) at 29.3725 17.7032 18.7871 in (null):Y-9999 (9) and SD(96) at 27.9406 16.4666 17.7454 in (null):M-9999 (13) other bump:2.38273 Ang CZ(70) at 29.6846 18.0707 17.4951 in (null):Y-9999 (9) and SD(96) at 27.9406 16.4666 17.7454 in (null):M-9999 (13) other bump:2.38514 Ang OD1(38) at 20.3377 20.6819 17.5968 in (null):N-9999 (5) and CG(87) at 22.3274 21.9163 17.1424 in (null):M-9999 (12) other bump:2.63015 Ang OD1(38) at 20.3377 20.6819 17.5968 in (null):N-9999 (5) and CB(86) at 22.7602 20.5601 16.5796 in (null):M-9999 (12) other bump:2.53535 Ang CG(36) at 19.4551 19.8469 17.5907 in (null):N-9999 (5) and CA(85) at 21.898 19.406 17.075 in (null):M-9999 (12) other bump:2.082 Ang OD1(38) at 20.3377 20.6819 17.5968 in (null):N-9999 (5) and CA(85) at 21.898 19.406 17.075 in (null):M-9999 (12) other bump:2.69266 Ang CG(36) at 19.4551 19.8469 17.5907 in (null):N-9999 (5) and N(84) at 21.916 19.283 18.527 in (null):M-9999 (12) other bump:2.17775 Ang ND2(37) at 19.1201 19.141 18.6772 in (null):N-9999 (5) and C(83) at 21.117 18.402 19.134 in (null):A-9999 (11) other bump:2.68909 Ang CG(36) at 19.4551 19.8469 17.5907 in (null):N-9999 (5) and C(83) at 21.117 18.402 19.134 in (null):A-9999 (11) other bump:2.85802 Ang OD1(38) at 20.3377 20.6819 17.5968 in (null):N-9999 (5) and C(83) at 21.117 18.402 19.134 in (null):A-9999 (11) other bump:1.93926 Ang ND2(37) at 19.1201 19.141 18.6772 in (null):N-9999 (5) and O(82) at 20.355 17.656 18.503 in (null):A-9999 (11) other bump:2.53812 Ang CG(36) at 19.4551 19.8469 17.5907 in (null):N-9999 (5) and O(82) at 20.355 17.656 18.503 in (null):A-9999 (11) other bump:2.54332 Ang NE2(30) at 14.0513 23.8958 16.3515 in (null):H-9999 (4) and NE2(47) at 13.32 25.0558 18.4935 in (null):Q-9999 (6) other bump:2.42204 Ang CE1(29) at 14.8048 24.0118 15.2811 in (null):H-9999 (4) and OE1(46) at 14.0413 25.9367 16.5374 in (null):Q-9999 (6) other bump:2.04934 Ang NE2(30) at 14.0513 23.8958 16.3515 in (null):H-9999 (4) and OE1(46) at 14.0413 25.9367 16.5374 in (null):Q-9999 (6) other bump:2.55029 Ang NE2(30) at 14.0513 23.8958 16.3515 in (null):H-9999 (4) and CG(44) at 15.6763 25.0007 17.9771 in (null):Q-9999 (6) Number of specific fragments= 1 total=1 Number of alignments=1 # Reading fragments from alignment file # T0159 read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1kq3A/T0159-1kq3A-2track-protein-STR-local-adpstyle5.pw.a2m.gz # 1kq3A read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1kq3A/T0159-1kq3A-2track-protein-STR-local-adpstyle5.pw.a2m.gz # found chain 1kq3A in template set T0159 38 :PKIAKLF 1kq3A 47 :ENFFSSF Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 9 residues T0159 46 :TNGDGKADLTGCN 1kq3A 54 :TKVRVNKQIFGGE Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues neighbor-bump: 2.08747 Ang O(72) at 19.955 13.793 28.831 in (null):G-9999 (11) and CB(76) at 21.5549 15.1321 28.7616 in (null):C-9999 (12) neighbor-bump: 2.55059 Ang C(73) at 19.53 14.009 27.692 in (null):G-9999 (11) and CB(76) at 21.5549 15.1321 28.7616 in (null):C-9999 (12) T0159 63 :CEGAINHQLAAYELT 1kq3A 67 :CSDEEIERLSGLVEE Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 17 residues other bump:2.40689 Ang O(59) at 12.876 7.34 20.983 in (null):Q-9999 (8) and CD1(83) at 10.8344 8.20905 21.9156 in (null):Y-9999 (12) other bump:2.94541 Ang OE2(14) at 21.9928 7.3873 26.0847 in (null):E-9999 (2) and CG1(29) at 20.4921 9.54057 24.7481 in (null):I-9999 (5) other bump:3.17867 Ang CG(11) at 23.1146 8.04205 24.0794 in (null):E-9999 (2) and N(26) at 20.294 7.338 22.794 in (null):I-9999 (5) T0159 78 :NTVTHNQGNYAAMMADTISRYKEGKPVFYYT 1kq3A 83 :TDVVVGIGGGKTLDTAKAVAYKLKKPVVIVP Fragment has 66 clashes (null) has 66 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 33 residues other bump:2.62226 Ang SD(96) at 23.3895 23.2617 16.5851 in (null):M-9999 (13) and OG1(249) at 23.6394 25.805 15.9973 in (null):T-9999 (31) other bump:2.30233 Ang CA(122) at 20.93 15.257 12.461 in (null):T-9999 (17) and OH(230) at 20.6057 16.9838 10.9732 in (null):Y-9999 (29) other bump:2.66629 Ang CG1(206) at 18.955 17.949 9.115 in (null):V-9999 (27) and OH(230) at 20.6057 16.9838 10.9732 in (null):Y-9999 (29) other bump:2.80166 Ang CG2(124) at 22.9422 15.438 10.9638 in (null):T-9999 (17) and OH(230) at 20.6057 16.9838 10.9732 in (null):Y-9999 (29) other bump:2.47852 Ang CB(123) at 22.3466 15.8251 12.3033 in (null):T-9999 (17) and OH(230) at 20.6057 16.9838 10.9732 in (null):Y-9999 (29) other bump:2.16977 Ang OG1(125) at 22.2403 17.2738 12.3702 in (null):T-9999 (17) and OH(230) at 20.6057 16.9838 10.9732 in (null):Y-9999 (29) other bump:3.09062 Ang CZ(148) at 17.5683 17.9782 11.9253 in (null):R-9999 (20) and CZ(229) at 20.5826 18.3081 11.3277 in (null):Y-9999 (29) other bump:2.00606 Ang NH2(150) at 18.7743 18.4787 12.1792 in (null):R-9999 (20) and CZ(229) at 20.5826 18.3081 11.3277 in (null):Y-9999 (29) other bump:2.77022 Ang CG1(206) at 18.955 17.949 9.115 in (null):V-9999 (27) and CZ(229) at 20.5826 18.3081 11.3277 in (null):Y-9999 (29) other bump:2.21463 Ang OG1(125) at 22.2403 17.2738 12.3702 in (null):T-9999 (17) and CZ(229) at 20.5826 18.3081 11.3277 in (null):Y-9999 (29) other bump:2.66822 Ang NH2(150) at 18.7743 18.4787 12.1792 in (null):R-9999 (20) and CE2(228) at 20.5385 19.3083 10.3574 in (null):Y-9999 (29) other bump:2.42868 Ang CG1(206) at 18.955 17.949 9.115 in (null):V-9999 (27) and CE2(228) at 20.5385 19.3083 10.3574 in (null):Y-9999 (29) other bump:1.92198 Ang NH2(150) at 18.7743 18.4787 12.1792 in (null):R-9999 (20) and CE1(227) at 20.6269 18.6276 12.6689 in (null):Y-9999 (29) other bump:2.1272 Ang OG1(125) at 22.2403 17.2738 12.3702 in (null):T-9999 (17) and CE1(227) at 20.6269 18.6276 12.6689 in (null):Y-9999 (29) other bump:2.53202 Ang NH2(150) at 18.7743 18.4787 12.1792 in (null):R-9999 (20) and CD1(225) at 20.6331 19.96 13.0519 in (null):Y-9999 (29) other bump:2.90832 Ang ND1(36) at 14.5355 22.9569 14.5365 in (null):H-9999 (5) and CD2(215) at 14.5901 24.6241 12.1541 in (null):F-9999 (28) other bump:2.27733 Ang CD(146) at 16.152 16.5439 10.4906 in (null):R-9999 (20) and CG2(207) at 17.769 17.909 11.332 in (null):V-9999 (27) other bump:1.88519 Ang NH1(149) at 16.5406 18.3101 12.7046 in (null):R-9999 (20) and CG2(207) at 17.769 17.909 11.332 in (null):V-9999 (27) other bump:0.939629 Ang NE(147) at 17.4062 17.1677 10.8828 in (null):R-9999 (20) and CG2(207) at 17.769 17.909 11.332 in (null):V-9999 (27) other bump:0.630083 Ang CZ(148) at 17.5683 17.9782 11.9253 in (null):R-9999 (20) and CG2(207) at 17.769 17.909 11.332 in (null):V-9999 (27) other bump:1.43282 Ang NH2(150) at 18.7743 18.4787 12.1792 in (null):R-9999 (20) and CG2(207) at 17.769 17.909 11.332 in (null):V-9999 (27) other bump:2.4768 Ang NE(147) at 17.4062 17.1677 10.8828 in (null):R-9999 (20) and CG1(206) at 18.955 17.949 9.115 in (null):V-9999 (27) other bump:3.11491 Ang NH2(150) at 18.7743 18.4787 12.1792 in (null):R-9999 (20) and CG1(206) at 18.955 17.949 9.115 in (null):V-9999 (27) other bump:1.95889 Ang CD(146) at 16.152 16.5439 10.4906 in (null):R-9999 (20) and CB(205) at 17.643 17.631 9.833 in (null):V-9999 (27) other bump:1.17171 Ang NE(147) at 17.4062 17.1677 10.8828 in (null):R-9999 (20) and CB(205) at 17.643 17.631 9.833 in (null):V-9999 (27) other bump:2.12218 Ang CZ(148) at 17.5683 17.9782 11.9253 in (null):R-9999 (20) and CB(205) at 17.643 17.631 9.833 in (null):V-9999 (27) other bump:2.73919 Ang NH2(150) at 18.7743 18.4787 12.1792 in (null):R-9999 (20) and CB(205) at 17.643 17.631 9.833 in (null):V-9999 (27) other bump:2.28534 Ang CD(146) at 16.152 16.5439 10.4906 in (null):R-9999 (20) and CA(204) at 16.456 18.421 9.223 in (null):V-9999 (27) other bump:2.28664 Ang NE(147) at 17.4062 17.1677 10.8828 in (null):R-9999 (20) and CA(204) at 16.456 18.421 9.223 in (null):V-9999 (27) other bump:2.95561 Ang CZ(148) at 17.5683 17.9782 11.9253 in (null):R-9999 (20) and CA(204) at 16.456 18.421 9.223 in (null):V-9999 (27) other bump:2.96518 Ang CD(146) at 16.152 16.5439 10.4906 in (null):R-9999 (20) and N(203) at 16.192 17.942 7.876 in (null):V-9999 (27) other bump:3.06575 Ang CD(146) at 16.152 16.5439 10.4906 in (null):R-9999 (20) and C(202) at 15.169 17.113 7.643 in (null):P-9999 (26) other bump:2.62864 Ang CD(146) at 16.152 16.5439 10.4906 in (null):R-9999 (20) and O(201) at 14.391 16.731 8.548 in (null):P-9999 (26) other bump:2.74244 Ang C(30) at 13.81 18.134 12.521 in (null):T-9999 (4) and NH1(149) at 16.5406 18.3101 12.7046 in (null):R-9999 (20) other bump:1.94507 Ang OG1(28) at 14.9815 15.544 11.6795 in (null):T-9999 (4) and CD(146) at 16.152 16.5439 10.4906 in (null):R-9999 (20) other bump:2.76438 Ang CB(26) at 13.8169 15.5846 12.5118 in (null):T-9999 (4) and CG(145) at 16.053 15.0903 10.9635 in (null):R-9999 (20) other bump:1.36621 Ang OG1(28) at 14.9815 15.544 11.6795 in (null):T-9999 (4) and CG(145) at 16.053 15.0903 10.9635 in (null):R-9999 (20) other bump:2.79949 Ang C(40) at 15.17 19.649 15.44 in (null):H-9999 (5) and OD2(118) at 17.3963 18.8669 16.9463 in (null):D-9999 (16) other bump:2.29285 Ang N(41) at 16.334 20.291 15.497 in (null):N-9999 (6) and OD2(118) at 17.3963 18.8669 16.9463 in (null):D-9999 (16) other bump:1.43991 Ang CA(42) at 17.174 20.264 16.678 in (null):N-9999 (6) and OD2(118) at 17.3963 18.8669 16.9463 in (null):D-9999 (16) other bump:1.50544 Ang CB(43) at 18.5461 19.6559 16.3792 in (null):N-9999 (6) and OD2(118) at 17.3963 18.8669 16.9463 in (null):D-9999 (16) other bump:2.84107 Ang C(48) at 17.334 21.699 17.163 in (null):N-9999 (6) and OD2(118) at 17.3963 18.8669 16.9463 in (null):D-9999 (16) other bump:2.36949 Ang CG(44) at 19.4551 19.8469 17.5907 in (null):N-9999 (6) and OD2(118) at 17.3963 18.8669 16.9463 in (null):D-9999 (16) other bump:2.65479 Ang CA(42) at 17.174 20.264 16.678 in (null):N-9999 (6) and CG(116) at 17.5914 17.644 16.7747 in (null):D-9999 (16) other bump:2.26178 Ang CB(43) at 18.5461 19.6559 16.3792 in (null):N-9999 (6) and CG(116) at 17.5914 17.644 16.7747 in (null):D-9999 (16) other bump:2.99868 Ang CG(44) at 19.4551 19.8469 17.5907 in (null):N-9999 (6) and CG(116) at 17.5914 17.644 16.7747 in (null):D-9999 (16) other bump:2.61992 Ang CB(43) at 18.5461 19.6559 16.3792 in (null):N-9999 (6) and CB(115) at 18.259 17.2097 15.4861 in (null):D-9999 (16) other bump:3.27647 Ang CE1(76) at 29.3618 19.3339 17.0427 in (null):Y-9999 (10) and SD(104) at 27.9406 16.4666 17.7454 in (null):M-9999 (14) other bump:2.7058 Ang OH(79) at 30.3085 17.1746 16.644 in (null):Y-9999 (10) and SD(104) at 27.9406 16.4666 17.7454 in (null):M-9999 (14) other bump:2.94077 Ang CD2(75) at 28.7179 18.5844 19.6319 in (null):Y-9999 (10) and SD(104) at 27.9406 16.4666 17.7454 in (null):M-9999 (14) other bump:2.15978 Ang CE2(77) at 29.3725 17.7032 18.7871 in (null):Y-9999 (10) and SD(104) at 27.9406 16.4666 17.7454 in (null):M-9999 (14) other bump:2.38273 Ang CZ(78) at 29.6846 18.0707 17.4951 in (null):Y-9999 (10) and SD(104) at 27.9406 16.4666 17.7454 in (null):M-9999 (14) other bump:2.38514 Ang OD1(46) at 20.3377 20.6819 17.5968 in (null):N-9999 (6) and CG(95) at 22.3274 21.9163 17.1424 in (null):M-9999 (13) other bump:2.63015 Ang OD1(46) at 20.3377 20.6819 17.5968 in (null):N-9999 (6) and CB(94) at 22.7602 20.5601 16.5796 in (null):M-9999 (13) other bump:2.53535 Ang CG(44) at 19.4551 19.8469 17.5907 in (null):N-9999 (6) and CA(93) at 21.898 19.406 17.075 in (null):M-9999 (13) other bump:2.082 Ang OD1(46) at 20.3377 20.6819 17.5968 in (null):N-9999 (6) and CA(93) at 21.898 19.406 17.075 in (null):M-9999 (13) other bump:2.69266 Ang CG(44) at 19.4551 19.8469 17.5907 in (null):N-9999 (6) and N(92) at 21.916 19.283 18.527 in (null):M-9999 (13) other bump:2.17775 Ang ND2(45) at 19.1201 19.141 18.6772 in (null):N-9999 (6) and C(91) at 21.117 18.402 19.134 in (null):A-9999 (12) other bump:2.68909 Ang CG(44) at 19.4551 19.8469 17.5907 in (null):N-9999 (6) and C(91) at 21.117 18.402 19.134 in (null):A-9999 (12) other bump:2.85802 Ang OD1(46) at 20.3377 20.6819 17.5968 in (null):N-9999 (6) and C(91) at 21.117 18.402 19.134 in (null):A-9999 (12) other bump:1.93926 Ang ND2(45) at 19.1201 19.141 18.6772 in (null):N-9999 (6) and O(90) at 20.355 17.656 18.503 in (null):A-9999 (12) other bump:2.53812 Ang CG(44) at 19.4551 19.8469 17.5907 in (null):N-9999 (6) and O(90) at 20.355 17.656 18.503 in (null):A-9999 (12) other bump:2.54332 Ang NE2(38) at 14.0513 23.8958 16.3515 in (null):H-9999 (5) and NE2(55) at 13.32 25.0558 18.4935 in (null):Q-9999 (7) other bump:2.42204 Ang CE1(37) at 14.8048 24.0118 15.2811 in (null):H-9999 (5) and OE1(54) at 14.0413 25.9367 16.5374 in (null):Q-9999 (7) other bump:2.04934 Ang NE2(38) at 14.0513 23.8958 16.3515 in (null):H-9999 (5) and OE1(54) at 14.0413 25.9367 16.5374 in (null):Q-9999 (7) other bump:2.55029 Ang NE2(38) at 14.0513 23.8958 16.3515 in (null):H-9999 (5) and CG(52) at 15.6763 25.0007 17.9771 in (null):Q-9999 (7) T0159 112 :Y 1kq3A 114 :T Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 3 residues T0159 114 :VSNELKPGKDVVWLQVPFSA 1kq3A 115 :IASTDAPCSALSVIYTPNGE Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 22 residues neighbor-bump: 2.92786 Ang CG1(125) at 29.3519 5.43152 27.154 in (null):V-9999 (16) and CD(133) at 26.528 5.214 26.412 in (null):P-9999 (17) other bump:3.16177 Ang CG1(80) at 30.8065 15.1227 12.1133 in (null):V-9999 (11) and NE1(99) at 32.3801 15.9586 14.7252 in (null):W-9999 (13) other bump:2.51182 Ang CG1(5) at 25.673 27.244 22.124 in (null):V-9999 (1) and OD1(20) at 27.9444 28.0266 22.8572 in (null):N-9999 (3) other bump:2.47725 Ang CB(4) at 25.658 28.766 22.255 in (null):V-9999 (1) and OD1(20) at 27.9444 28.0266 22.8572 in (null):N-9999 (3) Number of specific fragments= 6 total=7 Number of alignments=2 # Reading fragments from alignment file # T0159 read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1b16A/T0159-1b16A-2track-protein-STR-local-adpstyle5.pw.a2m.gz # 1b16A read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1b16A/T0159-1b16A-2track-protein-STR-local-adpstyle5.pw.a2m.gz # adding 1b16A to template set 1b16A:Skipped atom 198, because occupancy 0.4 <= existing 0.600001 Skipped atom 200, because occupancy 0.4 <= existing 0.600001 Skipped atom 202, because occupancy 0.4 <= existing 0.600001 Skipped atom 204, because occupancy 0.4 <= existing 0.600001 Skipped atom 926, because occupancy 0.5 <= existing 0.500001 Skipped atom 928, because occupancy 0.5 <= existing 0.500001 Skipped atom 930, because occupancy 0.5 <= existing 0.500001 Skipped atom 1282, because occupancy 0.2 <= existing 0.800001 Skipped atom 1284, because occupancy 0.2 <= existing 0.800001 Skipped atom 1286, because occupancy 0.2 <= existing 0.800001 Skipped atom 1288, because occupancy 0.2 <= existing 0.800001 Skipped atom 1408, because occupancy 0.3 <= existing 0.700001 Skipped atom 1410, because occupancy 0.3 <= existing 0.700001 Skipped atom 1412, because occupancy 0.3 <= existing 0.700001 Skipped atom 1414, because occupancy 0.3 <= existing 0.700001 Skipped atom 1416, because occupancy 0.3 <= existing 0.700001 Skipped atom 1418, because occupancy 0.3 <= existing 0.700001 Skipped atom 1420, because occupancy 0.3 <= existing 0.700001 Skipped atom 1422, because occupancy 0.3 <= existing 0.700001 Skipped atom 1424, because occupancy 0.3 <= existing 0.700001 Skipped atom 1426, because occupancy 0.3 <= existing 0.700001 Skipped atom 1428, because occupancy 0.3 <= existing 0.700001 Skipped atom 1822, because occupancy 0.5 <= existing 0.500001 Skipped atom 1824, because occupancy 0.5 <= existing 0.500001 Skipped atom 1826, because occupancy 0.5 <= existing 0.500001 Skipped atom 1828, because occupancy 0.5 <= existing 0.500001 # found chain 1b16A in template set T0159 48 :GDGKADLTGCNPGWGCEGAINHQLAAYELTNTVTHNQGNYAAMMADTI 1b16A 2 :DLTNKNVIFVAALGGIGLDTSRELVKRNLKNFVILDRVENPTALAELK Fragment has 23 clashes (null) has 23 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 50 residues other bump:2.53302 Ang CE1(148) at 12.6031 -12.9292 -13.0238 in (null):H-9999 (22) and OD1(330) at 12.5617 -14.57 -14.9531 in (null):D-9999 (46) other bump:2.80027 Ang CD1(287) at 10.4524 -20.0145 -8.36363 in (null):Y-9999 (40) and N(305) at 12.085 -19.654 -10.61 in (null):M-9999 (43) other bump:2.58076 Ang CE1(289) at 9.41251 -20.0567 -9.29941 in (null):Y-9999 (40) and CB(302) at 9.759 -21.524 -11.394 in (null):A-9999 (42) other bump:2.1619 Ang CG2(51) at 24.4655 -12.2441 -0.0954647 in (null):T-9999 (8) and NE2(251) at 24.2248 -14.3713 0.206193 in (null):H-9999 (35) other bump:2.50953 Ang CG2(51) at 24.4655 -12.2441 -0.0954647 in (null):T-9999 (8) and CD2(248) at 22.8704 -14.1563 0.216652 in (null):H-9999 (35) other bump:2.23524 Ang CG(76) at 17.4341 -13.8696 -3.36836 in (null):P-9999 (12) and CG2(240) at 18.2674 -15.8011 -4.12421 in (null):T-9999 (34) other bump:2.57666 Ang CD1(204) at 24.141 -9.164 -10.12 in (null):L-9999 (29) and OG1(227) at 24.0878 -11.7323 -9.92016 in (null):T-9999 (32) other bump:2.76257 Ang CA(19) at 31.361 -7.8 -13.401 in (null):K-9999 (4) and CG2(211) at 31.8376 -10.3483 -12.4467 in (null):T-9999 (30) other bump:2.70214 Ang C(26) at 31.413 -7.74 -11.883 in (null):K-9999 (4) and CG2(211) at 31.8376 -10.3483 -12.4467 in (null):T-9999 (30) other bump:2.51946 Ang O(25) at 32.402 -8.174 -11.306 in (null):K-9999 (4) and CG2(211) at 31.8376 -10.3483 -12.4467 in (null):T-9999 (30) other bump:2.3837 Ang CD1(44) at 26.1099 -7.64971 -8.27055 in (null):L-9999 (7) and CD2(205) at 25.812 -7.362 -10.618 in (null):L-9999 (29) other bump:2.84616 Ang O(159) at 19.249 -5.965 -14.221 in (null):Q-9999 (23) and CE2(186) at 19.8323 -3.17965 -14.1746 in (null):Y-9999 (27) other bump:2.55602 Ang O(159) at 19.249 -5.965 -14.221 in (null):Q-9999 (23) and CD2(184) at 20.9188 -4.03608 -14.0648 in (null):Y-9999 (27) other bump:2.44318 Ang O(119) at 13.31 -10.383 -10.264 in (null):G-9999 (18) and CD2(146) at 12.1936 -10.872 -12.3814 in (null):H-9999 (22) other bump:3.14142 Ang C(120) at 12.52 -10.243 -9.321 in (null):G-9999 (18) and CD2(146) at 12.1936 -10.872 -12.3814 in (null):H-9999 (22) other bump:2.92762 Ang C(72) at 15.086 -11.892 -1.509 in (null):N-9999 (11) and CD(112) at 14.6265 -9.0991 -2.25703 in (null):E-9999 (17) other bump:2.05159 Ang O(71) at 14.232 -11.07 -1.846 in (null):N-9999 (11) and CD(112) at 14.6265 -9.0991 -2.25703 in (null):E-9999 (17) other bump:2.70422 Ang C(72) at 15.086 -11.892 -1.509 in (null):N-9999 (11) and CG(111) at 13.4648 -10.0036 -2.56648 in (null):E-9999 (17) other bump:1.49833 Ang O(71) at 14.232 -11.07 -1.846 in (null):N-9999 (11) and CG(111) at 13.4648 -10.0036 -2.56648 in (null):E-9999 (17) other bump:2.74357 Ang C(79) at 14.622 -12.706 -4.567 in (null):P-9999 (12) and CB(110) at 13.2922 -10.3667 -4.03146 in (null):E-9999 (17) other bump:2.48071 Ang O(71) at 14.232 -11.07 -1.846 in (null):N-9999 (11) and CB(110) at 13.2922 -10.3667 -4.03146 in (null):E-9999 (17) other bump:3.09025 Ang CA(74) at 15.823 -12.129 -3.833 in (null):P-9999 (12) and CB(110) at 13.2922 -10.3667 -4.03146 in (null):E-9999 (17) neighbor-bump: 2.47038 Ang N(65) at 16.651 -12.535 0.28 in (null):N-9999 (11) and CD(77) at 17.0305 -13.2992 -2.03835 in (null):P-9999 (12) T0159 97 :RYKEGKPVFYYTWTP 1b16A 50 :AINPKVNITFHTYDV Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 17 residues other bump:3.09498 Ang CZ3(122) at 18.684 -13.4962 5.34071 in (null):W-9999 (13) and CG(136) at 15.9434 -13.7403 6.75796 in (null):P-9999 (15) Number of specific fragments= 2 total=9 Number of alignments=3 # Reading fragments from alignment file # T0159 read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1b16A/T0159-1b16A-2track-protein-STR-local-adpstyle1.pw.a2m.gz # 1b16A read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1b16A/T0159-1b16A-2track-protein-STR-local-adpstyle1.pw.a2m.gz # found chain 1b16A in template set T0159 48 :GDGKADLTGCNPGWGCEGAINHQLAAYELTNTVTHNQGNYAAMMADT 1b16A 2 :DLTNKNVIFVAALGGIGLDTSRELVKRNLKNFVILDRVENPTALAEL Fragment has 23 clashes (null) has 23 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 49 residues other bump:2.53302 Ang CE1(148) at 12.6031 -12.9292 -13.0238 in (null):H-9999 (22) and OD1(330) at 12.5617 -14.57 -14.9531 in (null):D-9999 (46) other bump:2.80027 Ang CD1(287) at 10.4524 -20.0145 -8.36363 in (null):Y-9999 (40) and N(305) at 12.085 -19.654 -10.61 in (null):M-9999 (43) other bump:2.58076 Ang CE1(289) at 9.41251 -20.0567 -9.29941 in (null):Y-9999 (40) and CB(302) at 9.759 -21.524 -11.394 in (null):A-9999 (42) other bump:2.1619 Ang CG2(51) at 24.4655 -12.2441 -0.0954647 in (null):T-9999 (8) and NE2(251) at 24.2248 -14.3713 0.206193 in (null):H-9999 (35) other bump:2.50953 Ang CG2(51) at 24.4655 -12.2441 -0.0954647 in (null):T-9999 (8) and CD2(248) at 22.8704 -14.1563 0.216652 in (null):H-9999 (35) other bump:2.23524 Ang CG(76) at 17.4341 -13.8696 -3.36836 in (null):P-9999 (12) and CG2(240) at 18.2674 -15.8011 -4.12421 in (null):T-9999 (34) other bump:2.57666 Ang CD1(204) at 24.141 -9.164 -10.12 in (null):L-9999 (29) and OG1(227) at 24.0878 -11.7323 -9.92016 in (null):T-9999 (32) other bump:2.76257 Ang CA(19) at 31.361 -7.8 -13.401 in (null):K-9999 (4) and CG2(211) at 31.8376 -10.3483 -12.4467 in (null):T-9999 (30) other bump:2.70214 Ang C(26) at 31.413 -7.74 -11.883 in (null):K-9999 (4) and CG2(211) at 31.8376 -10.3483 -12.4467 in (null):T-9999 (30) other bump:2.51946 Ang O(25) at 32.402 -8.174 -11.306 in (null):K-9999 (4) and CG2(211) at 31.8376 -10.3483 -12.4467 in (null):T-9999 (30) other bump:2.3837 Ang CD1(44) at 26.1099 -7.64971 -8.27055 in (null):L-9999 (7) and CD2(205) at 25.812 -7.362 -10.618 in (null):L-9999 (29) other bump:2.84616 Ang O(159) at 19.249 -5.965 -14.221 in (null):Q-9999 (23) and CE2(186) at 19.8323 -3.17965 -14.1746 in (null):Y-9999 (27) other bump:2.55602 Ang O(159) at 19.249 -5.965 -14.221 in (null):Q-9999 (23) and CD2(184) at 20.9188 -4.03608 -14.0648 in (null):Y-9999 (27) other bump:2.44318 Ang O(119) at 13.31 -10.383 -10.264 in (null):G-9999 (18) and CD2(146) at 12.1936 -10.872 -12.3814 in (null):H-9999 (22) other bump:3.14142 Ang C(120) at 12.52 -10.243 -9.321 in (null):G-9999 (18) and CD2(146) at 12.1936 -10.872 -12.3814 in (null):H-9999 (22) other bump:2.92762 Ang C(72) at 15.086 -11.892 -1.509 in (null):N-9999 (11) and CD(112) at 14.6265 -9.0991 -2.25703 in (null):E-9999 (17) other bump:2.05159 Ang O(71) at 14.232 -11.07 -1.846 in (null):N-9999 (11) and CD(112) at 14.6265 -9.0991 -2.25703 in (null):E-9999 (17) other bump:2.70422 Ang C(72) at 15.086 -11.892 -1.509 in (null):N-9999 (11) and CG(111) at 13.4648 -10.0036 -2.56648 in (null):E-9999 (17) other bump:1.49833 Ang O(71) at 14.232 -11.07 -1.846 in (null):N-9999 (11) and CG(111) at 13.4648 -10.0036 -2.56648 in (null):E-9999 (17) other bump:2.74357 Ang C(79) at 14.622 -12.706 -4.567 in (null):P-9999 (12) and CB(110) at 13.2922 -10.3667 -4.03146 in (null):E-9999 (17) other bump:2.48071 Ang O(71) at 14.232 -11.07 -1.846 in (null):N-9999 (11) and CB(110) at 13.2922 -10.3667 -4.03146 in (null):E-9999 (17) other bump:3.09025 Ang CA(74) at 15.823 -12.129 -3.833 in (null):P-9999 (12) and CB(110) at 13.2922 -10.3667 -4.03146 in (null):E-9999 (17) neighbor-bump: 2.47038 Ang N(65) at 16.651 -12.535 0.28 in (null):N-9999 (11) and CD(77) at 17.0305 -13.2992 -2.03835 in (null):P-9999 (12) T0159 96 :SRYKEGKPVFYYTW 1b16A 49 :KAINPKVNITFHTY Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 16 residues Number of specific fragments= 2 total=11 Number of alignments=4 # Reading fragments from alignment file # T0159 read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1pot/T0159-1pot-2track-protein-STR-local-adpstyle5.pw.a2m.gz # 1pot read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1pot/T0159-1pot-2track-protein-STR-local-adpstyle5.pw.a2m.gz # found chain 1pot in training set T0159 5 :REGVFVNGAAQGYLIDKKTADQYKITNIAQLKDPKIAKLF 1pot 124 :DYSIPYIWGATAIGVNGDAVDPKSVTSWADLWKPEYKGSL Fragment has 26 clashes (null) has 26 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 42 residues other bump:0.928587 Ang CG2(280) at 87.9748 47.1346 10.8958 in (null):I-9999 (36) and CZ(314) at 87.3997 46.9558 11.6026 in (null):F-9999 (40) other bump:2.58062 Ang CG1(279) at 89.7673 46.5006 12.5228 in (null):I-9999 (36) and CZ(314) at 87.3997 46.9558 11.6026 in (null):F-9999 (40) other bump:2.01892 Ang CB(278) at 89.3297 47.5349 11.4771 in (null):I-9999 (36) and CZ(314) at 87.3997 46.9558 11.6026 in (null):F-9999 (40) other bump:1.22142 Ang CG2(280) at 87.9748 47.1346 10.8958 in (null):I-9999 (36) and CE2(313) at 87.2949 48.1481 10.9468 in (null):F-9999 (40) other bump:2.19034 Ang CB(278) at 89.3297 47.5349 11.4771 in (null):I-9999 (36) and CE2(313) at 87.2949 48.1481 10.9468 in (null):F-9999 (40) other bump:1.89988 Ang CG2(280) at 87.9748 47.1346 10.8958 in (null):I-9999 (36) and CE1(312) at 86.5514 45.9371 11.2824 in (null):F-9999 (40) other bump:2.22894 Ang CG2(280) at 87.9748 47.1346 10.8958 in (null):I-9999 (36) and CD2(311) at 86.328 48.333 9.99006 in (null):F-9999 (40) other bump:2.64314 Ang CG2(280) at 87.9748 47.1346 10.8958 in (null):I-9999 (36) and CD1(310) at 85.6039 46.1123 10.3299 in (null):F-9999 (40) other bump:2.79065 Ang CG2(280) at 87.9748 47.1346 10.8958 in (null):I-9999 (36) and CG(309) at 85.4806 47.3134 9.65685 in (null):F-9999 (40) other bump:2.86145 Ang OD1(210) at 84.9673 46.8894 21.1633 in (null):N-9999 (27) and C(225) at 85.461 48.97 19.262 in (null):A-9999 (29) other bump:2.73571 Ang OD1(210) at 84.9673 46.8894 21.1633 in (null):N-9999 (27) and CA(222) at 84.272 49.32 20.118 in (null):A-9999 (29) other bump:2.19838 Ang OH(95) at 80.4722 46.8191 17.3608 in (null):Y-9999 (13) and CG2(217) at 80.1129 48.8968 17.9829 in (null):I-9999 (28) other bump:2.9117 Ang CE2(93) at 80.519 44.4842 17.8407 in (null):Y-9999 (13) and CG1(216) at 79.0567 46.7681 18.9006 in (null):I-9999 (28) other bump:2.78106 Ang CZ(94) at 80.5717 45.5201 16.9304 in (null):Y-9999 (13) and CG1(216) at 79.0567 46.7681 18.9006 in (null):I-9999 (28) other bump:2.0921 Ang OH(95) at 80.4722 46.8191 17.3608 in (null):Y-9999 (13) and CG1(216) at 79.0567 46.7681 18.9006 in (null):I-9999 (28) other bump:1.93377 Ang OH(95) at 80.4722 46.8191 17.3608 in (null):Y-9999 (13) and CB(215) at 80.2105 47.7943 19.01 in (null):I-9999 (28) other bump:2.93741 Ang CE2(93) at 80.519 44.4842 17.8407 in (null):Y-9999 (13) and CA(214) at 81.509 47.059 18.85 in (null):I-9999 (28) other bump:2.6328 Ang CZ(94) at 80.5717 45.5201 16.9304 in (null):Y-9999 (13) and CA(214) at 81.509 47.059 18.85 in (null):I-9999 (28) other bump:1.83036 Ang OH(95) at 80.4722 46.8191 17.3608 in (null):Y-9999 (13) and CA(214) at 81.509 47.059 18.85 in (null):I-9999 (28) other bump:3.04123 Ang CE2(93) at 80.519 44.4842 17.8407 in (null):Y-9999 (13) and N(213) at 81.831 46.187 19.992 in (null):I-9999 (28) other bump:3.25991 Ang CE2(93) at 80.519 44.4842 17.8407 in (null):Y-9999 (13) and C(212) at 82.882 45.373 19.903 in (null):N-9999 (27) other bump:2.86533 Ang CD1(111) at 84.5046 37.6924 15.3712 in (null):I-9999 (15) and CG2(194) at 85.8705 40.0757 16.1864 in (null):I-9999 (25) other bump:1.74819 Ang OD2(119) at 88.1665 36.0002 5.83151 in (null):D-9999 (16) and OG1(144) at 89.7353 35.2679 5.58918 in (null):T-9999 (19) other bump:2.82454 Ang OD2(119) at 88.1665 36.0002 5.83151 in (null):D-9999 (16) and CG2(143) at 90.5611 37.4036 6.35565 in (null):T-9999 (19) other bump:2.79456 Ang CG(117) at 87.244 35.5547 6.54543 in (null):D-9999 (16) and CB(142) at 89.9851 36.0526 6.76526 in (null):T-9999 (19) other bump:2.04494 Ang OD2(119) at 88.1665 36.0002 5.83151 in (null):D-9999 (16) and CB(142) at 89.9851 36.0526 6.76526 in (null):T-9999 (19) T0159 46 :T 1pot 166 :T Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 3 residues T0159 48 :GDGK 1pot 167 :DDAR Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 6 residues T0159 55 :TGCNPGWGCEGAINHQLAAY 1pot 180 :LGYSGNTTDPKEIEAAYNEL Fragment has 33 clashes (null) has 33 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 22 residues other bump:2.64599 Ang O(113) at 78.289 58.516 16.025 in (null):Q-9999 (16) and CD2(138) at 76.6795 57.4 14.2459 in (null):Y-9999 (20) other bump:3.09944 Ang C(114) at 77.461 59.238 16.616 in (null):Q-9999 (16) and CD2(138) at 76.6795 57.4 14.2459 in (null):Y-9999 (20) other bump:2.83496 Ang CD1(42) at 69.3604 60.4566 21.691 in (null):W-9999 (7) and CG1(83) at 69.967 60.791 18.942 in (null):I-9999 (13) other bump:2.80042 Ang CD1(42) at 69.3604 60.4566 21.691 in (null):W-9999 (7) and C(61) at 69 63.231 21.814 in (null):C-9999 (9) other bump:2.50886 Ang CE2(44) at 69.2725 61.528 23.636 in (null):W-9999 (7) and C(61) at 69 63.231 21.814 in (null):C-9999 (9) other bump:1.6829 Ang NE1(46) at 69.4783 61.6902 22.2929 in (null):W-9999 (7) and C(61) at 69 63.231 21.814 in (null):C-9999 (9) other bump:2.96632 Ang CZ2(47) at 69.2848 62.4608 24.6644 in (null):W-9999 (7) and C(61) at 69 63.231 21.814 in (null):C-9999 (9) other bump:2.20832 Ang CD1(42) at 69.3604 60.4566 21.691 in (null):W-9999 (7) and O(60) at 70.015 62.561 21.551 in (null):C-9999 (9) other bump:2.44252 Ang CE2(44) at 69.2725 61.528 23.636 in (null):W-9999 (7) and O(60) at 70.015 62.561 21.551 in (null):C-9999 (9) other bump:1.26363 Ang NE1(46) at 69.4783 61.6902 22.2929 in (null):W-9999 (7) and O(60) at 70.015 62.561 21.551 in (null):C-9999 (9) other bump:2.98029 Ang CE2(44) at 69.2725 61.528 23.636 in (null):W-9999 (7) and SG(59) at 69.5515 64.2498 24.8175 in (null):C-9999 (9) other bump:1.81525 Ang CZ2(47) at 69.2848 62.4608 24.6644 in (null):W-9999 (7) and SG(59) at 69.5515 64.2498 24.8175 in (null):C-9999 (9) other bump:2.55438 Ang CH2(49) at 69.0529 62.0066 25.9329 in (null):W-9999 (7) and SG(59) at 69.5515 64.2498 24.8175 in (null):C-9999 (9) other bump:1.51076 Ang CE2(44) at 69.2725 61.528 23.636 in (null):W-9999 (7) and CB(58) at 68.6751 62.7559 24.2823 in (null):C-9999 (9) other bump:2.39553 Ang NE1(46) at 69.4783 61.6902 22.2929 in (null):W-9999 (7) and CB(58) at 68.6751 62.7559 24.2823 in (null):C-9999 (9) other bump:2.6492 Ang CD2(43) at 69.027 60.1615 23.878 in (null):W-9999 (7) and CB(58) at 68.6751 62.7559 24.2823 in (null):C-9999 (9) other bump:3.15494 Ang CE3(45) at 68.8001 59.7328 25.176 in (null):W-9999 (7) and CB(58) at 68.6751 62.7559 24.2823 in (null):C-9999 (9) other bump:0.777661 Ang CZ2(47) at 69.2848 62.4608 24.6644 in (null):W-9999 (7) and CB(58) at 68.6751 62.7559 24.2823 in (null):C-9999 (9) other bump:2.85409 Ang CZ3(48) at 68.7983 60.6544 26.2096 in (null):W-9999 (7) and CB(58) at 68.6751 62.7559 24.2823 in (null):C-9999 (9) other bump:1.85166 Ang CH2(49) at 69.0529 62.0066 25.9329 in (null):W-9999 (7) and CB(58) at 68.6751 62.7559 24.2823 in (null):C-9999 (9) other bump:3.02096 Ang CD1(42) at 69.3604 60.4566 21.691 in (null):W-9999 (7) and CA(57) at 68.051 62.872 22.947 in (null):C-9999 (9) other bump:1.94247 Ang CE2(44) at 69.2725 61.528 23.636 in (null):W-9999 (7) and CA(57) at 68.051 62.872 22.947 in (null):C-9999 (9) other bump:1.96509 Ang NE1(46) at 69.4783 61.6902 22.2929 in (null):W-9999 (7) and CA(57) at 68.051 62.872 22.947 in (null):C-9999 (9) other bump:3.02755 Ang CD2(43) at 69.027 60.1615 23.878 in (null):W-9999 (7) and CA(57) at 68.051 62.872 22.947 in (null):C-9999 (9) other bump:2.15423 Ang CZ2(47) at 69.2848 62.4608 24.6644 in (null):W-9999 (7) and CA(57) at 68.051 62.872 22.947 in (null):C-9999 (9) other bump:2.86671 Ang CG(41) at 69.1019 59.4997 22.6172 in (null):W-9999 (7) and N(56) at 67.26 61.696 22.576 in (null):C-9999 (9) other bump:2.59441 Ang CD1(42) at 69.3604 60.4566 21.691 in (null):W-9999 (7) and N(56) at 67.26 61.696 22.576 in (null):C-9999 (9) other bump:2.28079 Ang CE2(44) at 69.2725 61.528 23.636 in (null):W-9999 (7) and N(56) at 67.26 61.696 22.576 in (null):C-9999 (9) other bump:2.23631 Ang NE1(46) at 69.4783 61.6902 22.2929 in (null):W-9999 (7) and N(56) at 67.26 61.696 22.576 in (null):C-9999 (9) other bump:2.67808 Ang CD2(43) at 69.027 60.1615 23.878 in (null):W-9999 (7) and N(56) at 67.26 61.696 22.576 in (null):C-9999 (9) other bump:2.90514 Ang OD1(24) at 67.4565 53.3767 23.8386 in (null):N-9999 (4) and C(37) at 66.43 55.38 22.002 in (null):G-9999 (6) other bump:2.57042 Ang OD1(24) at 67.4565 53.3767 23.8386 in (null):N-9999 (4) and CA(35) at 66.56 53.955 21.5 in (null):G-9999 (6) other bump:2.20256 Ang OD1(24) at 67.4565 53.3767 23.8386 in (null):N-9999 (4) and N(34) at 67.939 53.456 21.691 in (null):G-9999 (6) T0159 75 :ELTNTVTHNQGNYAA 1pot 201 :KLMPNVAAFNSDNPA Fragment has 9 clashes (null) has 9 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 17 residues other bump:2.63213 Ang OE1(78) at 73.8913 42.8014 1.4177 in (null):Q-9999 (10) and C(105) at 73.818 40.346 2.363 in (null):Y-9999 (13) neighbor-bump: 2.27775 Ang O(92) at 69.726 40.837 1.358 in (null):N-9999 (12) and CD1(98) at 70.0382 39.2246 -0.220186 in (null):Y-9999 (13) neighbor-bump: 2.46122 Ang O(92) at 69.726 40.837 1.358 in (null):N-9999 (12) and CG(97) at 70.6399 38.6066 0.860476 in (null):Y-9999 (13) other bump:2.49614 Ang OE1(78) at 73.8913 42.8014 1.4177 in (null):Q-9999 (10) and N(94) at 71.886 41.315 1.417 in (null):Y-9999 (13) neighbor-bump: 2.46588 Ang CB(88) at 70.8391 42.4775 -0.489034 in (null):N-9999 (12) and N(94) at 71.886 41.315 1.417 in (null):Y-9999 (13) self-bump: 1.88218 Ang CB(88) at 70.8391 42.4775 -0.489034 in (null):N-9999 (12) and C(93) at 70.638 41.639 1.184 in (null):N-9999 (12) self-bump: 1.34405 Ang CA(87) at 70.481 43.072 0.662 in (null):N-9999 (12) and CB(88) at 70.8391 42.4775 -0.489034 in (null):N-9999 (12) other bump:2.77575 Ang NE2(79) at 72.9409 44.2298 -0.0238314 in (null):Q-9999 (10) and CB(88) at 70.8391 42.4775 -0.489034 in (null):N-9999 (12) other bump:2.80396 Ang NE2(79) at 72.9409 44.2298 -0.0238314 in (null):Q-9999 (10) and CA(87) at 70.481 43.072 0.662 in (null):N-9999 (12) T0159 96 :SRYKEGKPVFYYTWT 1pot 216 :NPYMEGEVNLGMIWN Fragment has 45 clashes (null) has 45 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 17 residues other bump:2.30979 Ang CE2(94) at 79.0687 40.6647 8.12531 in (null):Y-9999 (11) and OG1(115) at 77.3386 39.3281 8.8706 in (null):T-9999 (13) other bump:3.02914 Ang CE2(94) at 79.0687 40.6647 8.12531 in (null):Y-9999 (11) and CB(113) at 77.1339 39.6978 10.246 in (null):T-9999 (13) neighbor-bump: 2.78291 Ang CD2(92) at 79.5197 41.9372 8.46055 in (null):Y-9999 (11) and C(110) at 77.56 42.656 10.301 in (null):Y-9999 (12) neighbor-bump: 2.29261 Ang CE2(94) at 79.0687 40.6647 8.12531 in (null):Y-9999 (11) and O(109) at 78.034 42.429 9.161 in (null):Y-9999 (12) neighbor-bump: 1.71464 Ang CD2(92) at 79.5197 41.9372 8.46055 in (null):Y-9999 (11) and O(109) at 78.034 42.429 9.161 in (null):Y-9999 (12) other bump:2.06082 Ang CD1(23) at 80.147 39.453 5.702 in (null):Y-9999 (3) and OH(96) at 79.5611 38.4439 7.40063 in (null):Y-9999 (11) other bump:2.08187 Ang CE1(25) at 79.789 40.375 6.657 in (null):Y-9999 (3) and OH(96) at 79.5611 38.4439 7.40063 in (null):Y-9999 (11) other bump:2.40684 Ang CZ(27) at 80.622 40.576 7.749 in (null):Y-9999 (3) and OH(96) at 79.5611 38.4439 7.40063 in (null):Y-9999 (11) other bump:2.42636 Ang CG(22) at 81.347 38.734 5.784 in (null):Y-9999 (3) and OH(96) at 79.5611 38.4439 7.40063 in (null):Y-9999 (11) other bump:2.72199 Ang CE2(26) at 81.821 39.887 7.869 in (null):Y-9999 (3) and OH(96) at 79.5611 38.4439 7.40063 in (null):Y-9999 (11) other bump:2.03431 Ang CD1(23) at 80.147 39.453 5.702 in (null):Y-9999 (3) and CZ(95) at 79.9844 39.7087 7.71361 in (null):Y-9999 (11) other bump:1.26433 Ang CE1(25) at 79.789 40.375 6.657 in (null):Y-9999 (3) and CZ(95) at 79.9844 39.7087 7.71361 in (null):Y-9999 (11) other bump:1.07703 Ang CZ(27) at 80.622 40.576 7.749 in (null):Y-9999 (3) and CZ(95) at 79.9844 39.7087 7.71361 in (null):Y-9999 (11) other bump:2.04012 Ang OH(28) at 80.303 41.444 8.738 in (null):Y-9999 (3) and CZ(95) at 79.9844 39.7087 7.71361 in (null):Y-9999 (11) other bump:2.55543 Ang CG(22) at 81.347 38.734 5.784 in (null):Y-9999 (3) and CZ(95) at 79.9844 39.7087 7.71361 in (null):Y-9999 (11) other bump:2.45486 Ang CD2(24) at 82.17 38.953 6.89 in (null):Y-9999 (3) and CZ(95) at 79.9844 39.7087 7.71361 in (null):Y-9999 (11) other bump:1.85178 Ang CE2(26) at 81.821 39.887 7.869 in (null):Y-9999 (3) and CZ(95) at 79.9844 39.7087 7.71361 in (null):Y-9999 (11) other bump:1.66092 Ang CE1(25) at 79.789 40.375 6.657 in (null):Y-9999 (3) and CE2(94) at 79.0687 40.6647 8.12531 in (null):Y-9999 (11) other bump:1.60069 Ang CZ(27) at 80.622 40.576 7.749 in (null):Y-9999 (3) and CE2(94) at 79.0687 40.6647 8.12531 in (null):Y-9999 (11) other bump:1.5831 Ang OH(28) at 80.303 41.444 8.738 in (null):Y-9999 (3) and CE2(94) at 79.0687 40.6647 8.12531 in (null):Y-9999 (11) other bump:2.32965 Ang CD1(23) at 80.147 39.453 5.702 in (null):Y-9999 (3) and CE1(93) at 81.3309 40.016 7.62781 in (null):Y-9999 (11) other bump:1.85705 Ang CE1(25) at 79.789 40.375 6.657 in (null):Y-9999 (3) and CE1(93) at 81.3309 40.016 7.62781 in (null):Y-9999 (11) other bump:0.911439 Ang CZ(27) at 80.622 40.576 7.749 in (null):Y-9999 (3) and CE1(93) at 81.3309 40.016 7.62781 in (null):Y-9999 (11) other bump:2.0804 Ang OH(28) at 80.303 41.444 8.738 in (null):Y-9999 (3) and CE1(93) at 81.3309 40.016 7.62781 in (null):Y-9999 (11) other bump:2.24578 Ang CG(22) at 81.347 38.734 5.784 in (null):Y-9999 (3) and CE1(93) at 81.3309 40.016 7.62781 in (null):Y-9999 (11) other bump:1.54226 Ang CD2(24) at 82.17 38.953 6.89 in (null):Y-9999 (3) and CE1(93) at 81.3309 40.016 7.62781 in (null):Y-9999 (11) other bump:0.561304 Ang CE2(26) at 81.821 39.887 7.869 in (null):Y-9999 (3) and CE1(93) at 81.3309 40.016 7.62781 in (null):Y-9999 (11) other bump:2.40118 Ang CE1(25) at 79.789 40.375 6.657 in (null):Y-9999 (3) and CD2(92) at 79.5197 41.9372 8.46055 in (null):Y-9999 (11) other bump:1.89051 Ang CZ(27) at 80.622 40.576 7.749 in (null):Y-9999 (3) and CD2(92) at 79.5197 41.9372 8.46055 in (null):Y-9999 (11) other bump:0.966271 Ang OH(28) at 80.303 41.444 8.738 in (null):Y-9999 (3) and CD2(92) at 79.5197 41.9372 8.46055 in (null):Y-9999 (11) other bump:2.54618 Ang CE1(25) at 79.789 40.375 6.657 in (null):Y-9999 (3) and CD1(91) at 81.7688 41.3018 7.96257 in (null):Y-9999 (11) other bump:1.37387 Ang CZ(27) at 80.622 40.576 7.749 in (null):Y-9999 (3) and CD1(91) at 81.7688 41.3018 7.96257 in (null):Y-9999 (11) other bump:1.66434 Ang OH(28) at 80.303 41.444 8.738 in (null):Y-9999 (3) and CD1(91) at 81.7688 41.3018 7.96257 in (null):Y-9999 (11) other bump:2.6131 Ang CD2(24) at 82.17 38.953 6.89 in (null):Y-9999 (3) and CD1(91) at 81.7688 41.3018 7.96257 in (null):Y-9999 (11) other bump:1.41886 Ang CE2(26) at 81.821 39.887 7.869 in (null):Y-9999 (3) and CD1(91) at 81.7688 41.3018 7.96257 in (null):Y-9999 (11) other bump:1.84089 Ang CZ(27) at 80.622 40.576 7.749 in (null):Y-9999 (3) and CG(90) at 80.8809 42.2859 8.37995 in (null):Y-9999 (11) other bump:1.08212 Ang OH(28) at 80.303 41.444 8.738 in (null):Y-9999 (3) and CG(90) at 80.8809 42.2859 8.37995 in (null):Y-9999 (11) other bump:2.62669 Ang CE2(26) at 81.821 39.887 7.869 in (null):Y-9999 (3) and CG(90) at 80.8809 42.2859 8.37995 in (null):Y-9999 (11) other bump:2.45374 Ang OH(28) at 80.303 41.444 8.738 in (null):Y-9999 (3) and CB(89) at 81.3094 43.6818 8.75665 in (null):Y-9999 (11) neighbor-bump: 2.64744 Ang C(86) at 83.662 42.718 9.495 in (null):F-9999 (10) and CB(89) at 81.3094 43.6818 8.75665 in (null):Y-9999 (11) neighbor-bump: 2.89828 Ang CG2(73) at 88.4736 41.8589 8.31969 in (null):V-9999 (9) and CD2(81) at 87.5426 43.7501 10.3088 in (null):F-9999 (10) neighbor-bump: 2.4412 Ang N(53) at 85.68 40.233 0.492 in (null):K-9999 (7) and CD(66) at 84.2296 41.6341 1.86773 in (null):P-9999 (8) neighbor-bump: 1.92408 Ang C(61) at 85.924 42.408 1.386 in (null):K-9999 (7) and CD(66) at 84.2296 41.6341 1.86773 in (null):P-9999 (8) other bump:1.81594 Ang OE1(45) at 82.02 40.453 -4.266 in (null):E-9999 (5) and NZ(59) at 83.1467 41.3315 -5.38689 in (null):K-9999 (7) other bump:2.45595 Ang OE1(45) at 82.02 40.453 -4.266 in (null):E-9999 (5) and CE(58) at 84.3662 41.1147 -4.56481 in (null):K-9999 (7) Number of specific fragments= 6 total=17 Number of alignments=5 # Reading fragments from alignment file # T0159 read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1pot/T0159-1pot-2track-protein-STR-local-adpstyle1.pw.a2m.gz # 1pot read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1pot/T0159-1pot-2track-protein-STR-local-adpstyle1.pw.a2m.gz # found chain 1pot in training set T0159 5 :REGVFVNGAAQGYLIDKKTADQYKITNIAQLKDPKI 1pot 124 :DYSIPYIWGATAIGVNGDAVDPKSVTSWADLWKPEY Fragment has 17 clashes (null) has 17 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 38 residues other bump:2.86145 Ang OD1(210) at 84.9673 46.8894 21.1633 in (null):N-9999 (27) and C(225) at 85.461 48.97 19.262 in (null):A-9999 (29) other bump:2.73571 Ang OD1(210) at 84.9673 46.8894 21.1633 in (null):N-9999 (27) and CA(222) at 84.272 49.32 20.118 in (null):A-9999 (29) other bump:2.19838 Ang OH(95) at 80.4722 46.8191 17.3608 in (null):Y-9999 (13) and CG2(217) at 80.1129 48.8968 17.9829 in (null):I-9999 (28) other bump:2.9117 Ang CE2(93) at 80.519 44.4842 17.8407 in (null):Y-9999 (13) and CG1(216) at 79.0567 46.7681 18.9006 in (null):I-9999 (28) other bump:2.78106 Ang CZ(94) at 80.5717 45.5201 16.9304 in (null):Y-9999 (13) and CG1(216) at 79.0567 46.7681 18.9006 in (null):I-9999 (28) other bump:2.0921 Ang OH(95) at 80.4722 46.8191 17.3608 in (null):Y-9999 (13) and CG1(216) at 79.0567 46.7681 18.9006 in (null):I-9999 (28) other bump:1.93377 Ang OH(95) at 80.4722 46.8191 17.3608 in (null):Y-9999 (13) and CB(215) at 80.2105 47.7943 19.01 in (null):I-9999 (28) other bump:2.93741 Ang CE2(93) at 80.519 44.4842 17.8407 in (null):Y-9999 (13) and CA(214) at 81.509 47.059 18.85 in (null):I-9999 (28) other bump:2.6328 Ang CZ(94) at 80.5717 45.5201 16.9304 in (null):Y-9999 (13) and CA(214) at 81.509 47.059 18.85 in (null):I-9999 (28) other bump:1.83036 Ang OH(95) at 80.4722 46.8191 17.3608 in (null):Y-9999 (13) and CA(214) at 81.509 47.059 18.85 in (null):I-9999 (28) other bump:3.04123 Ang CE2(93) at 80.519 44.4842 17.8407 in (null):Y-9999 (13) and N(213) at 81.831 46.187 19.992 in (null):I-9999 (28) other bump:3.25991 Ang CE2(93) at 80.519 44.4842 17.8407 in (null):Y-9999 (13) and C(212) at 82.882 45.373 19.903 in (null):N-9999 (27) other bump:2.86533 Ang CD1(111) at 84.5046 37.6924 15.3712 in (null):I-9999 (15) and CG2(194) at 85.8705 40.0757 16.1864 in (null):I-9999 (25) other bump:1.74819 Ang OD2(119) at 88.1665 36.0002 5.83151 in (null):D-9999 (16) and OG1(144) at 89.7353 35.2679 5.58918 in (null):T-9999 (19) other bump:2.82454 Ang OD2(119) at 88.1665 36.0002 5.83151 in (null):D-9999 (16) and CG2(143) at 90.5611 37.4036 6.35565 in (null):T-9999 (19) other bump:2.79456 Ang CG(117) at 87.244 35.5547 6.54543 in (null):D-9999 (16) and CB(142) at 89.9851 36.0526 6.76526 in (null):T-9999 (19) other bump:2.04494 Ang OD2(119) at 88.1665 36.0002 5.83151 in (null):D-9999 (16) and CB(142) at 89.9851 36.0526 6.76526 in (null):T-9999 (19) Number of specific fragments= 1 total=18 Number of alignments=6 # Reading fragments from alignment file # T0159 read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1a4uA/T0159-1a4uA-2track-protein-STR-local-adpstyle5.pw.a2m.gz # 1a4uA read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1a4uA/T0159-1a4uA-2track-protein-STR-local-adpstyle5.pw.a2m.gz # adding 1a4uA to template set 1a4uA:# found chain 1a4uA in template set T0159 48 :GDGKADLTGCNPGWGCEGAINHQLAAYELTNTVTHNQGNYAAMMADTI 1a4uA 2 :DLTNKNVIFVAALGGIGLDTSRELVKRNLKNFVILDRVENPTALAELK Fragment has 26 clashes (null) has 26 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 50 residues other bump:2.81877 Ang CA(81) at 12.524 -14.987 -4.597 in (null):G-9999 (13) and CE(310) at 10.8863 -15.3361 -6.86446 in (null):M-9999 (43) other bump:2.84447 Ang C(83) at 11.121 -14.611 -4.124 in (null):G-9999 (13) and CE(310) at 10.8863 -15.3361 -6.86446 in (null):M-9999 (43) other bump:3.26707 Ang CD2(288) at 9.22028 -19.9501 -7.23044 in (null):Y-9999 (40) and SD(309) at 9.98486 -16.8484 -6.54608 in (null):M-9999 (43) other bump:2.59464 Ang O(82) at 10.147 -15.265 -4.497 in (null):G-9999 (13) and SD(309) at 9.98486 -16.8484 -6.54608 in (null):M-9999 (43) other bump:2.60459 Ang CD2(288) at 9.22028 -19.9501 -7.23044 in (null):Y-9999 (40) and CG(308) at 10.1149 -17.6795 -8.14019 in (null):M-9999 (43) other bump:2.31057 Ang CG2(51) at 23.9885 -12.514 0.11064 in (null):T-9999 (8) and NE2(251) at 23.7429 -14.7728 0.530312 in (null):H-9999 (35) other bump:2.66161 Ang CG2(51) at 23.9885 -12.514 0.11064 in (null):T-9999 (8) and CD2(248) at 22.3892 -14.5772 0.629521 in (null):H-9999 (35) other bump:2.06087 Ang CG(76) at 17.0257 -14.1504 -3.50066 in (null):P-9999 (12) and CG2(240) at 17.7229 -16.0891 -3.55264 in (null):T-9999 (34) other bump:2.91775 Ang CD(77) at 16.7128 -13.783 -2.07791 in (null):P-9999 (12) and CG2(240) at 17.7229 -16.0891 -3.55264 in (null):T-9999 (34) other bump:2.83204 Ang CD1(204) at 23.479 -9.573 -10.197 in (null):L-9999 (29) and OG1(227) at 23.6104 -12.3329 -9.57571 in (null):T-9999 (32) other bump:2.66945 Ang CA(19) at 30.876 -8.51 -13.096 in (null):K-9999 (4) and CG2(211) at 31.3114 -10.9438 -12.0894 in (null):T-9999 (30) other bump:2.66723 Ang C(26) at 30.896 -8.359 -11.579 in (null):K-9999 (4) and CG2(211) at 31.3114 -10.9438 -12.0894 in (null):T-9999 (30) other bump:2.63806 Ang CD1(44) at 25.5945 -8.36617 -8.23537 in (null):L-9999 (7) and CD2(205) at 25.137 -7.791 -10.769 in (null):L-9999 (29) other bump:2.55186 Ang O(159) at 18.47 -6.449 -14.003 in (null):Q-9999 (23) and CE2(186) at 19.4265 -4.1147 -13.6181 in (null):Y-9999 (27) other bump:2.58275 Ang O(159) at 18.47 -6.449 -14.003 in (null):Q-9999 (23) and CD2(184) at 20.5345 -4.95004 -13.6012 in (null):Y-9999 (27) other bump:2.38533 Ang O(119) at 12.466 -10.797 -9.812 in (null):G-9999 (18) and CD2(146) at 11.4814 -11.3677 -11.9083 in (null):H-9999 (22) other bump:3.09134 Ang C(120) at 11.644 -10.552 -8.931 in (null):G-9999 (18) and CD2(146) at 11.4814 -11.3677 -11.9083 in (null):H-9999 (22) other bump:2.65582 Ang CB(67) at 13.9963 -12.3484 1.17652 in (null):N-9999 (11) and OE1(113) at 13.1813 -11.7039 -1.26763 in (null):E-9999 (17) other bump:0.541215 Ang O(71) at 13.653 -11.744 -1.53 in (null):N-9999 (11) and OE1(113) at 13.1813 -11.7039 -1.26763 in (null):E-9999 (17) other bump:1.61493 Ang C(72) at 14.564 -12.538 -1.29 in (null):N-9999 (11) and OE1(113) at 13.1813 -11.7039 -1.26763 in (null):E-9999 (17) other bump:2.52622 Ang CA(66) at 14.794 -13.062 0.124 in (null):N-9999 (11) and OE1(113) at 13.1813 -11.7039 -1.26763 in (null):E-9999 (17) other bump:1.50692 Ang O(71) at 13.653 -11.744 -1.53 in (null):N-9999 (11) and CD(112) at 12.9699 -10.4823 -1.06924 in (null):E-9999 (17) other bump:2.61071 Ang C(72) at 14.564 -12.538 -1.29 in (null):N-9999 (11) and CD(112) at 12.9699 -10.4823 -1.06924 in (null):E-9999 (17) other bump:2.46192 Ang O(71) at 13.653 -11.744 -1.53 in (null):N-9999 (11) and CG(111) at 12.7883 -9.55555 -2.2539 in (null):E-9999 (17) other bump:2.59534 Ang O(96) at 10.085 -10.835 -3.287 in (null):W-9999 (14) and CB(110) at 12.603 -10.2742 -3.5712 in (null):E-9999 (17) other bump:2.62997 Ang O(57) at 19.17 -13.097 -1.439 in (null):G-9999 (9) and CD(77) at 16.7128 -13.783 -2.07791 in (null):P-9999 (12) T0159 97 :RYKEGKPVFYYTWTP 1a4uA 50 :AINPKVNITFHTYDV Fragment has 25 clashes (null) has 25 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 17 residues other bump:2.90888 Ang CZ3(122) at 18.3749 -13.9123 5.86341 in (null):W-9999 (13) and CG(136) at 15.7077 -14.1844 6.99184 in (null):P-9999 (15) other bump:3.14177 Ang CZ3(122) at 18.3749 -13.9123 5.86341 in (null):W-9999 (13) and CB(135) at 16.2945 -13.5223 8.18518 in (null):P-9999 (15) other bump:3.19128 Ang CH2(123) at 19.1985 -13.3794 6.86957 in (null):W-9999 (13) and CB(135) at 16.2945 -13.5223 8.18518 in (null):P-9999 (15) other bump:2.96575 Ang CD1(74) at 25.5333 -22.0476 -4.73096 in (null):F-9999 (9) and OH(102) at 27.3226 -20.5892 -2.86895 in (null):Y-9999 (11) other bump:2.57808 Ang CZ(78) at 25.5425 -22.377 -2.33833 in (null):F-9999 (9) and OH(102) at 27.3226 -20.5892 -2.86895 in (null):Y-9999 (11) other bump:2.47472 Ang CD2(75) at 24.9059 -20.2517 -3.28133 in (null):F-9999 (9) and OH(102) at 27.3226 -20.5892 -2.86895 in (null):Y-9999 (11) other bump:2.35632 Ang CE2(77) at 25.1234 -21.0669 -2.17073 in (null):F-9999 (9) and OH(102) at 27.3226 -20.5892 -2.86895 in (null):Y-9999 (11) other bump:2.81605 Ang CE1(76) at 25.7498 -22.8687 -3.61451 in (null):F-9999 (9) and CZ(101) at 26.2173 -20.5729 -2.05208 in (null):Y-9999 (11) other bump:1.94728 Ang CZ(78) at 25.5425 -22.377 -2.33833 in (null):F-9999 (9) and CZ(101) at 26.2173 -20.5729 -2.05208 in (null):Y-9999 (11) other bump:2.75432 Ang CG(73) at 25.1149 -20.7282 -4.5714 in (null):F-9999 (9) and CZ(101) at 26.2173 -20.5729 -2.05208 in (null):Y-9999 (11) other bump:1.82593 Ang CD2(75) at 24.9059 -20.2517 -3.28133 in (null):F-9999 (9) and CZ(101) at 26.2173 -20.5729 -2.05208 in (null):Y-9999 (11) other bump:1.20613 Ang CE2(77) at 25.1234 -21.0669 -2.17073 in (null):F-9999 (9) and CZ(101) at 26.2173 -20.5729 -2.05208 in (null):Y-9999 (11) other bump:2.86176 Ang CZ(78) at 25.5425 -22.377 -2.33833 in (null):F-9999 (9) and CE2(100) at 25.3336 -19.5357 -2.06817 in (null):Y-9999 (11) other bump:2.78138 Ang CG(73) at 25.1149 -20.7282 -4.5714 in (null):F-9999 (9) and CE2(100) at 25.3336 -19.5357 -2.06817 in (null):Y-9999 (11) other bump:1.47219 Ang CD2(75) at 24.9059 -20.2517 -3.28133 in (null):F-9999 (9) and CE2(100) at 25.3336 -19.5357 -2.06817 in (null):Y-9999 (11) other bump:1.54899 Ang CE2(77) at 25.1234 -21.0669 -2.17073 in (null):F-9999 (9) and CE2(100) at 25.3336 -19.5357 -2.06817 in (null):Y-9999 (11) other bump:2.63498 Ang CE1(76) at 25.7498 -22.8687 -3.61451 in (null):F-9999 (9) and CE1(99) at 25.9843 -21.6866 -1.27124 in (null):Y-9999 (11) other bump:1.34556 Ang CZ(78) at 25.5425 -22.377 -2.33833 in (null):F-9999 (9) and CE1(99) at 25.9843 -21.6866 -1.27124 in (null):Y-9999 (11) other bump:2.69493 Ang CD2(75) at 24.9059 -20.2517 -3.28133 in (null):F-9999 (9) and CE1(99) at 25.9843 -21.6866 -1.27124 in (null):Y-9999 (11) other bump:1.39083 Ang CE2(77) at 25.1234 -21.0669 -2.17073 in (null):F-9999 (9) and CE1(99) at 25.9843 -21.6866 -1.27124 in (null):Y-9999 (11) other bump:2.27958 Ang CD2(75) at 24.9059 -20.2517 -3.28133 in (null):F-9999 (9) and CD2(98) at 24.2075 -19.5559 -1.22593 in (null):Y-9999 (11) other bump:2.00363 Ang CE2(77) at 25.1234 -21.0669 -2.17073 in (null):F-9999 (9) and CD2(98) at 24.2075 -19.5559 -1.22593 in (null):Y-9999 (11) other bump:2.11269 Ang CZ(78) at 25.5425 -22.377 -2.33833 in (null):F-9999 (9) and CD1(97) at 24.85 -21.6996 -0.460833 in (null):Y-9999 (11) other bump:1.84359 Ang CE2(77) at 25.1234 -21.0669 -2.17073 in (null):F-9999 (9) and CD1(97) at 24.85 -21.6996 -0.460833 in (null):Y-9999 (11) other bump:2.11859 Ang CE2(77) at 25.1234 -21.0669 -2.17073 in (null):F-9999 (9) and CG(96) at 23.9689 -20.6522 -0.443387 in (null):Y-9999 (11) Number of specific fragments= 2 total=20 Number of alignments=7 # Reading fragments from alignment file # T0159 read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1a4uA/T0159-1a4uA-2track-protein-STR-local-adpstyle1.pw.a2m.gz # 1a4uA read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1a4uA/T0159-1a4uA-2track-protein-STR-local-adpstyle1.pw.a2m.gz # found chain 1a4uA in template set T0159 48 :GDGKADLTGCNPGWGCEGAINHQLAAYELTNTVTHNQGNYAAMMADT 1a4uA 2 :DLTNKNVIFVAALGGIGLDTSRELVKRNLKNFVILDRVENPTALAEL Fragment has 26 clashes (null) has 26 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 49 residues other bump:2.81877 Ang CA(81) at 12.524 -14.987 -4.597 in (null):G-9999 (13) and CE(310) at 10.8863 -15.3361 -6.86446 in (null):M-9999 (43) other bump:2.84447 Ang C(83) at 11.121 -14.611 -4.124 in (null):G-9999 (13) and CE(310) at 10.8863 -15.3361 -6.86446 in (null):M-9999 (43) other bump:3.26707 Ang CD2(288) at 9.22028 -19.9501 -7.23044 in (null):Y-9999 (40) and SD(309) at 9.98486 -16.8484 -6.54608 in (null):M-9999 (43) other bump:2.59464 Ang O(82) at 10.147 -15.265 -4.497 in (null):G-9999 (13) and SD(309) at 9.98486 -16.8484 -6.54608 in (null):M-9999 (43) other bump:2.60459 Ang CD2(288) at 9.22028 -19.9501 -7.23044 in (null):Y-9999 (40) and CG(308) at 10.1149 -17.6795 -8.14019 in (null):M-9999 (43) other bump:2.31057 Ang CG2(51) at 23.9885 -12.514 0.11064 in (null):T-9999 (8) and NE2(251) at 23.7429 -14.7728 0.530312 in (null):H-9999 (35) other bump:2.66161 Ang CG2(51) at 23.9885 -12.514 0.11064 in (null):T-9999 (8) and CD2(248) at 22.3892 -14.5772 0.629521 in (null):H-9999 (35) other bump:2.06087 Ang CG(76) at 17.0257 -14.1504 -3.50066 in (null):P-9999 (12) and CG2(240) at 17.7229 -16.0891 -3.55264 in (null):T-9999 (34) other bump:2.91775 Ang CD(77) at 16.7128 -13.783 -2.07791 in (null):P-9999 (12) and CG2(240) at 17.7229 -16.0891 -3.55264 in (null):T-9999 (34) other bump:2.83204 Ang CD1(204) at 23.479 -9.573 -10.197 in (null):L-9999 (29) and OG1(227) at 23.6104 -12.3329 -9.57571 in (null):T-9999 (32) other bump:2.66945 Ang CA(19) at 30.876 -8.51 -13.096 in (null):K-9999 (4) and CG2(211) at 31.3114 -10.9438 -12.0894 in (null):T-9999 (30) other bump:2.66723 Ang C(26) at 30.896 -8.359 -11.579 in (null):K-9999 (4) and CG2(211) at 31.3114 -10.9438 -12.0894 in (null):T-9999 (30) other bump:2.63806 Ang CD1(44) at 25.5945 -8.36617 -8.23537 in (null):L-9999 (7) and CD2(205) at 25.137 -7.791 -10.769 in (null):L-9999 (29) other bump:2.55186 Ang O(159) at 18.47 -6.449 -14.003 in (null):Q-9999 (23) and CE2(186) at 19.4265 -4.1147 -13.6181 in (null):Y-9999 (27) other bump:2.58275 Ang O(159) at 18.47 -6.449 -14.003 in (null):Q-9999 (23) and CD2(184) at 20.5345 -4.95004 -13.6012 in (null):Y-9999 (27) other bump:2.38533 Ang O(119) at 12.466 -10.797 -9.812 in (null):G-9999 (18) and CD2(146) at 11.4814 -11.3677 -11.9083 in (null):H-9999 (22) other bump:3.09134 Ang C(120) at 11.644 -10.552 -8.931 in (null):G-9999 (18) and CD2(146) at 11.4814 -11.3677 -11.9083 in (null):H-9999 (22) other bump:2.65582 Ang CB(67) at 13.9963 -12.3484 1.17652 in (null):N-9999 (11) and OE1(113) at 13.1813 -11.7039 -1.26763 in (null):E-9999 (17) other bump:0.541215 Ang O(71) at 13.653 -11.744 -1.53 in (null):N-9999 (11) and OE1(113) at 13.1813 -11.7039 -1.26763 in (null):E-9999 (17) other bump:1.61493 Ang C(72) at 14.564 -12.538 -1.29 in (null):N-9999 (11) and OE1(113) at 13.1813 -11.7039 -1.26763 in (null):E-9999 (17) other bump:2.52622 Ang CA(66) at 14.794 -13.062 0.124 in (null):N-9999 (11) and OE1(113) at 13.1813 -11.7039 -1.26763 in (null):E-9999 (17) other bump:1.50692 Ang O(71) at 13.653 -11.744 -1.53 in (null):N-9999 (11) and CD(112) at 12.9699 -10.4823 -1.06924 in (null):E-9999 (17) other bump:2.61071 Ang C(72) at 14.564 -12.538 -1.29 in (null):N-9999 (11) and CD(112) at 12.9699 -10.4823 -1.06924 in (null):E-9999 (17) other bump:2.46192 Ang O(71) at 13.653 -11.744 -1.53 in (null):N-9999 (11) and CG(111) at 12.7883 -9.55555 -2.2539 in (null):E-9999 (17) other bump:2.59534 Ang O(96) at 10.085 -10.835 -3.287 in (null):W-9999 (14) and CB(110) at 12.603 -10.2742 -3.5712 in (null):E-9999 (17) other bump:2.62997 Ang O(57) at 19.17 -13.097 -1.439 in (null):G-9999 (9) and CD(77) at 16.7128 -13.783 -2.07791 in (null):P-9999 (12) T0159 96 :SRYKEGKPVFYYTW 1a4uA 49 :KAINPKVNITFHTY Fragment has 22 clashes (null) has 22 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 16 residues other bump:2.96575 Ang CD1(80) at 25.5333 -22.0476 -4.73096 in (null):F-9999 (10) and OH(108) at 27.3226 -20.5892 -2.86895 in (null):Y-9999 (12) other bump:2.57808 Ang CZ(84) at 25.5425 -22.377 -2.33833 in (null):F-9999 (10) and OH(108) at 27.3226 -20.5892 -2.86895 in (null):Y-9999 (12) other bump:2.47472 Ang CD2(81) at 24.9059 -20.2517 -3.28133 in (null):F-9999 (10) and OH(108) at 27.3226 -20.5892 -2.86895 in (null):Y-9999 (12) other bump:2.35632 Ang CE2(83) at 25.1234 -21.0669 -2.17073 in (null):F-9999 (10) and OH(108) at 27.3226 -20.5892 -2.86895 in (null):Y-9999 (12) other bump:2.81605 Ang CE1(82) at 25.7498 -22.8687 -3.61451 in (null):F-9999 (10) and CZ(107) at 26.2173 -20.5729 -2.05208 in (null):Y-9999 (12) other bump:1.94728 Ang CZ(84) at 25.5425 -22.377 -2.33833 in (null):F-9999 (10) and CZ(107) at 26.2173 -20.5729 -2.05208 in (null):Y-9999 (12) other bump:2.75432 Ang CG(79) at 25.1149 -20.7282 -4.5714 in (null):F-9999 (10) and CZ(107) at 26.2173 -20.5729 -2.05208 in (null):Y-9999 (12) other bump:1.82593 Ang CD2(81) at 24.9059 -20.2517 -3.28133 in (null):F-9999 (10) and CZ(107) at 26.2173 -20.5729 -2.05208 in (null):Y-9999 (12) other bump:1.20613 Ang CE2(83) at 25.1234 -21.0669 -2.17073 in (null):F-9999 (10) and CZ(107) at 26.2173 -20.5729 -2.05208 in (null):Y-9999 (12) other bump:2.86176 Ang CZ(84) at 25.5425 -22.377 -2.33833 in (null):F-9999 (10) and CE2(106) at 25.3336 -19.5357 -2.06817 in (null):Y-9999 (12) other bump:2.78138 Ang CG(79) at 25.1149 -20.7282 -4.5714 in (null):F-9999 (10) and CE2(106) at 25.3336 -19.5357 -2.06817 in (null):Y-9999 (12) other bump:1.47219 Ang CD2(81) at 24.9059 -20.2517 -3.28133 in (null):F-9999 (10) and CE2(106) at 25.3336 -19.5357 -2.06817 in (null):Y-9999 (12) other bump:1.54899 Ang CE2(83) at 25.1234 -21.0669 -2.17073 in (null):F-9999 (10) and CE2(106) at 25.3336 -19.5357 -2.06817 in (null):Y-9999 (12) other bump:2.63498 Ang CE1(82) at 25.7498 -22.8687 -3.61451 in (null):F-9999 (10) and CE1(105) at 25.9843 -21.6866 -1.27124 in (null):Y-9999 (12) other bump:1.34556 Ang CZ(84) at 25.5425 -22.377 -2.33833 in (null):F-9999 (10) and CE1(105) at 25.9843 -21.6866 -1.27124 in (null):Y-9999 (12) other bump:2.69493 Ang CD2(81) at 24.9059 -20.2517 -3.28133 in (null):F-9999 (10) and CE1(105) at 25.9843 -21.6866 -1.27124 in (null):Y-9999 (12) other bump:1.39083 Ang CE2(83) at 25.1234 -21.0669 -2.17073 in (null):F-9999 (10) and CE1(105) at 25.9843 -21.6866 -1.27124 in (null):Y-9999 (12) other bump:2.27958 Ang CD2(81) at 24.9059 -20.2517 -3.28133 in (null):F-9999 (10) and CD2(104) at 24.2075 -19.5559 -1.22593 in (null):Y-9999 (12) other bump:2.00363 Ang CE2(83) at 25.1234 -21.0669 -2.17073 in (null):F-9999 (10) and CD2(104) at 24.2075 -19.5559 -1.22593 in (null):Y-9999 (12) other bump:2.11269 Ang CZ(84) at 25.5425 -22.377 -2.33833 in (null):F-9999 (10) and CD1(103) at 24.85 -21.6996 -0.460833 in (null):Y-9999 (12) other bump:1.84359 Ang CE2(83) at 25.1234 -21.0669 -2.17073 in (null):F-9999 (10) and CD1(103) at 24.85 -21.6996 -0.460833 in (null):Y-9999 (12) other bump:2.11859 Ang CE2(83) at 25.1234 -21.0669 -2.17073 in (null):F-9999 (10) and CG(102) at 23.9689 -20.6522 -0.443387 in (null):Y-9999 (12) Number of specific fragments= 2 total=22 Number of alignments=8 # Reading fragments from alignment file # T0159 read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1cl1A/T0159-1cl1A-2track-protein-STR-local-adpstyle1.pw.a2m.gz # 1cl1A read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1cl1A/T0159-1cl1A-2track-protein-STR-local-adpstyle1.pw.a2m.gz # adding 1cl1A to template set 1cl1A:Bad short name: N1 for alphabet: pdb_atoms Bad short name: C2 for alphabet: pdb_atoms Bad short name: C2A for alphabet: pdb_atoms Bad short name: C3 for alphabet: pdb_atoms Bad short name: O3 for alphabet: pdb_atoms Bad short name: C4 for alphabet: pdb_atoms Bad short name: C4A for alphabet: pdb_atoms Bad short name: C5 for alphabet: pdb_atoms Bad short name: C6 for alphabet: pdb_atoms Bad short name: C5A for alphabet: pdb_atoms Bad short name: O4P for alphabet: pdb_atoms Bad short name: P for alphabet: pdb_atoms Bad short name: O1P for alphabet: pdb_atoms Bad short name: O2P for alphabet: pdb_atoms Bad short name: O3P for alphabet: pdb_atoms # found chain 1cl1A in template set T0159 48 :GDGKADLTGCNPGWGCEGAINHQLAAYELTNTVTHNQGNYAAMMADTISRYKEGKPVFYY 1cl1A 48 :NRANGELFYGRRGTLTHFSLQQAMCELEGGAGCVLFPCGAAAVANSILAFIEQGDHVLMT Fragment has 45 clashes (null) has 45 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 62 residues other bump:2.1093 Ang CG1(419) at 0.014 -6.549 51 in (null):V-9999 (57) and OH(443) at 0.778562 -4.88599 49.9517 in (null):Y-9999 (59) other bump:1.74085 Ang CG1(419) at 0.014 -6.549 51 in (null):V-9999 (57) and CZ(442) at -0.0605636 -4.81028 51.0431 in (null):Y-9999 (59) other bump:3.03784 Ang CG1(419) at 0.014 -6.549 51 in (null):V-9999 (57) and CE2(441) at -0.29582 -3.60009 51.6606 in (null):Y-9999 (59) other bump:2.39121 Ang CB(418) at 0.042 -7.927 50.318 in (null):V-9999 (57) and CE1(440) at -0.655893 -5.96729 51.4971 in (null):Y-9999 (59) other bump:1.017 Ang CG1(419) at 0.014 -6.549 51 in (null):V-9999 (57) and CE1(440) at -0.655893 -5.96729 51.4971 in (null):Y-9999 (59) other bump:2.28968 Ang CG1(419) at 0.014 -6.549 51 in (null):V-9999 (57) and CD1(438) at -1.5015 -5.91191 52.5937 in (null):Y-9999 (59) neighbor-bump: 2.03116 Ang C(408) at 2.171 -13.008 47.581 in (null):K-9999 (55) and CD(413) at 3.12743 -14.0036 49.0709 in (null):P-9999 (56) other bump:0.77655 Ang CD1(346) at 0.303735 -3.63133 41.6233 in (null):I-9999 (48) and OH(375) at 0.975101 -3.79047 41.267 in (null):Y-9999 (51) other bump:1.76857 Ang CG1(344) at 0.784284 -2.21858 42.0548 in (null):I-9999 (48) and OH(375) at 0.975101 -3.79047 41.267 in (null):Y-9999 (51) other bump:2.82983 Ang CA(342) at 3.081 -2.854 42.909 in (null):I-9999 (48) and OH(375) at 0.975101 -3.79047 41.267 in (null):Y-9999 (51) other bump:2.56065 Ang CG2(345) at 2.72453 -2.10159 40.4644 in (null):I-9999 (48) and OH(375) at 0.975101 -3.79047 41.267 in (null):Y-9999 (51) other bump:2.35969 Ang CB(343) at 2.27117 -1.92127 41.895 in (null):I-9999 (48) and OH(375) at 0.975101 -3.79047 41.267 in (null):Y-9999 (51) other bump:1.76187 Ang CD1(346) at 0.303735 -3.63133 41.6233 in (null):I-9999 (48) and CZ(374) at 1.62769 -4.70993 42.0569 in (null):Y-9999 (51) other bump:2.63024 Ang CG1(344) at 0.784284 -2.21858 42.0548 in (null):I-9999 (48) and CZ(374) at 1.62769 -4.70993 42.0569 in (null):Y-9999 (51) other bump:2.50653 Ang CA(342) at 3.081 -2.854 42.909 in (null):I-9999 (48) and CZ(374) at 1.62769 -4.70993 42.0569 in (null):Y-9999 (51) other bump:2.86651 Ang CB(343) at 2.27117 -1.92127 41.895 in (null):I-9999 (48) and CZ(374) at 1.62769 -4.70993 42.0569 in (null):Y-9999 (51) other bump:2.59265 Ang CD1(346) at 0.303735 -3.63133 41.6233 in (null):I-9999 (48) and CE2(373) at 2.23111 -4.2849 43.2295 in (null):Y-9999 (51) other bump:2.78264 Ang CG1(344) at 0.784284 -2.21858 42.0548 in (null):I-9999 (48) and CE2(373) at 2.23111 -4.2849 43.2295 in (null):Y-9999 (51) other bump:1.69486 Ang CA(342) at 3.081 -2.854 42.909 in (null):I-9999 (48) and CE2(373) at 2.23111 -4.2849 43.2295 in (null):Y-9999 (51) other bump:2.7662 Ang C(348) at 4.563 -2.97 42.533 in (null):I-9999 (48) and CE2(373) at 2.23111 -4.2849 43.2295 in (null):Y-9999 (51) other bump:2.8722 Ang C(340) at 3.424 -2.731 45.33 in (null):T-9999 (47) and CE2(373) at 2.23111 -4.2849 43.2295 in (null):Y-9999 (51) other bump:2.35461 Ang N(341) at 2.87 -2.247 44.221 in (null):I-9999 (48) and CE2(373) at 2.23111 -4.2849 43.2295 in (null):Y-9999 (51) other bump:2.71464 Ang CB(343) at 2.27117 -1.92127 41.895 in (null):I-9999 (48) and CE2(373) at 2.23111 -4.2849 43.2295 in (null):Y-9999 (51) other bump:2.782 Ang CD1(346) at 0.303735 -3.63133 41.6233 in (null):I-9999 (48) and CE1(372) at 1.6921 -6.04154 41.6768 in (null):Y-9999 (51) other bump:2.36566 Ang O(339) at 4.192 -3.704 45.329 in (null):T-9999 (47) and CD2(371) at 2.90337 -5.19851 44.0243 in (null):Y-9999 (51) other bump:2.60234 Ang CA(342) at 3.081 -2.854 42.909 in (null):I-9999 (48) and CD2(371) at 2.90337 -5.19851 44.0243 in (null):Y-9999 (51) other bump:3.15351 Ang C(348) at 4.563 -2.97 42.533 in (null):I-9999 (48) and CD2(371) at 2.90337 -5.19851 44.0243 in (null):Y-9999 (51) other bump:2.83981 Ang C(340) at 3.424 -2.731 45.33 in (null):T-9999 (47) and CD2(371) at 2.90337 -5.19851 44.0243 in (null):Y-9999 (51) other bump:3.08106 Ang CG(257) at 1.58495 8.58009 43.1014 in (null):N-9999 (36) and N(300) at 0.56 6.735 45.346 in (null):A-9999 (42) other bump:3.18698 Ang CG(257) at 1.58495 8.58009 43.1014 in (null):N-9999 (36) and C(299) at 0.148 6.004 44.308 in (null):A-9999 (41) other bump:2.92532 Ang CD(266) at -1.04913 9.27327 40.2464 in (null):Q-9999 (37) and CB(297) at -0.861 7.51 42.573 in (null):A-9999 (41) other bump:2.90919 Ang OE1(267) at 0.177967 9.11626 40.3812 in (null):Q-9999 (37) and CB(297) at -0.861 7.51 42.573 in (null):A-9999 (41) other bump:2.72158 Ang CG(257) at 1.58495 8.58009 43.1014 in (null):N-9999 (36) and CB(297) at -0.861 7.51 42.573 in (null):A-9999 (41) other bump:2.0389 Ang OD1(259) at 0.439878 9.01053 43.0348 in (null):N-9999 (36) and CB(297) at -0.861 7.51 42.573 in (null):A-9999 (41) other bump:2.57665 Ang CG(137) at 12.3443 14.2522 44.6608 in (null):N-9999 (21) and NE2(251) at 9.79961 14.6513 44.7268 in (null):H-9999 (35) other bump:1.61263 Ang OD1(139) at 11.2225 13.9986 45.1139 in (null):N-9999 (21) and NE2(251) at 9.79961 14.6513 44.7268 in (null):H-9999 (35) other bump:2.75489 Ang OD1(139) at 11.2225 13.9986 45.1139 in (null):N-9999 (21) and CE1(250) at 8.734 15.1658 45.2989 in (null):H-9999 (35) other bump:2.2547 Ang OD1(139) at 11.2225 13.9986 45.1139 in (null):N-9999 (21) and CD2(248) at 9.40846 13.7015 43.8082 in (null):H-9999 (35) other bump:2.92997 Ang CG(155) at 12.0202 20.0357 52.2275 in (null):Q-9999 (23) and CZ(187) at 12.5393 20.436 55.0832 in (null):Y-9999 (27) other bump:2.10072 Ang CG(155) at 12.0202 20.0357 52.2275 in (null):Q-9999 (23) and CE1(185) at 12.5663 19.4039 54.1551 in (null):Y-9999 (27) other bump:2.59264 Ang O(159) at 13.343 17.107 53.237 in (null):Q-9999 (23) and CE1(185) at 12.5663 19.4039 54.1551 in (null):Y-9999 (27) other bump:3.09508 Ang C(160) at 13.177 17.247 52.021 in (null):Q-9999 (23) and CE1(185) at 12.5663 19.4039 54.1551 in (null):Y-9999 (27) other bump:1.93429 Ang O(159) at 13.343 17.107 53.237 in (null):Q-9999 (23) and CD1(183) at 12.3587 18.0922 54.5794 in (null):Y-9999 (27) other bump:2.83094 Ang CD1(88) at 12.0853 22.8478 37.3783 in (null):W-9999 (14) and N(102) at 12.622 21.959 40.012 in (null):C-9999 (16) neighbor-bump: 2.47222 Ang C(26) at 20.743 12.675 39.72 in (null):K-9999 (4) and CB(29) at 20.5515 14.7296 41.0815 in (null):A-9999 (5) Number of specific fragments= 1 total=23 Number of alignments=9 # Reading fragments from alignment file # T0159 read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1cl1A/T0159-1cl1A-2track-protein-STR-local-adpstyle5.pw.a2m.gz # 1cl1A read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1cl1A/T0159-1cl1A-2track-protein-STR-local-adpstyle5.pw.a2m.gz # found chain 1cl1A in template set T0159 52 :ADLTGCNPGWGCEGAINHQLAAYELTNTVTHNQGNYAAMMADTISRYKEGKPVFYY 1cl1A 52 :GELFYGRRGTLTHFSLQQAMCELEGGAGCVLFPCGAAAVANSILAFIEQGDHVLMT Fragment has 45 clashes (null) has 45 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 58 residues other bump:2.1093 Ang CG1(394) at 0.014 -6.549 51 in (null):V-9999 (53) and OH(418) at 0.778562 -4.88599 49.9517 in (null):Y-9999 (55) other bump:1.74085 Ang CG1(394) at 0.014 -6.549 51 in (null):V-9999 (53) and CZ(417) at -0.0605636 -4.81028 51.0431 in (null):Y-9999 (55) other bump:3.03784 Ang CG1(394) at 0.014 -6.549 51 in (null):V-9999 (53) and CE2(416) at -0.29582 -3.60009 51.6606 in (null):Y-9999 (55) other bump:2.39121 Ang CB(393) at 0.042 -7.927 50.318 in (null):V-9999 (53) and CE1(415) at -0.655893 -5.96729 51.4971 in (null):Y-9999 (55) other bump:1.017 Ang CG1(394) at 0.014 -6.549 51 in (null):V-9999 (53) and CE1(415) at -0.655893 -5.96729 51.4971 in (null):Y-9999 (55) other bump:2.28968 Ang CG1(394) at 0.014 -6.549 51 in (null):V-9999 (53) and CD1(413) at -1.5015 -5.91191 52.5937 in (null):Y-9999 (55) neighbor-bump: 2.03116 Ang C(383) at 2.171 -13.008 47.581 in (null):K-9999 (51) and CD(388) at 3.12743 -14.0036 49.0709 in (null):P-9999 (52) other bump:0.77655 Ang CD1(321) at 0.303735 -3.63133 41.6233 in (null):I-9999 (44) and OH(350) at 0.975101 -3.79047 41.267 in (null):Y-9999 (47) other bump:1.76857 Ang CG1(319) at 0.784284 -2.21858 42.0548 in (null):I-9999 (44) and OH(350) at 0.975101 -3.79047 41.267 in (null):Y-9999 (47) other bump:2.82983 Ang CA(317) at 3.081 -2.854 42.909 in (null):I-9999 (44) and OH(350) at 0.975101 -3.79047 41.267 in (null):Y-9999 (47) other bump:2.56065 Ang CG2(320) at 2.72453 -2.10159 40.4644 in (null):I-9999 (44) and OH(350) at 0.975101 -3.79047 41.267 in (null):Y-9999 (47) other bump:2.35969 Ang CB(318) at 2.27117 -1.92127 41.895 in (null):I-9999 (44) and OH(350) at 0.975101 -3.79047 41.267 in (null):Y-9999 (47) other bump:1.76187 Ang CD1(321) at 0.303735 -3.63133 41.6233 in (null):I-9999 (44) and CZ(349) at 1.62769 -4.70993 42.0569 in (null):Y-9999 (47) other bump:2.63024 Ang CG1(319) at 0.784284 -2.21858 42.0548 in (null):I-9999 (44) and CZ(349) at 1.62769 -4.70993 42.0569 in (null):Y-9999 (47) other bump:2.50653 Ang CA(317) at 3.081 -2.854 42.909 in (null):I-9999 (44) and CZ(349) at 1.62769 -4.70993 42.0569 in (null):Y-9999 (47) other bump:2.86651 Ang CB(318) at 2.27117 -1.92127 41.895 in (null):I-9999 (44) and CZ(349) at 1.62769 -4.70993 42.0569 in (null):Y-9999 (47) other bump:2.59265 Ang CD1(321) at 0.303735 -3.63133 41.6233 in (null):I-9999 (44) and CE2(348) at 2.23111 -4.2849 43.2295 in (null):Y-9999 (47) other bump:2.78264 Ang CG1(319) at 0.784284 -2.21858 42.0548 in (null):I-9999 (44) and CE2(348) at 2.23111 -4.2849 43.2295 in (null):Y-9999 (47) other bump:1.69486 Ang CA(317) at 3.081 -2.854 42.909 in (null):I-9999 (44) and CE2(348) at 2.23111 -4.2849 43.2295 in (null):Y-9999 (47) other bump:2.7662 Ang C(323) at 4.563 -2.97 42.533 in (null):I-9999 (44) and CE2(348) at 2.23111 -4.2849 43.2295 in (null):Y-9999 (47) other bump:2.8722 Ang C(315) at 3.424 -2.731 45.33 in (null):T-9999 (43) and CE2(348) at 2.23111 -4.2849 43.2295 in (null):Y-9999 (47) other bump:2.35461 Ang N(316) at 2.87 -2.247 44.221 in (null):I-9999 (44) and CE2(348) at 2.23111 -4.2849 43.2295 in (null):Y-9999 (47) other bump:2.71464 Ang CB(318) at 2.27117 -1.92127 41.895 in (null):I-9999 (44) and CE2(348) at 2.23111 -4.2849 43.2295 in (null):Y-9999 (47) other bump:2.782 Ang CD1(321) at 0.303735 -3.63133 41.6233 in (null):I-9999 (44) and CE1(347) at 1.6921 -6.04154 41.6768 in (null):Y-9999 (47) other bump:2.36566 Ang O(314) at 4.192 -3.704 45.329 in (null):T-9999 (43) and CD2(346) at 2.90337 -5.19851 44.0243 in (null):Y-9999 (47) other bump:2.60234 Ang CA(317) at 3.081 -2.854 42.909 in (null):I-9999 (44) and CD2(346) at 2.90337 -5.19851 44.0243 in (null):Y-9999 (47) other bump:3.15351 Ang C(323) at 4.563 -2.97 42.533 in (null):I-9999 (44) and CD2(346) at 2.90337 -5.19851 44.0243 in (null):Y-9999 (47) other bump:2.83981 Ang C(315) at 3.424 -2.731 45.33 in (null):T-9999 (43) and CD2(346) at 2.90337 -5.19851 44.0243 in (null):Y-9999 (47) other bump:3.08106 Ang CG(232) at 1.58495 8.58009 43.1014 in (null):N-9999 (32) and N(275) at 0.56 6.735 45.346 in (null):A-9999 (38) other bump:3.18698 Ang CG(232) at 1.58495 8.58009 43.1014 in (null):N-9999 (32) and C(274) at 0.148 6.004 44.308 in (null):A-9999 (37) other bump:2.92532 Ang CD(241) at -1.04913 9.27327 40.2464 in (null):Q-9999 (33) and CB(272) at -0.861 7.51 42.573 in (null):A-9999 (37) other bump:2.90919 Ang OE1(242) at 0.177967 9.11626 40.3812 in (null):Q-9999 (33) and CB(272) at -0.861 7.51 42.573 in (null):A-9999 (37) other bump:2.72158 Ang CG(232) at 1.58495 8.58009 43.1014 in (null):N-9999 (32) and CB(272) at -0.861 7.51 42.573 in (null):A-9999 (37) other bump:2.0389 Ang OD1(234) at 0.439878 9.01053 43.0348 in (null):N-9999 (32) and CB(272) at -0.861 7.51 42.573 in (null):A-9999 (37) other bump:2.57665 Ang CG(112) at 12.3443 14.2522 44.6608 in (null):N-9999 (17) and NE2(226) at 9.79961 14.6513 44.7268 in (null):H-9999 (31) other bump:1.61263 Ang OD1(114) at 11.2225 13.9986 45.1139 in (null):N-9999 (17) and NE2(226) at 9.79961 14.6513 44.7268 in (null):H-9999 (31) other bump:2.75489 Ang OD1(114) at 11.2225 13.9986 45.1139 in (null):N-9999 (17) and CE1(225) at 8.734 15.1658 45.2989 in (null):H-9999 (31) other bump:2.2547 Ang OD1(114) at 11.2225 13.9986 45.1139 in (null):N-9999 (17) and CD2(223) at 9.40846 13.7015 43.8082 in (null):H-9999 (31) other bump:2.92997 Ang CG(130) at 12.0202 20.0357 52.2275 in (null):Q-9999 (19) and CZ(162) at 12.5393 20.436 55.0832 in (null):Y-9999 (23) other bump:2.10072 Ang CG(130) at 12.0202 20.0357 52.2275 in (null):Q-9999 (19) and CE1(160) at 12.5663 19.4039 54.1551 in (null):Y-9999 (23) other bump:2.59264 Ang O(134) at 13.343 17.107 53.237 in (null):Q-9999 (19) and CE1(160) at 12.5663 19.4039 54.1551 in (null):Y-9999 (23) other bump:3.09508 Ang C(135) at 13.177 17.247 52.021 in (null):Q-9999 (19) and CE1(160) at 12.5663 19.4039 54.1551 in (null):Y-9999 (23) other bump:1.93429 Ang O(134) at 13.343 17.107 53.237 in (null):Q-9999 (19) and CD1(158) at 12.3587 18.0922 54.5794 in (null):Y-9999 (23) other bump:2.83094 Ang CD1(63) at 12.0853 22.8478 37.3783 in (null):W-9999 (10) and N(77) at 12.622 21.959 40.012 in (null):C-9999 (12) neighbor-bump: 2.47222 Ang C(1) at 20.743 12.675 39.72 in (null):G-9999 (0) and CB(4) at 20.5515 14.7296 41.0815 in (null):A-9999 (1) Number of specific fragments= 1 total=24 Number of alignments=10 # Reading fragments from alignment file # T0159 read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1cl2A/T0159-1cl2A-2track-protein-STR-local-adpstyle1.pw.a2m.gz # 1cl2A read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1cl2A/T0159-1cl2A-2track-protein-STR-local-adpstyle1.pw.a2m.gz # adding 1cl2A to template set 1cl2A:# found chain 1cl2A in template set T0159 48 :GDGKADLTGCNPGWGCEGAINHQLAAYELTNTVTHNQGNYAAMMADTISRYKEGKPVFYY 1cl2A 48 :NRANGELFYGRRGTLTHFSLQQAMCELEGGAGCVLFPCGAAAVANSILAFIEQGDHVLMT Fragment has 47 clashes (null) has 47 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 62 residues other bump:2.11232 Ang CG1(419) at -0.154 -6.584 50.653 in (null):V-9999 (57) and OH(443) at 0.866534 -5.023 49.6612 in (null):Y-9999 (59) other bump:2.94264 Ang CG2(420) at 0.845 -7.817 48.738 in (null):V-9999 (57) and OH(443) at 0.866534 -5.023 49.6612 in (null):Y-9999 (59) other bump:1.67341 Ang CG1(419) at -0.154 -6.584 50.653 in (null):V-9999 (57) and CZ(442) at 0.0157418 -4.92157 50.7415 in (null):Y-9999 (59) other bump:2.96484 Ang CG1(419) at -0.154 -6.584 50.653 in (null):V-9999 (57) and CE2(441) at -0.205014 -3.70138 51.3445 in (null):Y-9999 (59) other bump:2.31862 Ang CB(418) at 0.004 -7.942 49.985 in (null):V-9999 (57) and CE1(440) at -0.605924 -6.06319 51.1991 in (null):Y-9999 (59) other bump:3.18341 Ang C(422) at -0.124 -9.021 52.273 in (null):V-9999 (57) and CE1(440) at -0.605924 -6.06319 51.1991 in (null):Y-9999 (59) other bump:0.879614 Ang CG1(419) at -0.154 -6.584 50.653 in (null):V-9999 (57) and CE1(440) at -0.605924 -6.06319 51.1991 in (null):Y-9999 (59) other bump:2.17714 Ang CG1(419) at -0.154 -6.584 50.653 in (null):V-9999 (57) and CD1(438) at -1.46362 -5.98192 52.2847 in (null):Y-9999 (59) neighbor-bump: 2.08464 Ang C(408) at 2.225 -12.971 47.352 in (null):K-9999 (55) and CD(413) at 3.21477 -13.9767 48.8865 in (null):P-9999 (56) other bump:1.13442 Ang CG1(344) at 2.01719 -3.09289 40.4384 in (null):I-9999 (48) and OH(375) at 1.14342 -3.57517 40.9777 in (null):Y-9999 (51) other bump:0.670924 Ang CD1(346) at 1.01119 -4.20799 40.7983 in (null):I-9999 (48) and OH(375) at 1.14342 -3.57517 40.9777 in (null):Y-9999 (51) other bump:2.6979 Ang CA(342) at 3.098 -2.845 42.688 in (null):I-9999 (48) and OH(375) at 1.14342 -3.57517 40.9777 in (null):Y-9999 (51) other bump:1.96184 Ang CB(343) at 2.28618 -2.09625 41.5741 in (null):I-9999 (48) and OH(375) at 1.14342 -3.57517 40.9777 in (null):Y-9999 (51) other bump:1.98522 Ang CG1(344) at 2.01719 -3.09289 40.4384 in (null):I-9999 (48) and CZ(374) at 1.72856 -4.53898 41.7675 in (null):Y-9999 (51) other bump:1.25045 Ang CD1(346) at 1.01119 -4.20799 40.7983 in (null):I-9999 (48) and CZ(374) at 1.72856 -4.53898 41.7675 in (null):Y-9999 (51) other bump:2.36478 Ang CA(342) at 3.098 -2.845 42.688 in (null):I-9999 (48) and CZ(374) at 1.72856 -4.53898 41.7675 in (null):Y-9999 (51) other bump:3.26929 Ang C(348) at 4.558 -2.976 42.257 in (null):I-9999 (48) and CZ(374) at 1.72856 -4.53898 41.7675 in (null):Y-9999 (51) other bump:2.51303 Ang CB(343) at 2.28618 -2.09625 41.5741 in (null):I-9999 (48) and CZ(374) at 1.72856 -4.53898 41.7675 in (null):Y-9999 (51) other bump:2.76761 Ang CG1(344) at 2.01719 -3.09289 40.4384 in (null):I-9999 (48) and CE2(373) at 2.3017 -4.16725 42.973 in (null):Y-9999 (51) other bump:2.52916 Ang CD1(346) at 1.01119 -4.20799 40.7983 in (null):I-9999 (48) and CE2(373) at 2.3017 -4.16725 42.973 in (null):Y-9999 (51) other bump:1.56962 Ang CA(342) at 3.098 -2.845 42.688 in (null):I-9999 (48) and CE2(373) at 2.3017 -4.16725 42.973 in (null):Y-9999 (51) other bump:2.65004 Ang C(348) at 4.558 -2.976 42.257 in (null):I-9999 (48) and CE2(373) at 2.3017 -4.16725 42.973 in (null):Y-9999 (51) other bump:2.84798 Ang C(340) at 3.437 -2.687 45.125 in (null):T-9999 (47) and CE2(373) at 2.3017 -4.16725 42.973 in (null):Y-9999 (51) other bump:2.27822 Ang N(341) at 2.89 -2.219 43.997 in (null):I-9999 (48) and CE2(373) at 2.3017 -4.16725 42.973 in (null):Y-9999 (51) other bump:2.49926 Ang CB(343) at 2.28618 -2.09625 41.5741 in (null):I-9999 (48) and CE2(373) at 2.3017 -4.16725 42.973 in (null):Y-9999 (51) other bump:2.92899 Ang CG1(344) at 2.01719 -3.09289 40.4384 in (null):I-9999 (48) and CE1(372) at 1.75616 -5.86234 41.3555 in (null):Y-9999 (51) other bump:1.89797 Ang CD1(346) at 1.01119 -4.20799 40.7983 in (null):I-9999 (48) and CE1(372) at 1.75616 -5.86234 41.3555 in (null):Y-9999 (51) other bump:2.43712 Ang O(339) at 4.244 -3.624 45.145 in (null):T-9999 (47) and CD2(371) at 2.90651 -5.12613 43.7687 in (null):Y-9999 (51) other bump:2.53141 Ang CA(342) at 3.098 -2.845 42.688 in (null):I-9999 (48) and CD2(371) at 2.90651 -5.12613 43.7687 in (null):Y-9999 (51) other bump:3.10412 Ang C(348) at 4.558 -2.976 42.257 in (null):I-9999 (48) and CD2(371) at 2.90651 -5.12613 43.7687 in (null):Y-9999 (51) other bump:2.84084 Ang C(340) at 3.437 -2.687 45.125 in (null):T-9999 (47) and CD2(371) at 2.90651 -5.12613 43.7687 in (null):Y-9999 (51) other bump:3.04103 Ang CG(257) at 1.38323 8.63281 42.9374 in (null):N-9999 (36) and N(300) at 0.551 6.755 45.18 in (null):A-9999 (42) other bump:3.0948 Ang CG(257) at 1.38323 8.63281 42.9374 in (null):N-9999 (36) and C(299) at 0.152 6.051 44.119 in (null):A-9999 (41) other bump:2.66756 Ang ND2(258) at 1.66655 7.44895 42.4256 in (null):N-9999 (36) and C(299) at 0.152 6.051 44.119 in (null):A-9999 (41) other bump:2.03508 Ang OD1(259) at 0.250095 9.09033 42.8503 in (null):N-9999 (36) and CB(297) at -0.893 7.49 42.327 in (null):A-9999 (41) other bump:2.61913 Ang CG(257) at 1.38323 8.63281 42.9374 in (null):N-9999 (36) and CB(297) at -0.893 7.49 42.327 in (null):A-9999 (41) other bump:2.56177 Ang ND2(258) at 1.66655 7.44895 42.4256 in (null):N-9999 (36) and CB(297) at -0.893 7.49 42.327 in (null):A-9999 (41) self-bump: 1.38544 Ang CA(276) at -1.436 9.516 47.829 in (null):N-9999 (39) and CB(277) at -1.54102 9.63218 49.2056 in (null):N-9999 (39) other bump:2.74 Ang CG(137) at 12.3468 14.1988 44.3728 in (null):N-9999 (21) and NE2(251) at 9.64548 14.6098 44.5764 in (null):H-9999 (35) other bump:1.72149 Ang OD1(139) at 11.2167 13.9444 44.8043 in (null):N-9999 (21) and NE2(251) at 9.64548 14.6098 44.5764 in (null):H-9999 (35) other bump:2.90598 Ang OD1(139) at 11.2167 13.9444 44.8043 in (null):N-9999 (21) and CE1(250) at 8.57989 15.1134 45.1581 in (null):H-9999 (35) other bump:2.29625 Ang OD1(139) at 11.2167 13.9444 44.8043 in (null):N-9999 (21) and CD2(248) at 9.25444 13.6748 43.6426 in (null):H-9999 (35) other bump:3.15492 Ang CD1(165) at 8.88579 14.5505 48.8886 in (null):L-9999 (24) and CG1(233) at 10.2806 11.8781 47.9578 in (null):V-9999 (33) other bump:2.24145 Ang CG(155) at 11.9247 19.9309 51.8548 in (null):Q-9999 (23) and CE1(185) at 12.4634 19.451 53.977 in (null):Y-9999 (27) other bump:2.10692 Ang O(159) at 13.257 17.012 52.892 in (null):Q-9999 (23) and CD1(183) at 12.2622 18.1301 54.375 in (null):Y-9999 (27) other bump:2.82587 Ang CD1(88) at 12.0292 22.7962 37.1416 in (null):W-9999 (14) and N(102) at 12.61 21.909 39.761 in (null):C-9999 (16) neighbor-bump: 2.49896 Ang C(26) at 20.822 12.758 39.623 in (null):K-9999 (4) and CB(29) at 20.4708 14.8482 40.9468 in (null):A-9999 (5) Number of specific fragments= 1 total=25 Number of alignments=11 # Reading fragments from alignment file # T0159 read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1cl2A/T0159-1cl2A-2track-protein-STR-local-adpstyle5.pw.a2m.gz # 1cl2A read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1cl2A/T0159-1cl2A-2track-protein-STR-local-adpstyle5.pw.a2m.gz # found chain 1cl2A in template set T0159 35 :LKDPKIAK 1cl2A 135 :LIGADIVK Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 10 residues other bump:3.30996 Ang NZ(16) at -1.21027 -9.65252 62.2044 in (null):K-9999 (2) and CG1(46) at 2.022 -9.191 61.661 in (null):I-9999 (6) neighbor-bump: 1.99662 Ang CB(21) at 2.89014 -5.89027 68.7886 in (null):D-9999 (3) and CD(31) at 3.91326 -7.49179 69.4009 in (null):P-9999 (4) self-bump: 1.33495 Ang N(27) at 3.813 -8.171 68.256 in (null):P-9999 (4) and CD(31) at 3.91326 -7.49179 69.4009 in (null):P-9999 (4) self-bump: 2.20702 Ang N(27) at 3.813 -8.171 68.256 in (null):P-9999 (4) and CG(30) at 5.26276 -7.9657 69.9074 in (null):P-9999 (4) self-bump: 1.29954 Ang CA(20) at 2.136 -6.462 67.898 in (null):D-9999 (3) and CB(21) at 2.89014 -5.89027 68.7886 in (null):D-9999 (3) T0159 73 :AYELTNTVTHNQGNY 1cl2A 143 :HLQPNTKIVFLESPG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 17 residues T0159 88 :AAMMADTISRYKEGKPVFYYTWTPYWVSNELKPGKDVVWLQVPFSALPGDKN 1cl2A 167 :PAIVAAVRSVVPDAIIMIDNTWAAGVLFKALDFGIDVSIQAATKYLVGHSDA Fragment has 153 clashes (null) has 153 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 54 residues other bump:2.98048 Ang CD1(386) at -1.09868 19.2537 47.8414 in (null):L-9999 (47) and C(425) at -3.217 18.811 45.792 in (null):N-9999 (52) other bump:2.69575 Ang CD1(386) at -1.09868 19.2537 47.8414 in (null):L-9999 (47) and O(424) at -3.533 18.506 46.957 in (null):N-9999 (52) other bump:1.12458 Ang CD1(386) at -1.09868 19.2537 47.8414 in (null):L-9999 (47) and OD1(423) at -0.890064 20.0843 47.1125 in (null):N-9999 (52) other bump:1.87443 Ang CG(385) at -0.0322075 19.813 48.7569 in (null):L-9999 (47) and OD1(423) at -0.890064 20.0843 47.1125 in (null):N-9999 (52) other bump:2.08727 Ang CD2(387) at 0.868634 20.7788 47.9964 in (null):L-9999 (47) and OD1(423) at -0.890064 20.0843 47.1125 in (null):N-9999 (52) other bump:2.55059 Ang CD2(387) at 0.868634 20.7788 47.9964 in (null):L-9999 (47) and ND2(422) at -0.752801 22.3009 46.7475 in (null):N-9999 (52) other bump:2.30403 Ang CD1(386) at -1.09868 19.2537 47.8414 in (null):L-9999 (47) and CG(421) at -1.15 21.0706 46.4255 in (null):N-9999 (52) other bump:2.87513 Ang CG(385) at -0.0322075 19.813 48.7569 in (null):L-9999 (47) and CG(421) at -1.15 21.0706 46.4255 in (null):N-9999 (52) other bump:2.57446 Ang CD2(387) at 0.868634 20.7788 47.9964 in (null):L-9999 (47) and CG(421) at -1.15 21.0706 46.4255 in (null):N-9999 (52) other bump:2.43159 Ang O(380) at 2.524 21.214 52.574 in (null):A-9999 (46) and CD(394) at 0.121969 21.5904 52.5401 in (null):P-9999 (48) other bump:2.29747 Ang C(381) at 1.915 20.154 52.546 in (null):A-9999 (46) and CD(394) at 0.121969 21.5904 52.5401 in (null):P-9999 (48) neighbor-bump: 1.96755 Ang N(382) at 0.859 19.939 51.765 in (null):L-9999 (47) and CD(394) at 0.121969 21.5904 52.5401 in (null):P-9999 (48) neighbor-bump: 1.70474 Ang CA(383) at 0.273 20.992 50.951 in (null):L-9999 (47) and CD(394) at 0.121969 21.5904 52.5401 in (null):P-9999 (48) neighbor-bump: 1.76795 Ang O(388) at -0.254 23.175 51.852 in (null):L-9999 (47) and CD(394) at 0.121969 21.5904 52.5401 in (null):P-9999 (48) neighbor-bump: 0.886689 Ang C(389) at -0.416 21.965 51.943 in (null):L-9999 (47) and CD(394) at 0.121969 21.5904 52.5401 in (null):P-9999 (48) self-bump: 1.36475 Ang N(390) at -1.189 21.393 52.864 in (null):P-9999 (48) and CD(394) at 0.121969 21.5904 52.5401 in (null):P-9999 (48) other bump:3.24848 Ang C(381) at 1.915 20.154 52.546 in (null):A-9999 (46) and CG(393) at 0.36167 22.9424 53.15 in (null):P-9999 (48) neighbor-bump: 2.94063 Ang CA(383) at 0.273 20.992 50.951 in (null):L-9999 (47) and CG(393) at 0.36167 22.9424 53.15 in (null):P-9999 (48) neighbor-bump: 1.4553 Ang O(388) at -0.254 23.175 51.852 in (null):L-9999 (47) and CG(393) at 0.36167 22.9424 53.15 in (null):P-9999 (48) neighbor-bump: 1.7369 Ang C(389) at -0.416 21.965 51.943 in (null):L-9999 (47) and CG(393) at 0.36167 22.9424 53.15 in (null):P-9999 (48) self-bump: 2.21064 Ang N(390) at -1.189 21.393 52.864 in (null):P-9999 (48) and CG(393) at 0.36167 22.9424 53.15 in (null):P-9999 (48) neighbor-bump: 2.62443 Ang C(389) at -0.416 21.965 51.943 in (null):L-9999 (47) and CB(392) at -0.456556 22.8865 54.4 in (null):P-9999 (48) self-bump: 1.36933 Ang CA(361) at -2.871 16.474 53.344 in (null):F-9999 (44) and CB(362) at -3.48376 15.8126 54.3746 in (null):F-9999 (44) other bump:2.91171 Ang CG(340) at -2.94968 12.1396 49.8751 in (null):Q-9999 (41) and CD(357) at -0.886596 14.0994 49.2579 in (null):P-9999 (43) other bump:2.85688 Ang CA(338) at -0.692 11.605 50.637 in (null):Q-9999 (41) and CD(357) at -0.886596 14.0994 49.2579 in (null):P-9999 (43) other bump:2.16641 Ang C(345) at -0.299 13.03 51.048 in (null):Q-9999 (41) and CD(357) at -0.886596 14.0994 49.2579 in (null):P-9999 (43) neighbor-bump: 2.07868 Ang N(346) at 0.753 13.566 50.419 in (null):V-9999 (42) and CD(357) at -0.886596 14.0994 49.2579 in (null):P-9999 (43) other bump:2.59797 Ang CG(340) at -2.94968 12.1396 49.8751 in (null):Q-9999 (41) and CG(356) at -2.11369 14.0817 48.3656 in (null):P-9999 (43) other bump:2.93804 Ang CG(340) at -2.94968 12.1396 49.8751 in (null):Q-9999 (41) and CB(355) at -3.09511 14.9628 49.0748 in (null):P-9999 (43) other bump:2.15084 Ang OH(150) at -2.14718 9.35835 51.7014 in (null):Y-9999 (19) and CB(339) at -2.01906 11.168 50.5459 in (null):Q-9999 (41) other bump:3.05963 Ang CA(166) at 0.299 10.656 56.245 in (null):T-9999 (21) and CD2(334) at 3.1923 10.692 55.2506 in (null):L-9999 (40) other bump:2.3359 Ang O(163) at 2.703 10.29 57.499 in (null):Y-9999 (20) and CD2(334) at 3.1923 10.692 55.2506 in (null):L-9999 (40) other bump:2.57485 Ang C(164) at 2.11 9.292 57.121 in (null):Y-9999 (20) and CD2(334) at 3.1923 10.692 55.2506 in (null):L-9999 (40) other bump:2.90195 Ang CZ(208) at 5.17649 10.3211 53.1657 in (null):Y-9999 (25) and CD2(334) at 3.1923 10.692 55.2506 in (null):L-9999 (40) other bump:2.76751 Ang CD1(204) at 5.35807 12.2594 54.5353 in (null):Y-9999 (25) and CD2(334) at 3.1923 10.692 55.2506 in (null):L-9999 (40) other bump:2.56677 Ang CD2(205) at 6.61323 10.2794 55.0902 in (null):Y-9999 (25) and CD1(333) at 5.0078 12.107 54.2713 in (null):L-9999 (40) other bump:2.68309 Ang CE2(207) at 6.05683 9.65464 53.9811 in (null):Y-9999 (25) and CD1(333) at 5.0078 12.107 54.2713 in (null):L-9999 (40) other bump:2.10723 Ang CZ(208) at 5.17649 10.3211 53.1657 in (null):Y-9999 (25) and CD1(333) at 5.0078 12.107 54.2713 in (null):L-9999 (40) other bump:2.98081 Ang CB(202) at 6.94925 12.3891 56.5155 in (null):Y-9999 (25) and CD1(333) at 5.0078 12.107 54.2713 in (null):L-9999 (40) other bump:1.7418 Ang CG(203) at 6.27136 11.6141 55.3641 in (null):Y-9999 (25) and CD1(333) at 5.0078 12.107 54.2713 in (null):L-9999 (40) other bump:0.464331 Ang CD1(204) at 5.35807 12.2594 54.5353 in (null):Y-9999 (25) and CD1(333) at 5.0078 12.107 54.2713 in (null):L-9999 (40) other bump:1.02047 Ang CE1(206) at 4.78051 11.6122 53.4083 in (null):Y-9999 (25) and CD1(333) at 5.0078 12.107 54.2713 in (null):L-9999 (40) other bump:2.42182 Ang OH(209) at 4.68009 9.67587 52.0526 in (null):Y-9999 (25) and CG(332) at 4.06037 10.945 54.0199 in (null):L-9999 (40) other bump:2.84704 Ang CD2(205) at 6.61323 10.2794 55.0902 in (null):Y-9999 (25) and CG(332) at 4.06037 10.945 54.0199 in (null):L-9999 (40) other bump:2.3775 Ang CE2(207) at 6.05683 9.65464 53.9811 in (null):Y-9999 (25) and CG(332) at 4.06037 10.945 54.0199 in (null):L-9999 (40) other bump:1.53776 Ang CZ(208) at 5.17649 10.3211 53.1657 in (null):Y-9999 (25) and CG(332) at 4.06037 10.945 54.0199 in (null):L-9999 (40) other bump:2.67263 Ang CG(203) at 6.27136 11.6141 55.3641 in (null):Y-9999 (25) and CG(332) at 4.06037 10.945 54.0199 in (null):L-9999 (40) other bump:1.91762 Ang CD1(204) at 5.35807 12.2594 54.5353 in (null):Y-9999 (25) and CG(332) at 4.06037 10.945 54.0199 in (null):L-9999 (40) other bump:1.15661 Ang CE1(206) at 4.78051 11.6122 53.4083 in (null):Y-9999 (25) and CG(332) at 4.06037 10.945 54.0199 in (null):L-9999 (40) other bump:2.29294 Ang OH(209) at 4.68009 9.67587 52.0526 in (null):Y-9999 (25) and CB(331) at 3.17788 11.2375 52.8025 in (null):L-9999 (40) other bump:2.22848 Ang CZ(208) at 5.17649 10.3211 53.1657 in (null):Y-9999 (25) and CB(331) at 3.17788 11.2375 52.8025 in (null):L-9999 (40) other bump:2.96651 Ang CD1(204) at 5.35807 12.2594 54.5353 in (null):Y-9999 (25) and CB(331) at 3.17788 11.2375 52.8025 in (null):L-9999 (40) other bump:1.75379 Ang CE1(206) at 4.78051 11.6122 53.4083 in (null):Y-9999 (25) and CB(331) at 3.17788 11.2375 52.8025 in (null):L-9999 (40) other bump:2.39814 Ang OH(209) at 4.68009 9.67587 52.0526 in (null):Y-9999 (25) and CA(330) at 2.328 10.084 52.281 in (null):L-9999 (40) other bump:2.99213 Ang CZ(208) at 5.17649 10.3211 53.1657 in (null):Y-9999 (25) and CA(330) at 2.328 10.084 52.281 in (null):L-9999 (40) other bump:1.67718 Ang OH(209) at 4.68009 9.67587 52.0526 in (null):Y-9999 (25) and N(329) at 3.166 8.989 51.832 in (null):L-9999 (40) other bump:2.75596 Ang CZ(208) at 5.17649 10.3211 53.1657 in (null):Y-9999 (25) and N(329) at 3.166 8.989 51.832 in (null):L-9999 (40) other bump:2.14926 Ang OH(209) at 4.68009 9.67587 52.0526 in (null):Y-9999 (25) and C(328) at 3.496 7.977 52.628 in (null):W-9999 (39) other bump:2.93392 Ang CZ(208) at 5.17649 10.3211 53.1657 in (null):Y-9999 (25) and C(328) at 3.496 7.977 52.628 in (null):W-9999 (39) other bump:2.43906 Ang CG1(304) at 7.938 3.393 50.47 in (null):V-9999 (37) and NE1(323) at 5.5634 3.15579 49.966 in (null):W-9999 (39) other bump:2.7941 Ang OH(209) at 4.68009 9.67587 52.0526 in (null):Y-9999 (25) and CA(316) at 4.365 6.9 52.005 in (null):W-9999 (39) other bump:3.23927 Ang CE2(207) at 6.05683 9.65464 53.9811 in (null):Y-9999 (25) and C(314) at 6.538 6.586 53.062 in (null):V-9999 (38) other bump:1.96072 Ang OE1(252) at 7.44711 4.83177 55.843 in (null):E-9999 (30) and CG2(312) at 8.81403 6.20339 56.1507 in (null):V-9999 (38) other bump:2.62521 Ang CD(251) at 7.30188 4.16572 56.8238 in (null):E-9999 (30) and CG2(312) at 8.81403 6.20339 56.1507 in (null):V-9999 (38) other bump:2.82795 Ang CD1(260) at 11.515 5.467 55.751 in (null):L-9999 (31) and CG2(312) at 8.81403 6.20339 56.1507 in (null):V-9999 (38) other bump:2.63787 Ang CB(249) at 8.38357 5.64025 58.6916 in (null):E-9999 (30) and CG2(312) at 8.81403 6.20339 56.1507 in (null):V-9999 (38) other bump:2.76039 Ang CG(250) at 8.29007 4.25626 58.0359 in (null):E-9999 (30) and CG2(312) at 8.81403 6.20339 56.1507 in (null):V-9999 (38) other bump:2.64307 Ang CD2(158) at 5.43095 6.14393 56.8447 in (null):Y-9999 (20) and CG1(311) at 6.99843 7.88103 55.6154 in (null):V-9999 (38) other bump:2.48524 Ang CD2(205) at 6.61323 10.2794 55.0902 in (null):Y-9999 (25) and CG1(311) at 6.99843 7.88103 55.6154 in (null):V-9999 (38) other bump:2.58902 Ang CE2(207) at 6.05683 9.65464 53.9811 in (null):Y-9999 (25) and CG1(311) at 6.99843 7.88103 55.6154 in (null):V-9999 (38) other bump:2.32105 Ang OE1(252) at 7.44711 4.83177 55.843 in (null):E-9999 (30) and CB(310) at 8.02335 6.91937 55.008 in (null):V-9999 (38) other bump:1.96346 Ang OE1(252) at 7.44711 4.83177 55.843 in (null):E-9999 (30) and CA(309) at 7.321 5.855 54.172 in (null):V-9999 (38) other bump:3.12519 Ang CE2(160) at 6.01892 4.90936 56.851 in (null):Y-9999 (20) and CA(309) at 7.321 5.855 54.172 in (null):V-9999 (38) other bump:3.14421 Ang CD(251) at 7.30188 4.16572 56.8238 in (null):E-9999 (30) and CA(309) at 7.321 5.855 54.172 in (null):V-9999 (38) other bump:2.52903 Ang OE1(252) at 7.44711 4.83177 55.843 in (null):E-9999 (30) and N(308) at 8.3 5.037 53.471 in (null):V-9999 (38) other bump:2.7667 Ang OE1(252) at 7.44711 4.83177 55.843 in (null):E-9999 (30) and C(307) at 8.203 3.709 53.43 in (null):V-9999 (37) other bump:1.84828 Ang CD(120) at 10.0916 -3.83555 54.9427 in (null):P-9999 (16) and OD2(298) at 11.539 -2.87 54.319 in (null):D-9999 (36) other bump:3.05653 Ang CD(120) at 10.0916 -3.83555 54.9427 in (null):P-9999 (16) and CG(296) at 12.252 -1.907 53.965 in (null):D-9999 (36) other bump:3.00943 Ang CZ(161) at 5.9255 4.1239 57.9722 in (null):Y-9999 (20) and CD(288) at 7.82781 2.66023 59.7876 in (null):K-9999 (35) other bump:2.33457 Ang OH(162) at 6.48404 2.88538 57.8919 in (null):Y-9999 (20) and CD(288) at 7.82781 2.66023 59.7876 in (null):K-9999 (35) other bump:2.41443 Ang CG(250) at 8.29007 4.25626 58.0359 in (null):E-9999 (30) and CD(288) at 7.82781 2.66023 59.7876 in (null):K-9999 (35) other bump:2.85576 Ang OH(162) at 6.48404 2.88538 57.8919 in (null):Y-9999 (20) and CG(287) at 8.56933 1.45983 59.224 in (null):K-9999 (35) other bump:3.05118 Ang CG(250) at 8.29007 4.25626 58.0359 in (null):E-9999 (30) and CG(287) at 8.56933 1.45983 59.224 in (null):K-9999 (35) other bump:2.73159 Ang CG(250) at 8.29007 4.25626 58.0359 in (null):E-9999 (30) and CB(286) at 9.55702 1.83784 58.1235 in (null):K-9999 (35) other bump:2.63831 Ang CE(25) at 10.5585 -2.09504 59.4404 in (null):M-9999 (4) and C(283) at 12.428 -0.255 59.158 in (null):G-9999 (34) other bump:2.28853 Ang CE(25) at 10.5585 -2.09504 59.4404 in (null):M-9999 (4) and O(282) at 12.468 -1.282 58.476 in (null):G-9999 (34) other bump:3.17821 Ang C(255) at 10.558 5.036 59.626 in (null):E-9999 (30) and CD(277) at 12.2096 4.69445 62.3198 in (null):P-9999 (33) other bump:2.3982 Ang O(245) at 11.207 6.795 61.742 in (null):N-9999 (29) and CD(277) at 12.2096 4.69445 62.3198 in (null):P-9999 (33) neighbor-bump: 2.17413 Ang N(264) at 13.467 5.518 60.749 in (null):K-9999 (32) and CD(277) at 12.2096 4.69445 62.3198 in (null):P-9999 (33) neighbor-bump: 2.22843 Ang CA(265) at 14.318 5.284 61.904 in (null):K-9999 (32) and CD(277) at 12.2096 4.69445 62.3198 in (null):P-9999 (33) neighbor-bump: 2.66991 Ang CB(266) at 14.0427 6.58624 62.7549 in (null):K-9999 (32) and CD(277) at 12.2096 4.69445 62.3198 in (null):P-9999 (33) neighbor-bump: 1.84578 Ang C(272) at 13.897 4.034 62.671 in (null):K-9999 (32) and CD(277) at 12.2096 4.69445 62.3198 in (null):P-9999 (33) self-bump: 1.28418 Ang N(273) at 12.706 3.512 62.387 in (null):P-9999 (33) and CD(277) at 12.2096 4.69445 62.3198 in (null):P-9999 (33) self-bump: 2.14371 Ang N(273) at 12.706 3.512 62.387 in (null):P-9999 (33) and CG(276) at 10.9486 4.48383 63.137 in (null):P-9999 (33) other bump:1.91391 Ang CB(132) at 4.58726 3.00513 57.3996 in (null):F-9999 (18) and OE2(253) at 6.44732 3.33557 57.0929 in (null):E-9999 (30) other bump:2.62805 Ang CE1(159) at 5.2565 4.55968 59.0904 in (null):Y-9999 (20) and OE2(253) at 6.44732 3.33557 57.0929 in (null):E-9999 (30) other bump:1.6489 Ang CE2(160) at 6.01892 4.90936 56.851 in (null):Y-9999 (20) and OE2(253) at 6.44732 3.33557 57.0929 in (null):E-9999 (30) other bump:1.29112 Ang CZ(161) at 5.9255 4.1239 57.9722 in (null):Y-9999 (20) and OE2(253) at 6.44732 3.33557 57.0929 in (null):E-9999 (30) other bump:0.917787 Ang OH(162) at 6.48404 2.88538 57.8919 in (null):Y-9999 (20) and OE2(253) at 6.44732 3.33557 57.0929 in (null):E-9999 (30) other bump:2.60579 Ang CD2(158) at 5.43095 6.14393 56.8447 in (null):Y-9999 (20) and OE1(252) at 7.44711 4.83177 55.843 in (null):E-9999 (30) other bump:1.74981 Ang CE2(160) at 6.01892 4.90936 56.851 in (null):Y-9999 (20) and OE1(252) at 7.44711 4.83177 55.843 in (null):E-9999 (30) other bump:2.71108 Ang CZ(161) at 5.9255 4.1239 57.9722 in (null):Y-9999 (20) and OE1(252) at 7.44711 4.83177 55.843 in (null):E-9999 (30) other bump:3.00793 Ang CB(132) at 4.58726 3.00513 57.3996 in (null):F-9999 (18) and CD(251) at 7.30188 4.16572 56.8238 in (null):E-9999 (30) other bump:2.72289 Ang CD2(158) at 5.43095 6.14393 56.8447 in (null):Y-9999 (20) and CD(251) at 7.30188 4.16572 56.8238 in (null):E-9999 (30) other bump:1.48315 Ang CE2(160) at 6.01892 4.90936 56.851 in (null):Y-9999 (20) and CD(251) at 7.30188 4.16572 56.8238 in (null):E-9999 (30) other bump:1.79306 Ang CZ(161) at 5.9255 4.1239 57.9722 in (null):Y-9999 (20) and CD(251) at 7.30188 4.16572 56.8238 in (null):E-9999 (30) other bump:1.85712 Ang OH(162) at 6.48404 2.88538 57.8919 in (null):Y-9999 (20) and CD(251) at 7.30188 4.16572 56.8238 in (null):E-9999 (30) other bump:2.64358 Ang CE2(160) at 6.01892 4.90936 56.851 in (null):Y-9999 (20) and CG(250) at 8.29007 4.25626 58.0359 in (null):E-9999 (30) other bump:2.27195 Ang OH(162) at 6.48404 2.88538 57.8919 in (null):Y-9999 (20) and CG(250) at 8.29007 4.25626 58.0359 in (null):E-9999 (30) other bump:3.08437 Ang CE2(160) at 6.01892 4.90936 56.851 in (null):Y-9999 (20) and CB(249) at 8.38357 5.64025 58.6916 in (null):E-9999 (30) other bump:2.4967 Ang C(185) at -0.187 12.294 60.378 in (null):W-9999 (22) and CD(197) at 1.7074 13.8594 59.9373 in (null):P-9999 (24) neighbor-bump: 2.24953 Ang N(186) at 1.025 11.756 60.35 in (null):T-9999 (23) and CD(197) at 1.7074 13.8594 59.9373 in (null):P-9999 (24) neighbor-bump: 1.36981 Ang C(192) at 2.93 13.278 60.146 in (null):T-9999 (23) and CD(197) at 1.7074 13.8594 59.9373 in (null):P-9999 (24) self-bump: 1.36596 Ang N(193) at 2.473 13.408 58.9 in (null):P-9999 (24) and CD(197) at 1.7074 13.8594 59.9373 in (null):P-9999 (24) other bump:2.44868 Ang O(184) at -0.444 13.334 60.982 in (null):W-9999 (22) and CD(197) at 1.7074 13.8594 59.9373 in (null):P-9999 (24) neighbor-bump: 1.93745 Ang CA(187) at 2.158 12.338 61.049 in (null):T-9999 (23) and CD(197) at 1.7074 13.8594 59.9373 in (null):P-9999 (24) neighbor-bump: 2.33676 Ang O(191) at 3.958 13.825 60.565 in (null):T-9999 (23) and CD(197) at 1.7074 13.8594 59.9373 in (null):P-9999 (24) neighbor-bump: 1.865 Ang C(192) at 2.93 13.278 60.146 in (null):T-9999 (23) and CG(196) at 2.51705 15.0956 60.2081 in (null):P-9999 (24) self-bump: 2.1357 Ang N(193) at 2.473 13.408 58.9 in (null):P-9999 (24) and CG(196) at 2.51705 15.0956 60.2081 in (null):P-9999 (24) neighbor-bump: 2.90528 Ang CA(187) at 2.158 12.338 61.049 in (null):T-9999 (23) and CG(196) at 2.51705 15.0956 60.2081 in (null):P-9999 (24) neighbor-bump: 1.95404 Ang O(191) at 3.958 13.825 60.565 in (null):T-9999 (23) and CG(196) at 2.51705 15.0956 60.2081 in (null):P-9999 (24) neighbor-bump: 2.6636 Ang C(192) at 2.93 13.278 60.146 in (null):T-9999 (23) and CB(195) at 2.82473 15.5925 58.832 in (null):P-9999 (24) neighbor-bump: 3.16886 Ang CE3(179) at -0.655 11.189 63.457 in (null):W-9999 (22) and CG2(189) at 2.36179 10.5342 62.7416 in (null):T-9999 (23) other bump:2.6064 Ang CZ(149) at -1.65962 8.26815 52.3751 in (null):Y-9999 (19) and OG1(169) at -0.49 9.794 54.135 in (null):T-9999 (21) other bump:2.36724 Ang CE2(148) at -2.02813 8.04466 53.7133 in (null):Y-9999 (19) and OG1(169) at -0.49 9.794 54.135 in (null):T-9999 (21) other bump:3.11046 Ang CE2(148) at -2.02813 8.04466 53.7133 in (null):Y-9999 (19) and CB(167) at -0.918 10.465 55.321 in (null):T-9999 (21) other bump:1.96328 Ang CB(132) at 4.58726 3.00513 57.3996 in (null):F-9999 (18) and OH(162) at 6.48404 2.88538 57.8919 in (null):Y-9999 (20) other bump:3.21151 Ang CA(131) at 3.828 2.561 56.109 in (null):F-9999 (18) and CZ(161) at 5.9255 4.1239 57.9722 in (null):Y-9999 (20) other bump:1.83588 Ang CB(132) at 4.58726 3.00513 57.3996 in (null):F-9999 (18) and CZ(161) at 5.9255 4.1239 57.9722 in (null):Y-9999 (20) other bump:2.24239 Ang CG(133) at 3.74954 3.77775 58.389 in (null):F-9999 (18) and CZ(161) at 5.9255 4.1239 57.9722 in (null):Y-9999 (20) other bump:2.4307 Ang CD2(135) at 3.77477 5.16842 58.41 in (null):F-9999 (18) and CZ(161) at 5.9255 4.1239 57.9722 in (null):Y-9999 (20) other bump:2.44472 Ang CB(132) at 4.58726 3.00513 57.3996 in (null):F-9999 (18) and CE2(160) at 6.01892 4.90936 56.851 in (null):Y-9999 (20) other bump:2.96583 Ang CG(133) at 3.74954 3.77775 58.389 in (null):F-9999 (18) and CE2(160) at 6.01892 4.90936 56.851 in (null):Y-9999 (20) other bump:2.74476 Ang CD2(135) at 3.77477 5.16842 58.41 in (null):F-9999 (18) and CE2(160) at 6.01892 4.90936 56.851 in (null):Y-9999 (20) other bump:2.72607 Ang CD1(134) at 2.95644 3.11507 59.3235 in (null):F-9999 (18) and CE1(159) at 5.2565 4.55968 59.0904 in (null):Y-9999 (20) other bump:2.59835 Ang CE2(137) at 3.03739 5.88584 59.3518 in (null):F-9999 (18) and CE1(159) at 5.2565 4.55968 59.0904 in (null):Y-9999 (20) other bump:2.39239 Ang CB(132) at 4.58726 3.00513 57.3996 in (null):F-9999 (18) and CE1(159) at 5.2565 4.55968 59.0904 in (null):Y-9999 (20) other bump:1.83692 Ang CG(133) at 3.74954 3.77775 58.389 in (null):F-9999 (18) and CE1(159) at 5.2565 4.55968 59.0904 in (null):Y-9999 (20) other bump:1.74043 Ang CD2(135) at 3.77477 5.16842 58.41 in (null):F-9999 (18) and CE1(159) at 5.2565 4.55968 59.0904 in (null):Y-9999 (20) other bump:2.47882 Ang CD2(135) at 3.77477 5.16842 58.41 in (null):F-9999 (18) and CD2(158) at 5.43095 6.14393 56.8447 in (null):Y-9999 (20) other bump:1.64386 Ang CE2(137) at 3.03739 5.88584 59.3518 in (null):F-9999 (18) and CD1(157) at 4.65651 5.82349 59.0746 in (null):Y-9999 (20) other bump:2.75523 Ang CZ(138) at 2.25372 5.21869 60.2796 in (null):F-9999 (18) and CD1(157) at 4.65651 5.82349 59.0746 in (null):Y-9999 (20) other bump:2.34043 Ang CG(133) at 3.74954 3.77775 58.389 in (null):F-9999 (18) and CD1(157) at 4.65651 5.82349 59.0746 in (null):Y-9999 (20) other bump:1.28385 Ang CD2(135) at 3.77477 5.16842 58.41 in (null):F-9999 (18) and CD1(157) at 4.65651 5.82349 59.0746 in (null):Y-9999 (20) other bump:2.33327 Ang CE2(137) at 3.03739 5.88584 59.3518 in (null):F-9999 (18) and CG(156) at 4.74128 6.6256 57.9398 in (null):Y-9999 (20) other bump:3.04887 Ang CG(133) at 3.74954 3.77775 58.389 in (null):F-9999 (18) and CG(156) at 4.74128 6.6256 57.9398 in (null):Y-9999 (20) other bump:1.81069 Ang CD2(135) at 3.77477 5.16842 58.41 in (null):F-9999 (18) and CG(156) at 4.74128 6.6256 57.9398 in (null):Y-9999 (20) other bump:2.74544 Ang CE2(137) at 3.03739 5.88584 59.3518 in (null):F-9999 (18) and CB(155) at 4.07146 7.95336 57.8707 in (null):Y-9999 (20) other bump:2.85214 Ang CD2(135) at 3.77477 5.16842 58.41 in (null):F-9999 (18) and CB(155) at 4.07146 7.95336 57.8707 in (null):Y-9999 (20) other bump:2.85381 Ang CE2(137) at 3.03739 5.88584 59.3518 in (null):F-9999 (18) and CA(154) at 2.708 7.893 57.35 in (null):Y-9999 (20) other bump:3.11206 Ang CD2(135) at 3.77477 5.16842 58.41 in (null):F-9999 (18) and CA(154) at 2.708 7.893 57.35 in (null):Y-9999 (20) other bump:2.38473 Ang O(54) at 14.036 -11.204 60.084 in (null):I-9999 (8) and CD(89) at 15.2592 -12.5037 58.5023 in (null):K-9999 (12) self-bump: 1.35671 Ang CA(63) at 10.7 -14.544 60.061 in (null):R-9999 (10) and CB(64) at 9.47876 -15.1201 60.1926 in (null):R-9999 (10) Number of specific fragments= 3 total=28 Number of alignments=12 # Reading fragments from alignment file # T0159 read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1qo7A/T0159-1qo7A-2track-protein-STR-local-adpstyle5.pw.a2m.gz # 1qo7A read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1qo7A/T0159-1qo7A-2track-protein-STR-local-adpstyle5.pw.a2m.gz # adding 1qo7A to template set 1qo7A:# found chain 1qo7A in template set T0159 58 :NPGWGCE 1qo7A 161 :DKDFGLM Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 9 residues T0159 65 :GAINHQLAAYELTNTVTHNQGNYAAMMADTIS 1qo7A 171 :RVVDQLMKDLGFGSGYIIQGGDIGSFVGRLLG Fragment has 43 clashes (null) has 43 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 34 residues other bump:2.08468 Ang CD2(133) at 25.1795 41.2297 46.3748 in (null):H-9999 (18) and CB(208) at 25.3397 42.019 48.2977 in (null):A-9999 (28) other bump:2.30912 Ang NE2(136) at 25.289 40.0552 47.084 in (null):H-9999 (18) and CB(208) at 25.3397 42.019 48.2977 in (null):A-9999 (28) other bump:2.26647 Ang OE1(152) at 26.3933 40.4902 46.9978 in (null):Q-9999 (20) and CB(208) at 25.3397 42.019 48.2977 in (null):A-9999 (28) other bump:3.0686 Ang CB(149) at 23.4485 39.7054 48.9957 in (null):Q-9999 (20) and CB(208) at 25.3397 42.019 48.2977 in (null):A-9999 (28) other bump:2.73266 Ang CG(150) at 24.3735 39.509 47.8142 in (null):Q-9999 (20) and CB(208) at 25.3397 42.019 48.2977 in (null):A-9999 (28) other bump:1.8026 Ang CD(151) at 25.6734 40.2788 47.9664 in (null):Q-9999 (20) and CB(208) at 25.3397 42.019 48.2977 in (null):A-9999 (28) other bump:1.68361 Ang NE2(153) at 25.9659 40.7263 49.1759 in (null):Q-9999 (20) and CB(208) at 25.3397 42.019 48.2977 in (null):A-9999 (28) other bump:2.6974 Ang CD2(133) at 25.1795 41.2297 46.3748 in (null):H-9999 (18) and CA(207) at 26.84 42.28 48.223 in (null):A-9999 (28) other bump:2.94152 Ang NE2(136) at 25.289 40.0552 47.084 in (null):H-9999 (18) and CA(207) at 26.84 42.28 48.223 in (null):A-9999 (28) other bump:2.21451 Ang OE1(152) at 26.3933 40.4902 46.9978 in (null):Q-9999 (20) and CA(207) at 26.84 42.28 48.223 in (null):A-9999 (28) other bump:2.33062 Ang CD(151) at 25.6734 40.2788 47.9664 in (null):Q-9999 (20) and CA(207) at 26.84 42.28 48.223 in (null):A-9999 (28) other bump:2.02143 Ang NE2(153) at 25.9659 40.7263 49.1759 in (null):Q-9999 (20) and CA(207) at 26.84 42.28 48.223 in (null):A-9999 (28) other bump:2.52278 Ang CD(151) at 25.6734 40.2788 47.9664 in (null):Q-9999 (20) and N(206) at 27.522 41.46 49.212 in (null):A-9999 (28) other bump:1.7208 Ang NE2(153) at 25.9659 40.7263 49.1759 in (null):Q-9999 (20) and N(206) at 27.522 41.46 49.212 in (null):A-9999 (28) other bump:1.66288 Ang CD1(16) at 30.0362 36.5839 46.4283 in (null):I-9999 (3) and CE(203) at 28.7809 37.1657 47.3508 in (null):M-9999 (27) other bump:3.1101 Ang CG1(14) at 30.8471 35.9864 45.2851 in (null):I-9999 (3) and SD(202) at 30.3929 37.2058 48.1099 in (null):M-9999 (27) other bump:1.82805 Ang CD1(16) at 30.0362 36.5839 46.4283 in (null):I-9999 (3) and SD(202) at 30.3929 37.2058 48.1099 in (null):M-9999 (27) other bump:2.83105 Ang CB(149) at 23.4485 39.7054 48.9957 in (null):Q-9999 (20) and C(184) at 25.294 39.002 51.024 in (null):A-9999 (24) other bump:2.61533 Ang NE2(153) at 25.9659 40.7263 49.1759 in (null):Q-9999 (20) and C(184) at 25.294 39.002 51.024 in (null):A-9999 (24) other bump:2.42942 Ang CB(149) at 23.4485 39.7054 48.9957 in (null):Q-9999 (20) and O(183) at 25.645 39.631 50.031 in (null):A-9999 (24) other bump:2.55844 Ang CG(150) at 24.3735 39.509 47.8142 in (null):Q-9999 (20) and O(183) at 25.645 39.631 50.031 in (null):A-9999 (24) other bump:2.16407 Ang CD(151) at 25.6734 40.2788 47.9664 in (null):Q-9999 (20) and O(183) at 25.645 39.631 50.031 in (null):A-9999 (24) other bump:1.4261 Ang NE2(153) at 25.9659 40.7263 49.1759 in (null):Q-9999 (20) and O(183) at 25.645 39.631 50.031 in (null):A-9999 (24) other bump:2.2988 Ang NE2(136) at 25.289 40.0552 47.084 in (null):H-9999 (18) and NE2(153) at 25.9659 40.7263 49.1759 in (null):Q-9999 (20) other bump:1.55186 Ang CD2(133) at 25.1795 41.2297 46.3748 in (null):H-9999 (18) and OE1(152) at 26.3933 40.4902 46.9978 in (null):Q-9999 (20) other bump:1.9967 Ang CE1(135) at 25.2574 39.0081 46.2906 in (null):H-9999 (18) and OE1(152) at 26.3933 40.4902 46.9978 in (null):Q-9999 (20) other bump:1.18996 Ang NE2(136) at 25.289 40.0552 47.084 in (null):H-9999 (18) and OE1(152) at 26.3933 40.4902 46.9978 in (null):Q-9999 (20) other bump:3.02372 Ang CG(132) at 25.067 40.8725 45.0641 in (null):H-9999 (18) and CD(151) at 25.6734 40.2788 47.9664 in (null):Q-9999 (20) other bump:1.9186 Ang CD2(133) at 25.1795 41.2297 46.3748 in (null):H-9999 (18) and CD(151) at 25.6734 40.2788 47.9664 in (null):Q-9999 (20) other bump:2.14374 Ang CE1(135) at 25.2574 39.0081 46.2906 in (null):H-9999 (18) and CD(151) at 25.6734 40.2788 47.9664 in (null):Q-9999 (20) other bump:0.988024 Ang NE2(136) at 25.289 40.0552 47.084 in (null):H-9999 (18) and CD(151) at 25.6734 40.2788 47.9664 in (null):Q-9999 (20) other bump:2.38382 Ang CD2(133) at 25.1795 41.2297 46.3748 in (null):H-9999 (18) and CG(150) at 24.3735 39.509 47.8142 in (null):Q-9999 (20) other bump:1.83126 Ang CE1(135) at 25.2574 39.0081 46.2906 in (null):H-9999 (18) and CG(150) at 24.3735 39.509 47.8142 in (null):Q-9999 (20) other bump:1.2922 Ang NE2(136) at 25.289 40.0552 47.084 in (null):H-9999 (18) and CG(150) at 24.3735 39.509 47.8142 in (null):Q-9999 (20) other bump:2.67664 Ang NE2(136) at 25.289 40.0552 47.084 in (null):H-9999 (18) and CB(149) at 23.4485 39.7054 48.9957 in (null):Q-9999 (20) neighbor-bump: 2.57224 Ang C(107) at 28.977 45.163 32.196 in (null):N-9999 (14) and CG2(111) at 27.9037 47.0441 33.5837 in (null):T-9999 (15) neighbor-bump: 1.75282 Ang O(106) at 28.397 46.25 32.101 in (null):N-9999 (14) and CG2(111) at 27.9037 47.0441 33.5837 in (null):T-9999 (15) self-bump: 2.13543 Ang CB(102) at 29.0771 44.8147 30.0915 in (null):N-9999 (14) and C(107) at 28.977 45.163 32.196 in (null):N-9999 (14) other bump:3.04796 Ang CG(40) at 31.3708 32.6312 39.1512 in (null):Q-9999 (6) and CZ(72) at 30.7862 30.8265 36.7655 in (null):Y-9999 (10) other bump:2.24723 Ang CG(40) at 31.3708 32.6312 39.1512 in (null):Q-9999 (6) and CE1(70) at 31.2405 32.123 36.9661 in (null):Y-9999 (10) other bump:3.1629 Ang C(45) at 32.297 35.05 37.532 in (null):Q-9999 (6) and CE1(70) at 31.2405 32.123 36.9661 in (null):Y-9999 (10) other bump:1.94459 Ang O(44) at 32.179 34.559 36.406 in (null):Q-9999 (6) and CD1(68) at 30.938 33.1101 36.0291 in (null):Y-9999 (10) other bump:2.80512 Ang C(45) at 32.297 35.05 37.532 in (null):Q-9999 (6) and CD1(68) at 30.938 33.1101 36.0291 in (null):Y-9999 (10) Number of specific fragments= 2 total=30 Number of alignments=13 # Reading fragments from alignment file # T0159 read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1qo7A/T0159-1qo7A-2track-protein-STR-local-adpstyle1.pw.a2m.gz # 1qo7A read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1qo7A/T0159-1qo7A-2track-protein-STR-local-adpstyle1.pw.a2m.gz # found chain 1qo7A in template set T0159 65 :GAINHQLAAYELTNTVTHNQGNYAAMMADTI 1qo7A 171 :RVVDQLMKDLGFGSGYIIQGGDIGSFVGRLL Fragment has 43 clashes (null) has 43 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 33 residues other bump:2.08468 Ang CD2(133) at 25.1795 41.2297 46.3748 in (null):H-9999 (18) and CB(208) at 25.3397 42.019 48.2977 in (null):A-9999 (28) other bump:2.30912 Ang NE2(136) at 25.289 40.0552 47.084 in (null):H-9999 (18) and CB(208) at 25.3397 42.019 48.2977 in (null):A-9999 (28) other bump:2.26647 Ang OE1(152) at 26.3933 40.4902 46.9978 in (null):Q-9999 (20) and CB(208) at 25.3397 42.019 48.2977 in (null):A-9999 (28) other bump:3.0686 Ang CB(149) at 23.4485 39.7054 48.9957 in (null):Q-9999 (20) and CB(208) at 25.3397 42.019 48.2977 in (null):A-9999 (28) other bump:2.73266 Ang CG(150) at 24.3735 39.509 47.8142 in (null):Q-9999 (20) and CB(208) at 25.3397 42.019 48.2977 in (null):A-9999 (28) other bump:1.8026 Ang CD(151) at 25.6734 40.2788 47.9664 in (null):Q-9999 (20) and CB(208) at 25.3397 42.019 48.2977 in (null):A-9999 (28) other bump:1.68361 Ang NE2(153) at 25.9659 40.7263 49.1759 in (null):Q-9999 (20) and CB(208) at 25.3397 42.019 48.2977 in (null):A-9999 (28) other bump:2.6974 Ang CD2(133) at 25.1795 41.2297 46.3748 in (null):H-9999 (18) and CA(207) at 26.84 42.28 48.223 in (null):A-9999 (28) other bump:2.94152 Ang NE2(136) at 25.289 40.0552 47.084 in (null):H-9999 (18) and CA(207) at 26.84 42.28 48.223 in (null):A-9999 (28) other bump:2.21451 Ang OE1(152) at 26.3933 40.4902 46.9978 in (null):Q-9999 (20) and CA(207) at 26.84 42.28 48.223 in (null):A-9999 (28) other bump:2.33062 Ang CD(151) at 25.6734 40.2788 47.9664 in (null):Q-9999 (20) and CA(207) at 26.84 42.28 48.223 in (null):A-9999 (28) other bump:2.02143 Ang NE2(153) at 25.9659 40.7263 49.1759 in (null):Q-9999 (20) and CA(207) at 26.84 42.28 48.223 in (null):A-9999 (28) other bump:2.52278 Ang CD(151) at 25.6734 40.2788 47.9664 in (null):Q-9999 (20) and N(206) at 27.522 41.46 49.212 in (null):A-9999 (28) other bump:1.7208 Ang NE2(153) at 25.9659 40.7263 49.1759 in (null):Q-9999 (20) and N(206) at 27.522 41.46 49.212 in (null):A-9999 (28) other bump:1.66288 Ang CD1(16) at 30.0362 36.5839 46.4283 in (null):I-9999 (3) and CE(203) at 28.7809 37.1657 47.3508 in (null):M-9999 (27) other bump:3.1101 Ang CG1(14) at 30.8471 35.9864 45.2851 in (null):I-9999 (3) and SD(202) at 30.3929 37.2058 48.1099 in (null):M-9999 (27) other bump:1.82805 Ang CD1(16) at 30.0362 36.5839 46.4283 in (null):I-9999 (3) and SD(202) at 30.3929 37.2058 48.1099 in (null):M-9999 (27) other bump:2.83105 Ang CB(149) at 23.4485 39.7054 48.9957 in (null):Q-9999 (20) and C(184) at 25.294 39.002 51.024 in (null):A-9999 (24) other bump:2.61533 Ang NE2(153) at 25.9659 40.7263 49.1759 in (null):Q-9999 (20) and C(184) at 25.294 39.002 51.024 in (null):A-9999 (24) other bump:2.42942 Ang CB(149) at 23.4485 39.7054 48.9957 in (null):Q-9999 (20) and O(183) at 25.645 39.631 50.031 in (null):A-9999 (24) other bump:2.55844 Ang CG(150) at 24.3735 39.509 47.8142 in (null):Q-9999 (20) and O(183) at 25.645 39.631 50.031 in (null):A-9999 (24) other bump:2.16407 Ang CD(151) at 25.6734 40.2788 47.9664 in (null):Q-9999 (20) and O(183) at 25.645 39.631 50.031 in (null):A-9999 (24) other bump:1.4261 Ang NE2(153) at 25.9659 40.7263 49.1759 in (null):Q-9999 (20) and O(183) at 25.645 39.631 50.031 in (null):A-9999 (24) other bump:2.2988 Ang NE2(136) at 25.289 40.0552 47.084 in (null):H-9999 (18) and NE2(153) at 25.9659 40.7263 49.1759 in (null):Q-9999 (20) other bump:1.9967 Ang CE1(135) at 25.2574 39.0081 46.2906 in (null):H-9999 (18) and OE1(152) at 26.3933 40.4902 46.9978 in (null):Q-9999 (20) other bump:1.55186 Ang CD2(133) at 25.1795 41.2297 46.3748 in (null):H-9999 (18) and OE1(152) at 26.3933 40.4902 46.9978 in (null):Q-9999 (20) other bump:1.18996 Ang NE2(136) at 25.289 40.0552 47.084 in (null):H-9999 (18) and OE1(152) at 26.3933 40.4902 46.9978 in (null):Q-9999 (20) other bump:2.14374 Ang CE1(135) at 25.2574 39.0081 46.2906 in (null):H-9999 (18) and CD(151) at 25.6734 40.2788 47.9664 in (null):Q-9999 (20) other bump:3.02372 Ang CG(132) at 25.067 40.8725 45.0641 in (null):H-9999 (18) and CD(151) at 25.6734 40.2788 47.9664 in (null):Q-9999 (20) other bump:1.9186 Ang CD2(133) at 25.1795 41.2297 46.3748 in (null):H-9999 (18) and CD(151) at 25.6734 40.2788 47.9664 in (null):Q-9999 (20) other bump:0.988024 Ang NE2(136) at 25.289 40.0552 47.084 in (null):H-9999 (18) and CD(151) at 25.6734 40.2788 47.9664 in (null):Q-9999 (20) other bump:1.83126 Ang CE1(135) at 25.2574 39.0081 46.2906 in (null):H-9999 (18) and CG(150) at 24.3735 39.509 47.8142 in (null):Q-9999 (20) other bump:2.38382 Ang CD2(133) at 25.1795 41.2297 46.3748 in (null):H-9999 (18) and CG(150) at 24.3735 39.509 47.8142 in (null):Q-9999 (20) other bump:1.2922 Ang NE2(136) at 25.289 40.0552 47.084 in (null):H-9999 (18) and CG(150) at 24.3735 39.509 47.8142 in (null):Q-9999 (20) other bump:2.67664 Ang NE2(136) at 25.289 40.0552 47.084 in (null):H-9999 (18) and CB(149) at 23.4485 39.7054 48.9957 in (null):Q-9999 (20) neighbor-bump: 1.75282 Ang O(106) at 28.397 46.25 32.101 in (null):N-9999 (14) and CG2(111) at 27.9037 47.0441 33.5837 in (null):T-9999 (15) neighbor-bump: 2.57224 Ang C(107) at 28.977 45.163 32.196 in (null):N-9999 (14) and CG2(111) at 27.9037 47.0441 33.5837 in (null):T-9999 (15) self-bump: 2.13543 Ang CB(102) at 29.0771 44.8147 30.0915 in (null):N-9999 (14) and C(107) at 28.977 45.163 32.196 in (null):N-9999 (14) other bump:3.04796 Ang CG(40) at 31.3708 32.6312 39.1512 in (null):Q-9999 (6) and CZ(72) at 30.7862 30.8265 36.7655 in (null):Y-9999 (10) other bump:2.24723 Ang CG(40) at 31.3708 32.6312 39.1512 in (null):Q-9999 (6) and CE1(70) at 31.2405 32.123 36.9661 in (null):Y-9999 (10) other bump:3.1629 Ang C(45) at 32.297 35.05 37.532 in (null):Q-9999 (6) and CE1(70) at 31.2405 32.123 36.9661 in (null):Y-9999 (10) other bump:1.94459 Ang O(44) at 32.179 34.559 36.406 in (null):Q-9999 (6) and CD1(68) at 30.938 33.1101 36.0291 in (null):Y-9999 (10) other bump:2.80512 Ang C(45) at 32.297 35.05 37.532 in (null):Q-9999 (6) and CD1(68) at 30.938 33.1101 36.0291 in (null):Y-9999 (10) Number of specific fragments= 1 total=31 Number of alignments=14 # Reading fragments from alignment file # T0159 read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1f2vA/T0159-1f2vA-2track-protein-STR-local-adpstyle1.pw.a2m.gz # 1f2vA read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1f2vA/T0159-1f2vA-2track-protein-STR-local-adpstyle1.pw.a2m.gz # adding 1f2vA to template set 1f2vA:# found chain 1f2vA in template set T0159 40 :IAKLFDTNGDGKADLTGCNPGWGCEGAINHQLAAYELTNTVTHNQG 1f2vA 145 :LLEMLRDGAPKPAAILGMPVGFVGAAESKDALAENSYGVPFAIVRG Fragment has 51 clashes (null) has 51 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 48 residues other bump:2.77075 Ang OE1(177) at 53.7215 14.9878 5.18304 in (null):E-9999 (25) and CA(340) at 52.846 12.366 5.375 in (null):G-9999 (47) other bump:2.5275 Ang CD2(230) at 52.196 17.744 19.622 in (null):L-9999 (32) and CG2(298) at 49.9999 18.0014 20.8463 in (null):V-9999 (41) other bump:2.74163 Ang CG(258) at 52.582 17.4371 21.5748 in (null):E-9999 (36) and CG2(298) at 49.9999 18.0014 20.8463 in (null):V-9999 (41) other bump:3.05976 Ang CD1(229) at 51.86 18.451 17.264 in (null):L-9999 (32) and CG1(297) at 49.3817 17.2322 18.5811 in (null):V-9999 (41) other bump:3.0439 Ang CD2(230) at 52.196 17.744 19.622 in (null):L-9999 (32) and CG1(297) at 49.3817 17.2322 18.5811 in (null):V-9999 (41) other bump:1.82368 Ang O(262) at 53.754 20.587 24.306 in (null):E-9999 (36) and OD1(284) at 52.3769 21.5622 23.6142 in (null):N-9999 (39) other bump:2.48975 Ang CG(107) at 50.7329 23.4805 19.7765 in (null):L-9999 (15) and ND2(283) at 51.1099 22.6153 22.0804 in (null):N-9999 (39) other bump:2.11306 Ang CD1(108) at 52.0724 22.9184 20.2239 in (null):L-9999 (15) and ND2(283) at 51.1099 22.6153 22.0804 in (null):N-9999 (39) other bump:1.37652 Ang C(232) at 54.116 15.633 19.802 in (null):L-9999 (32) and OE2(261) at 53.6377 16.8892 19.5053 in (null):E-9999 (36) other bump:2.41741 Ang N(233) at 53.742 14.486 19.265 in (null):A-9999 (33) and OE2(261) at 53.6377 16.8892 19.5053 in (null):E-9999 (36) other bump:1.68202 Ang CB(227) at 53.873 17.16 17.862 in (null):L-9999 (32) and OE2(261) at 53.6377 16.8892 19.5053 in (null):E-9999 (36) other bump:1.90363 Ang CG(228) at 52.883 18.204 18.354 in (null):L-9999 (32) and OE2(261) at 53.6377 16.8892 19.5053 in (null):E-9999 (36) other bump:1.6801 Ang CD2(230) at 52.196 17.744 19.622 in (null):L-9999 (32) and OE2(261) at 53.6377 16.8892 19.5053 in (null):E-9999 (36) other bump:1.79341 Ang O(231) at 53.916 15.938 21 in (null):L-9999 (32) and OE2(261) at 53.6377 16.8892 19.5053 in (null):E-9999 (36) other bump:1.41267 Ang CA(226) at 54.862 16.574 18.875 in (null):L-9999 (32) and OE2(261) at 53.6377 16.8892 19.5053 in (null):E-9999 (36) other bump:2.26359 Ang CG(228) at 52.883 18.204 18.354 in (null):L-9999 (32) and OE1(260) at 53.9256 18.947 20.2207 in (null):E-9999 (36) other bump:2.19029 Ang CD2(230) at 52.196 17.744 19.622 in (null):L-9999 (32) and OE1(260) at 53.9256 18.947 20.2207 in (null):E-9999 (36) other bump:2.3496 Ang C(232) at 54.116 15.633 19.802 in (null):L-9999 (32) and CD(259) at 53.4255 17.8062 20.3687 in (null):E-9999 (36) other bump:2.62702 Ang CB(227) at 53.873 17.16 17.862 in (null):L-9999 (32) and CD(259) at 53.4255 17.8062 20.3687 in (null):E-9999 (36) other bump:2.12403 Ang CG(228) at 52.883 18.204 18.354 in (null):L-9999 (32) and CD(259) at 53.4255 17.8062 20.3687 in (null):E-9999 (36) other bump:1.43982 Ang CD2(230) at 52.196 17.744 19.622 in (null):L-9999 (32) and CD(259) at 53.4255 17.8062 20.3687 in (null):E-9999 (36) other bump:2.03206 Ang O(231) at 53.916 15.938 21 in (null):L-9999 (32) and CD(259) at 53.4255 17.8062 20.3687 in (null):E-9999 (36) other bump:2.41099 Ang CA(226) at 54.862 16.574 18.875 in (null):L-9999 (32) and CD(259) at 53.4255 17.8062 20.3687 in (null):E-9999 (36) other bump:2.9582 Ang C(232) at 54.116 15.633 19.802 in (null):L-9999 (32) and CG(258) at 52.582 17.4371 21.5748 in (null):E-9999 (36) other bump:2.01412 Ang CD2(230) at 52.196 17.744 19.622 in (null):L-9999 (32) and CG(258) at 52.582 17.4371 21.5748 in (null):E-9999 (36) other bump:2.08743 Ang O(231) at 53.916 15.938 21 in (null):L-9999 (32) and CG(258) at 52.582 17.4371 21.5748 in (null):E-9999 (36) other bump:2.66619 Ang CB(139) at 51.258 18.1892 3.81986 in (null):P-9999 (20) and OE2(178) at 52.7882 16.897 5.57975 in (null):E-9999 (25) other bump:2.10283 Ang N(144) at 53.897 16.223 3.925 in (null):G-9999 (21) and OE2(178) at 52.7882 16.897 5.57975 in (null):E-9999 (25) other bump:2.28892 Ang O(135) at 52.085 17.263 7.727 in (null):N-9999 (19) and OE2(178) at 52.7882 16.897 5.57975 in (null):E-9999 (25) other bump:2.32419 Ang C(136) at 52.172 18.411 7.232 in (null):N-9999 (19) and OE2(178) at 52.7882 16.897 5.57975 in (null):E-9999 (25) other bump:1.87777 Ang N(137) at 52.151 18.632 5.911 in (null):P-9999 (20) and OE2(178) at 52.7882 16.897 5.57975 in (null):E-9999 (25) other bump:1.12359 Ang CA(138) at 52.075 17.504 4.959 in (null):P-9999 (20) and OE2(178) at 52.7882 16.897 5.57975 in (null):E-9999 (25) other bump:2.33006 Ang O(142) at 54.238 18.362 4.493 in (null):P-9999 (20) and OE2(178) at 52.7882 16.897 5.57975 in (null):E-9999 (25) other bump:1.43225 Ang C(143) at 53.505 17.39 4.442 in (null):P-9999 (20) and OE2(178) at 52.7882 16.897 5.57975 in (null):E-9999 (25) other bump:1.77179 Ang N(144) at 53.897 16.223 3.925 in (null):G-9999 (21) and OE1(177) at 53.7215 14.9878 5.18304 in (null):E-9999 (25) other bump:2.52324 Ang C(143) at 53.505 17.39 4.442 in (null):P-9999 (20) and OE1(177) at 53.7215 14.9878 5.18304 in (null):E-9999 (25) other bump:2.73937 Ang C(147) at 55.946 14.853 3.59 in (null):G-9999 (21) and OE1(177) at 53.7215 14.9878 5.18304 in (null):E-9999 (25) other bump:2.24577 Ang O(146) at 55.557 13.977 4.375 in (null):G-9999 (21) and OE1(177) at 53.7215 14.9878 5.18304 in (null):E-9999 (25) other bump:2.6306 Ang CA(145) at 55.223 16.151 3.363 in (null):G-9999 (21) and OE1(177) at 53.7215 14.9878 5.18304 in (null):E-9999 (25) other bump:2.02133 Ang N(144) at 53.897 16.223 3.925 in (null):G-9999 (21) and CD(176) at 53.5352 15.9743 5.89807 in (null):E-9999 (25) other bump:3.0944 Ang C(136) at 52.172 18.411 7.232 in (null):N-9999 (19) and CD(176) at 53.5352 15.9743 5.89807 in (null):E-9999 (25) other bump:2.99662 Ang N(137) at 52.151 18.632 5.911 in (null):P-9999 (20) and CD(176) at 53.5352 15.9743 5.89807 in (null):E-9999 (25) other bump:2.31389 Ang CA(138) at 52.075 17.504 4.959 in (null):P-9999 (20) and CD(176) at 53.5352 15.9743 5.89807 in (null):E-9999 (25) other bump:2.0311 Ang C(143) at 53.505 17.39 4.442 in (null):P-9999 (20) and CD(176) at 53.5352 15.9743 5.89807 in (null):E-9999 (25) other bump:3.05066 Ang CA(145) at 55.223 16.151 3.363 in (null):G-9999 (21) and CD(176) at 53.5352 15.9743 5.89807 in (null):E-9999 (25) other bump:2.5268 Ang O(135) at 52.085 17.263 7.727 in (null):N-9999 (19) and CG(175) at 54.2269 16.0216 7.22142 in (null):E-9999 (25) other bump:3.15156 Ang C(136) at 52.172 18.411 7.232 in (null):N-9999 (19) and CG(175) at 54.2269 16.0216 7.22142 in (null):E-9999 (25) other bump:3.18104 Ang C(143) at 53.505 17.39 4.442 in (null):P-9999 (20) and CG(175) at 54.2269 16.0216 7.22142 in (null):E-9999 (25) other bump:2.97534 Ang CG(85) at 51.0148 27.4361 20.6968 in (null):K-9999 (12) and CD2(109) at 50.8794 24.8656 19.2044 in (null):L-9999 (15) other bump:1.83892 Ang CD(86) at 51.5731 26.5162 19.6242 in (null):K-9999 (12) and CD2(109) at 50.8794 24.8656 19.2044 in (null):L-9999 (15) other bump:2.97117 Ang CE(87) at 52.8726 27.0634 19.0464 in (null):K-9999 (12) and CD2(109) at 50.8794 24.8656 19.2044 in (null):L-9999 (15) T0159 86 :NYAAMMADTISRYKE 1f2vA 193 :GGSAMTAAALNSLAR Fragment has 15 clashes (null) has 15 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 17 residues other bump:2.81834 Ang CG2(64) at 41.3092 20.4645 13.0824 in (null):T-9999 (9) and CE1(99) at 40.3644 20.9507 15.6928 in (null):Y-9999 (13) other bump:2.88624 Ang CE1(16) at 44.99 16.8141 3.83801 in (null):Y-9999 (2) and CE(37) at 43.561 14.682 5.158 in (null):M-9999 (5) other bump:2.57411 Ang CE1(16) at 44.99 16.8141 3.83801 in (null):Y-9999 (2) and SD(36) at 44.231 15.983 6.153 in (null):M-9999 (5) other bump:2.55594 Ang OH(19) at 42.5849 16.9601 3.6622 in (null):Y-9999 (2) and CG(35) at 42.835 17.147 6.199 in (null):M-9999 (5) other bump:2.61679 Ang CZ(18) at 43.8375 17.5268 3.51008 in (null):Y-9999 (2) and CB(34) at 43.5 18.461 5.931 in (null):M-9999 (5) other bump:2.87012 Ang OH(19) at 42.5849 16.9601 3.6622 in (null):Y-9999 (2) and CB(34) at 43.5 18.461 5.931 in (null):M-9999 (5) other bump:2.94141 Ang CE2(17) at 43.8869 18.8337 3.03906 in (null):Y-9999 (2) and CB(34) at 43.5 18.461 5.931 in (null):M-9999 (5) other bump:2.64901 Ang CE2(17) at 43.8869 18.8337 3.03906 in (null):Y-9999 (2) and N(32) at 43.058 20.539 4.889 in (null):M-9999 (5) neighbor-bump: 2.43323 Ang O(8) at 47.266 17.575 4.24 in (null):N-9999 (1) and CE1(16) at 44.99 16.8141 3.83801 in (null):Y-9999 (2) neighbor-bump: 1.1885 Ang O(8) at 47.266 17.575 4.24 in (null):N-9999 (1) and CD1(14) at 46.2306 17.4517 3.66973 in (null):Y-9999 (2) neighbor-bump: 2.3336 Ang C(9) at 47.867 17.903 5.271 in (null):N-9999 (1) and CD1(14) at 46.2306 17.4517 3.66973 in (null):Y-9999 (2) neighbor-bump: 1.82051 Ang O(8) at 47.266 17.575 4.24 in (null):N-9999 (1) and CG(13) at 46.3311 18.7582 3.22007 in (null):Y-9999 (2) neighbor-bump: 2.70124 Ang C(9) at 47.867 17.903 5.271 in (null):N-9999 (1) and CG(13) at 46.3311 18.7582 3.22007 in (null):Y-9999 (2) neighbor-bump: 2.23368 Ang O(8) at 47.266 17.575 4.24 in (null):N-9999 (1) and CB(12) at 47.6926 19.4473 3.09899 in (null):Y-9999 (2) neighbor-bump: 2.67074 Ang C(9) at 47.867 17.903 5.271 in (null):N-9999 (1) and CB(12) at 47.6926 19.4473 3.09899 in (null):Y-9999 (2) Number of specific fragments= 2 total=33 Number of alignments=15 # Reading fragments from alignment file # T0159 read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1f2vA/T0159-1f2vA-2track-protein-STR-local-adpstyle5.pw.a2m.gz # 1f2vA read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1f2vA/T0159-1f2vA-2track-protein-STR-local-adpstyle5.pw.a2m.gz # found chain 1f2vA in template set T0159 41 :AKLFDTNGDGKADLTGCNPGWGCEGAINHQLAAYELTNTVTHNQG 1f2vA 146 :LEMLRDGAPKPAAILGMPVGFVGAAESKDALAENSYGVPFAIVRG Fragment has 51 clashes (null) has 51 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 47 residues other bump:2.77075 Ang OE1(169) at 53.7215 14.9878 5.18304 in (null):E-9999 (24) and CA(332) at 52.846 12.366 5.375 in (null):G-9999 (46) other bump:2.5275 Ang CD2(222) at 52.196 17.744 19.622 in (null):L-9999 (31) and CG2(290) at 49.9999 18.0014 20.8463 in (null):V-9999 (40) other bump:2.74163 Ang CG(250) at 52.582 17.4371 21.5748 in (null):E-9999 (35) and CG2(290) at 49.9999 18.0014 20.8463 in (null):V-9999 (40) other bump:3.05976 Ang CD1(221) at 51.86 18.451 17.264 in (null):L-9999 (31) and CG1(289) at 49.3817 17.2322 18.5811 in (null):V-9999 (40) other bump:3.0439 Ang CD2(222) at 52.196 17.744 19.622 in (null):L-9999 (31) and CG1(289) at 49.3817 17.2322 18.5811 in (null):V-9999 (40) other bump:1.82368 Ang O(254) at 53.754 20.587 24.306 in (null):E-9999 (35) and OD1(276) at 52.3769 21.5622 23.6142 in (null):N-9999 (38) other bump:2.48975 Ang CG(99) at 50.7329 23.4805 19.7765 in (null):L-9999 (14) and ND2(275) at 51.1099 22.6153 22.0804 in (null):N-9999 (38) other bump:2.11306 Ang CD1(100) at 52.0724 22.9184 20.2239 in (null):L-9999 (14) and ND2(275) at 51.1099 22.6153 22.0804 in (null):N-9999 (38) other bump:1.37652 Ang C(224) at 54.116 15.633 19.802 in (null):L-9999 (31) and OE2(253) at 53.6377 16.8892 19.5053 in (null):E-9999 (35) other bump:2.41741 Ang N(225) at 53.742 14.486 19.265 in (null):A-9999 (32) and OE2(253) at 53.6377 16.8892 19.5053 in (null):E-9999 (35) other bump:1.68202 Ang CB(219) at 53.873 17.16 17.862 in (null):L-9999 (31) and OE2(253) at 53.6377 16.8892 19.5053 in (null):E-9999 (35) other bump:1.90363 Ang CG(220) at 52.883 18.204 18.354 in (null):L-9999 (31) and OE2(253) at 53.6377 16.8892 19.5053 in (null):E-9999 (35) other bump:1.6801 Ang CD2(222) at 52.196 17.744 19.622 in (null):L-9999 (31) and OE2(253) at 53.6377 16.8892 19.5053 in (null):E-9999 (35) other bump:1.79341 Ang O(223) at 53.916 15.938 21 in (null):L-9999 (31) and OE2(253) at 53.6377 16.8892 19.5053 in (null):E-9999 (35) other bump:1.41267 Ang CA(218) at 54.862 16.574 18.875 in (null):L-9999 (31) and OE2(253) at 53.6377 16.8892 19.5053 in (null):E-9999 (35) other bump:2.26359 Ang CG(220) at 52.883 18.204 18.354 in (null):L-9999 (31) and OE1(252) at 53.9256 18.947 20.2207 in (null):E-9999 (35) other bump:2.19029 Ang CD2(222) at 52.196 17.744 19.622 in (null):L-9999 (31) and OE1(252) at 53.9256 18.947 20.2207 in (null):E-9999 (35) other bump:2.3496 Ang C(224) at 54.116 15.633 19.802 in (null):L-9999 (31) and CD(251) at 53.4255 17.8062 20.3687 in (null):E-9999 (35) other bump:2.62702 Ang CB(219) at 53.873 17.16 17.862 in (null):L-9999 (31) and CD(251) at 53.4255 17.8062 20.3687 in (null):E-9999 (35) other bump:2.12403 Ang CG(220) at 52.883 18.204 18.354 in (null):L-9999 (31) and CD(251) at 53.4255 17.8062 20.3687 in (null):E-9999 (35) other bump:1.43982 Ang CD2(222) at 52.196 17.744 19.622 in (null):L-9999 (31) and CD(251) at 53.4255 17.8062 20.3687 in (null):E-9999 (35) other bump:2.03206 Ang O(223) at 53.916 15.938 21 in (null):L-9999 (31) and CD(251) at 53.4255 17.8062 20.3687 in (null):E-9999 (35) other bump:2.41099 Ang CA(218) at 54.862 16.574 18.875 in (null):L-9999 (31) and CD(251) at 53.4255 17.8062 20.3687 in (null):E-9999 (35) other bump:2.9582 Ang C(224) at 54.116 15.633 19.802 in (null):L-9999 (31) and CG(250) at 52.582 17.4371 21.5748 in (null):E-9999 (35) other bump:2.01412 Ang CD2(222) at 52.196 17.744 19.622 in (null):L-9999 (31) and CG(250) at 52.582 17.4371 21.5748 in (null):E-9999 (35) other bump:2.08743 Ang O(223) at 53.916 15.938 21 in (null):L-9999 (31) and CG(250) at 52.582 17.4371 21.5748 in (null):E-9999 (35) other bump:2.66619 Ang CB(131) at 51.258 18.1892 3.81986 in (null):P-9999 (19) and OE2(170) at 52.7882 16.897 5.57975 in (null):E-9999 (24) other bump:2.10283 Ang N(136) at 53.897 16.223 3.925 in (null):G-9999 (20) and OE2(170) at 52.7882 16.897 5.57975 in (null):E-9999 (24) other bump:2.28892 Ang O(127) at 52.085 17.263 7.727 in (null):N-9999 (18) and OE2(170) at 52.7882 16.897 5.57975 in (null):E-9999 (24) other bump:2.32419 Ang C(128) at 52.172 18.411 7.232 in (null):N-9999 (18) and OE2(170) at 52.7882 16.897 5.57975 in (null):E-9999 (24) other bump:1.87777 Ang N(129) at 52.151 18.632 5.911 in (null):P-9999 (19) and OE2(170) at 52.7882 16.897 5.57975 in (null):E-9999 (24) other bump:1.12359 Ang CA(130) at 52.075 17.504 4.959 in (null):P-9999 (19) and OE2(170) at 52.7882 16.897 5.57975 in (null):E-9999 (24) other bump:2.33006 Ang O(134) at 54.238 18.362 4.493 in (null):P-9999 (19) and OE2(170) at 52.7882 16.897 5.57975 in (null):E-9999 (24) other bump:1.43225 Ang C(135) at 53.505 17.39 4.442 in (null):P-9999 (19) and OE2(170) at 52.7882 16.897 5.57975 in (null):E-9999 (24) other bump:1.77179 Ang N(136) at 53.897 16.223 3.925 in (null):G-9999 (20) and OE1(169) at 53.7215 14.9878 5.18304 in (null):E-9999 (24) other bump:2.52324 Ang C(135) at 53.505 17.39 4.442 in (null):P-9999 (19) and OE1(169) at 53.7215 14.9878 5.18304 in (null):E-9999 (24) other bump:2.73937 Ang C(139) at 55.946 14.853 3.59 in (null):G-9999 (20) and OE1(169) at 53.7215 14.9878 5.18304 in (null):E-9999 (24) other bump:2.24577 Ang O(138) at 55.557 13.977 4.375 in (null):G-9999 (20) and OE1(169) at 53.7215 14.9878 5.18304 in (null):E-9999 (24) other bump:2.6306 Ang CA(137) at 55.223 16.151 3.363 in (null):G-9999 (20) and OE1(169) at 53.7215 14.9878 5.18304 in (null):E-9999 (24) other bump:2.02133 Ang N(136) at 53.897 16.223 3.925 in (null):G-9999 (20) and CD(168) at 53.5352 15.9743 5.89807 in (null):E-9999 (24) other bump:3.0944 Ang C(128) at 52.172 18.411 7.232 in (null):N-9999 (18) and CD(168) at 53.5352 15.9743 5.89807 in (null):E-9999 (24) other bump:2.99662 Ang N(129) at 52.151 18.632 5.911 in (null):P-9999 (19) and CD(168) at 53.5352 15.9743 5.89807 in (null):E-9999 (24) other bump:2.31389 Ang CA(130) at 52.075 17.504 4.959 in (null):P-9999 (19) and CD(168) at 53.5352 15.9743 5.89807 in (null):E-9999 (24) other bump:2.0311 Ang C(135) at 53.505 17.39 4.442 in (null):P-9999 (19) and CD(168) at 53.5352 15.9743 5.89807 in (null):E-9999 (24) other bump:3.05066 Ang CA(137) at 55.223 16.151 3.363 in (null):G-9999 (20) and CD(168) at 53.5352 15.9743 5.89807 in (null):E-9999 (24) other bump:2.5268 Ang O(127) at 52.085 17.263 7.727 in (null):N-9999 (18) and CG(167) at 54.2269 16.0216 7.22142 in (null):E-9999 (24) other bump:3.15156 Ang C(128) at 52.172 18.411 7.232 in (null):N-9999 (18) and CG(167) at 54.2269 16.0216 7.22142 in (null):E-9999 (24) other bump:3.18104 Ang C(135) at 53.505 17.39 4.442 in (null):P-9999 (19) and CG(167) at 54.2269 16.0216 7.22142 in (null):E-9999 (24) other bump:2.97534 Ang CG(77) at 51.0148 27.4361 20.6968 in (null):K-9999 (11) and CD2(101) at 50.8794 24.8656 19.2044 in (null):L-9999 (14) other bump:1.83892 Ang CD(78) at 51.5731 26.5162 19.6242 in (null):K-9999 (11) and CD2(101) at 50.8794 24.8656 19.2044 in (null):L-9999 (14) other bump:2.97117 Ang CE(79) at 52.8726 27.0634 19.0464 in (null):K-9999 (11) and CD2(101) at 50.8794 24.8656 19.2044 in (null):L-9999 (14) T0159 86 :NYAAMMADTISRYKE 1f2vA 193 :GGSAMTAAALNSLAR Fragment has 15 clashes (null) has 15 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 17 residues other bump:2.81834 Ang CG2(64) at 41.3092 20.4645 13.0824 in (null):T-9999 (9) and CE1(99) at 40.3644 20.9507 15.6928 in (null):Y-9999 (13) other bump:2.88624 Ang CE1(16) at 44.99 16.8141 3.83801 in (null):Y-9999 (2) and CE(37) at 43.561 14.682 5.158 in (null):M-9999 (5) other bump:2.57411 Ang CE1(16) at 44.99 16.8141 3.83801 in (null):Y-9999 (2) and SD(36) at 44.231 15.983 6.153 in (null):M-9999 (5) other bump:2.55594 Ang OH(19) at 42.5849 16.9601 3.6622 in (null):Y-9999 (2) and CG(35) at 42.835 17.147 6.199 in (null):M-9999 (5) other bump:2.61679 Ang CZ(18) at 43.8375 17.5268 3.51008 in (null):Y-9999 (2) and CB(34) at 43.5 18.461 5.931 in (null):M-9999 (5) other bump:2.87012 Ang OH(19) at 42.5849 16.9601 3.6622 in (null):Y-9999 (2) and CB(34) at 43.5 18.461 5.931 in (null):M-9999 (5) other bump:2.94141 Ang CE2(17) at 43.8869 18.8337 3.03906 in (null):Y-9999 (2) and CB(34) at 43.5 18.461 5.931 in (null):M-9999 (5) other bump:2.64901 Ang CE2(17) at 43.8869 18.8337 3.03906 in (null):Y-9999 (2) and N(32) at 43.058 20.539 4.889 in (null):M-9999 (5) neighbor-bump: 2.43323 Ang O(8) at 47.266 17.575 4.24 in (null):N-9999 (1) and CE1(16) at 44.99 16.8141 3.83801 in (null):Y-9999 (2) neighbor-bump: 1.1885 Ang O(8) at 47.266 17.575 4.24 in (null):N-9999 (1) and CD1(14) at 46.2306 17.4517 3.66973 in (null):Y-9999 (2) neighbor-bump: 2.3336 Ang C(9) at 47.867 17.903 5.271 in (null):N-9999 (1) and CD1(14) at 46.2306 17.4517 3.66973 in (null):Y-9999 (2) neighbor-bump: 1.82051 Ang O(8) at 47.266 17.575 4.24 in (null):N-9999 (1) and CG(13) at 46.3311 18.7582 3.22007 in (null):Y-9999 (2) neighbor-bump: 2.70124 Ang C(9) at 47.867 17.903 5.271 in (null):N-9999 (1) and CG(13) at 46.3311 18.7582 3.22007 in (null):Y-9999 (2) neighbor-bump: 2.23368 Ang O(8) at 47.266 17.575 4.24 in (null):N-9999 (1) and CB(12) at 47.6926 19.4473 3.09899 in (null):Y-9999 (2) neighbor-bump: 2.67074 Ang C(9) at 47.867 17.903 5.271 in (null):N-9999 (1) and CB(12) at 47.6926 19.4473 3.09899 in (null):Y-9999 (2) Number of specific fragments= 2 total=35 Number of alignments=16 # Reading fragments from alignment file # T0159 read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1kq3A/T0159-1kq3A-2track-protein-STR-global-adpstyle1.pw.a2m.gz # 1kq3A read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1kq3A/T0159-1kq3A-2track-protein-STR-global-adpstyle1.pw.a2m.gz # found chain 1kq3A in template set T0159 13 :AAQGYLIDKKTADQYKITNI 1kq3A 1 :MITTTIFPGRYVQGAGAINI Fragment has 8 clashes (null) has 8 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 22 residues other bump:2.8991 Ang CD(103) at 16.3279 37.3475 9.85295 in (null):Q-9999 (14) and CD1(134) at 15.7423 34.5923 10.5388 in (null):I-9999 (17) other bump:2.41473 Ang OE1(104) at 16.2503 36.4268 9.05309 in (null):Q-9999 (14) and CD1(134) at 15.7423 34.5923 10.5388 in (null):I-9999 (17) neighbor-bump: 2.95279 Ang CD1(112) at 16.2084 41.2072 17.4707 in (null):Y-9999 (15) and NZ(126) at 13.7135 42.1016 18.7725 in (null):K-9999 (16) neighbor-bump: 2.05546 Ang CE1(114) at 15.6692 41.4717 18.7121 in (null):Y-9999 (15) and NZ(126) at 13.7135 42.1016 18.7725 in (null):K-9999 (16) neighbor-bump: 3.02333 Ang CZ(116) at 16.4187 41.3174 19.8715 in (null):Y-9999 (15) and NZ(126) at 13.7135 42.1016 18.7725 in (null):K-9999 (16) neighbor-bump: 2.02203 Ang CE1(114) at 15.6692 41.4717 18.7121 in (null):Y-9999 (15) and CE(125) at 13.8898 40.7294 19.3215 in (null):K-9999 (16) neighbor-bump: 2.65399 Ang CZ(116) at 16.4187 41.3174 19.8715 in (null):Y-9999 (15) and CE(125) at 13.8898 40.7294 19.3215 in (null):K-9999 (16) neighbor-bump: 2.61371 Ang CG2(49) at 25.4525 25.3062 1.15238 in (null):I-9999 (7) and O(59) at 23.118 24.68 2.147 in (null):D-9999 (8) T0159 33 :AQLKDPKIAKLF 1kq3A 42 :KNVLGENFFSSF Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:1.89817 Ang CA(25) at 12.05 29.665 24.123 in (null):K-9999 (4) and CD1(62) at 10.3188 29.0898 23.5984 in (null):I-9999 (8) other bump:1.62 Ang CB(26) at 11.7927 28.6065 23.1309 in (null):K-9999 (4) and CD1(62) at 10.3188 29.0898 23.5984 in (null):I-9999 (8) other bump:1.89638 Ang O(31) at 9.91 30.614 24.65 in (null):K-9999 (4) and CD1(62) at 10.3188 29.0898 23.5984 in (null):I-9999 (8) other bump:1.6778 Ang C(32) at 10.82 29.864 25 in (null):K-9999 (4) and CD1(62) at 10.3188 29.0898 23.5984 in (null):I-9999 (8) other bump:2.58557 Ang N(33) at 10.812 29.178 26.135 in (null):D-9999 (5) and CD1(62) at 10.3188 29.0898 23.5984 in (null):I-9999 (8) other bump:2.24989 Ang OD1(37) at 8.06164 30.5631 25.3384 in (null):D-9999 (5) and CG1(60) at 8.82469 29.3876 23.5783 in (null):I-9999 (8) other bump:1.95719 Ang O(31) at 9.91 30.614 24.65 in (null):K-9999 (4) and CG1(60) at 8.82469 29.3876 23.5783 in (null):I-9999 (8) other bump:2.49592 Ang C(32) at 10.82 29.864 25 in (null):K-9999 (4) and CG1(60) at 8.82469 29.3876 23.5783 in (null):I-9999 (8) neighbor-bump: 2.33117 Ang O(31) at 9.91 30.614 24.65 in (null):K-9999 (4) and CG(36) at 8.43464 31.1804 26.3637 in (null):D-9999 (5) self-bump: 1.39115 Ang CA(34) at 9.664 29.246 27.026 in (null):D-9999 (5) and CB(35) at 9.19458 30.4835 27.4543 in (null):D-9999 (5) T0159 46 :TNGDGKADLTGCN 1kq3A 54 :TKVRVNKQIFGGE Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues neighbor-bump: 2.08747 Ang O(72) at 19.955 13.793 28.831 in (null):G-9999 (11) and CB(76) at 21.5549 15.1321 28.7616 in (null):C-9999 (12) neighbor-bump: 2.55059 Ang C(73) at 19.53 14.009 27.692 in (null):G-9999 (11) and CB(76) at 21.5549 15.1321 28.7616 in (null):C-9999 (12) T0159 63 :CEGAINHQLAAYELT 1kq3A 67 :CSDEEIERLSGLVEE Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 17 residues other bump:2.40689 Ang O(59) at 12.876 7.34 20.983 in (null):Q-9999 (8) and CD1(83) at 10.8344 8.20905 21.9156 in (null):Y-9999 (12) other bump:2.94541 Ang OE2(14) at 21.9928 7.3873 26.0847 in (null):E-9999 (2) and CG1(29) at 20.4921 9.54057 24.7481 in (null):I-9999 (5) other bump:3.17867 Ang CG(11) at 23.1146 8.04205 24.0794 in (null):E-9999 (2) and N(26) at 20.294 7.338 22.794 in (null):I-9999 (5) T0159 78 :NTVTHNQGNYAAMMADTISRYKEGKPVFYYT 1kq3A 83 :TDVVVGIGGGKTLDTAKAVAYKLKKPVVIVP Fragment has 66 clashes (null) has 66 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 33 residues other bump:2.62226 Ang SD(96) at 23.3895 23.2617 16.5851 in (null):M-9999 (13) and OG1(249) at 23.6394 25.805 15.9973 in (null):T-9999 (31) other bump:2.30233 Ang CA(122) at 20.93 15.257 12.461 in (null):T-9999 (17) and OH(230) at 20.6057 16.9838 10.9732 in (null):Y-9999 (29) other bump:2.66629 Ang CG1(206) at 18.955 17.949 9.115 in (null):V-9999 (27) and OH(230) at 20.6057 16.9838 10.9732 in (null):Y-9999 (29) other bump:2.80166 Ang CG2(124) at 22.9422 15.438 10.9638 in (null):T-9999 (17) and OH(230) at 20.6057 16.9838 10.9732 in (null):Y-9999 (29) other bump:2.47852 Ang CB(123) at 22.3466 15.8251 12.3033 in (null):T-9999 (17) and OH(230) at 20.6057 16.9838 10.9732 in (null):Y-9999 (29) other bump:2.16977 Ang OG1(125) at 22.2403 17.2738 12.3702 in (null):T-9999 (17) and OH(230) at 20.6057 16.9838 10.9732 in (null):Y-9999 (29) other bump:3.09062 Ang CZ(148) at 17.5683 17.9782 11.9253 in (null):R-9999 (20) and CZ(229) at 20.5826 18.3081 11.3277 in (null):Y-9999 (29) other bump:2.00606 Ang NH2(150) at 18.7743 18.4787 12.1792 in (null):R-9999 (20) and CZ(229) at 20.5826 18.3081 11.3277 in (null):Y-9999 (29) other bump:2.77022 Ang CG1(206) at 18.955 17.949 9.115 in (null):V-9999 (27) and CZ(229) at 20.5826 18.3081 11.3277 in (null):Y-9999 (29) other bump:2.21463 Ang OG1(125) at 22.2403 17.2738 12.3702 in (null):T-9999 (17) and CZ(229) at 20.5826 18.3081 11.3277 in (null):Y-9999 (29) other bump:2.66822 Ang NH2(150) at 18.7743 18.4787 12.1792 in (null):R-9999 (20) and CE2(228) at 20.5385 19.3083 10.3574 in (null):Y-9999 (29) other bump:2.42868 Ang CG1(206) at 18.955 17.949 9.115 in (null):V-9999 (27) and CE2(228) at 20.5385 19.3083 10.3574 in (null):Y-9999 (29) other bump:1.92198 Ang NH2(150) at 18.7743 18.4787 12.1792 in (null):R-9999 (20) and CE1(227) at 20.6269 18.6276 12.6689 in (null):Y-9999 (29) other bump:2.1272 Ang OG1(125) at 22.2403 17.2738 12.3702 in (null):T-9999 (17) and CE1(227) at 20.6269 18.6276 12.6689 in (null):Y-9999 (29) other bump:2.53202 Ang NH2(150) at 18.7743 18.4787 12.1792 in (null):R-9999 (20) and CD1(225) at 20.6331 19.96 13.0519 in (null):Y-9999 (29) other bump:2.90832 Ang ND1(36) at 14.5355 22.9569 14.5365 in (null):H-9999 (5) and CD2(215) at 14.5901 24.6241 12.1541 in (null):F-9999 (28) other bump:2.27733 Ang CD(146) at 16.152 16.5439 10.4906 in (null):R-9999 (20) and CG2(207) at 17.769 17.909 11.332 in (null):V-9999 (27) other bump:1.88519 Ang NH1(149) at 16.5406 18.3101 12.7046 in (null):R-9999 (20) and CG2(207) at 17.769 17.909 11.332 in (null):V-9999 (27) other bump:0.939629 Ang NE(147) at 17.4062 17.1677 10.8828 in (null):R-9999 (20) and CG2(207) at 17.769 17.909 11.332 in (null):V-9999 (27) other bump:0.630083 Ang CZ(148) at 17.5683 17.9782 11.9253 in (null):R-9999 (20) and CG2(207) at 17.769 17.909 11.332 in (null):V-9999 (27) other bump:1.43282 Ang NH2(150) at 18.7743 18.4787 12.1792 in (null):R-9999 (20) and CG2(207) at 17.769 17.909 11.332 in (null):V-9999 (27) other bump:2.4768 Ang NE(147) at 17.4062 17.1677 10.8828 in (null):R-9999 (20) and CG1(206) at 18.955 17.949 9.115 in (null):V-9999 (27) other bump:3.11491 Ang NH2(150) at 18.7743 18.4787 12.1792 in (null):R-9999 (20) and CG1(206) at 18.955 17.949 9.115 in (null):V-9999 (27) other bump:1.95889 Ang CD(146) at 16.152 16.5439 10.4906 in (null):R-9999 (20) and CB(205) at 17.643 17.631 9.833 in (null):V-9999 (27) other bump:1.17171 Ang NE(147) at 17.4062 17.1677 10.8828 in (null):R-9999 (20) and CB(205) at 17.643 17.631 9.833 in (null):V-9999 (27) other bump:2.12218 Ang CZ(148) at 17.5683 17.9782 11.9253 in (null):R-9999 (20) and CB(205) at 17.643 17.631 9.833 in (null):V-9999 (27) other bump:2.73919 Ang NH2(150) at 18.7743 18.4787 12.1792 in (null):R-9999 (20) and CB(205) at 17.643 17.631 9.833 in (null):V-9999 (27) other bump:2.28534 Ang CD(146) at 16.152 16.5439 10.4906 in (null):R-9999 (20) and CA(204) at 16.456 18.421 9.223 in (null):V-9999 (27) other bump:2.28664 Ang NE(147) at 17.4062 17.1677 10.8828 in (null):R-9999 (20) and CA(204) at 16.456 18.421 9.223 in (null):V-9999 (27) other bump:2.95561 Ang CZ(148) at 17.5683 17.9782 11.9253 in (null):R-9999 (20) and CA(204) at 16.456 18.421 9.223 in (null):V-9999 (27) other bump:2.96518 Ang CD(146) at 16.152 16.5439 10.4906 in (null):R-9999 (20) and N(203) at 16.192 17.942 7.876 in (null):V-9999 (27) other bump:3.06575 Ang CD(146) at 16.152 16.5439 10.4906 in (null):R-9999 (20) and C(202) at 15.169 17.113 7.643 in (null):P-9999 (26) other bump:2.62864 Ang CD(146) at 16.152 16.5439 10.4906 in (null):R-9999 (20) and O(201) at 14.391 16.731 8.548 in (null):P-9999 (26) other bump:2.74244 Ang C(30) at 13.81 18.134 12.521 in (null):T-9999 (4) and NH1(149) at 16.5406 18.3101 12.7046 in (null):R-9999 (20) other bump:1.94507 Ang OG1(28) at 14.9815 15.544 11.6795 in (null):T-9999 (4) and CD(146) at 16.152 16.5439 10.4906 in (null):R-9999 (20) other bump:2.76438 Ang CB(26) at 13.8169 15.5846 12.5118 in (null):T-9999 (4) and CG(145) at 16.053 15.0903 10.9635 in (null):R-9999 (20) other bump:1.36621 Ang OG1(28) at 14.9815 15.544 11.6795 in (null):T-9999 (4) and CG(145) at 16.053 15.0903 10.9635 in (null):R-9999 (20) other bump:2.79949 Ang C(40) at 15.17 19.649 15.44 in (null):H-9999 (5) and OD2(118) at 17.3963 18.8669 16.9463 in (null):D-9999 (16) other bump:2.29285 Ang N(41) at 16.334 20.291 15.497 in (null):N-9999 (6) and OD2(118) at 17.3963 18.8669 16.9463 in (null):D-9999 (16) other bump:1.43991 Ang CA(42) at 17.174 20.264 16.678 in (null):N-9999 (6) and OD2(118) at 17.3963 18.8669 16.9463 in (null):D-9999 (16) other bump:1.50544 Ang CB(43) at 18.5461 19.6559 16.3792 in (null):N-9999 (6) and OD2(118) at 17.3963 18.8669 16.9463 in (null):D-9999 (16) other bump:2.84107 Ang C(48) at 17.334 21.699 17.163 in (null):N-9999 (6) and OD2(118) at 17.3963 18.8669 16.9463 in (null):D-9999 (16) other bump:2.36949 Ang CG(44) at 19.4551 19.8469 17.5907 in (null):N-9999 (6) and OD2(118) at 17.3963 18.8669 16.9463 in (null):D-9999 (16) other bump:2.65479 Ang CA(42) at 17.174 20.264 16.678 in (null):N-9999 (6) and CG(116) at 17.5914 17.644 16.7747 in (null):D-9999 (16) other bump:2.26178 Ang CB(43) at 18.5461 19.6559 16.3792 in (null):N-9999 (6) and CG(116) at 17.5914 17.644 16.7747 in (null):D-9999 (16) other bump:2.99868 Ang CG(44) at 19.4551 19.8469 17.5907 in (null):N-9999 (6) and CG(116) at 17.5914 17.644 16.7747 in (null):D-9999 (16) other bump:2.61992 Ang CB(43) at 18.5461 19.6559 16.3792 in (null):N-9999 (6) and CB(115) at 18.259 17.2097 15.4861 in (null):D-9999 (16) other bump:3.27647 Ang CE1(76) at 29.3618 19.3339 17.0427 in (null):Y-9999 (10) and SD(104) at 27.9406 16.4666 17.7454 in (null):M-9999 (14) other bump:2.7058 Ang OH(79) at 30.3085 17.1746 16.644 in (null):Y-9999 (10) and SD(104) at 27.9406 16.4666 17.7454 in (null):M-9999 (14) other bump:2.94077 Ang CD2(75) at 28.7179 18.5844 19.6319 in (null):Y-9999 (10) and SD(104) at 27.9406 16.4666 17.7454 in (null):M-9999 (14) other bump:2.15978 Ang CE2(77) at 29.3725 17.7032 18.7871 in (null):Y-9999 (10) and SD(104) at 27.9406 16.4666 17.7454 in (null):M-9999 (14) other bump:2.38273 Ang CZ(78) at 29.6846 18.0707 17.4951 in (null):Y-9999 (10) and SD(104) at 27.9406 16.4666 17.7454 in (null):M-9999 (14) other bump:2.38514 Ang OD1(46) at 20.3377 20.6819 17.5968 in (null):N-9999 (6) and CG(95) at 22.3274 21.9163 17.1424 in (null):M-9999 (13) other bump:2.63015 Ang OD1(46) at 20.3377 20.6819 17.5968 in (null):N-9999 (6) and CB(94) at 22.7602 20.5601 16.5796 in (null):M-9999 (13) other bump:2.53535 Ang CG(44) at 19.4551 19.8469 17.5907 in (null):N-9999 (6) and CA(93) at 21.898 19.406 17.075 in (null):M-9999 (13) other bump:2.082 Ang OD1(46) at 20.3377 20.6819 17.5968 in (null):N-9999 (6) and CA(93) at 21.898 19.406 17.075 in (null):M-9999 (13) other bump:2.69266 Ang CG(44) at 19.4551 19.8469 17.5907 in (null):N-9999 (6) and N(92) at 21.916 19.283 18.527 in (null):M-9999 (13) other bump:2.17775 Ang ND2(45) at 19.1201 19.141 18.6772 in (null):N-9999 (6) and C(91) at 21.117 18.402 19.134 in (null):A-9999 (12) other bump:2.68909 Ang CG(44) at 19.4551 19.8469 17.5907 in (null):N-9999 (6) and C(91) at 21.117 18.402 19.134 in (null):A-9999 (12) other bump:2.85802 Ang OD1(46) at 20.3377 20.6819 17.5968 in (null):N-9999 (6) and C(91) at 21.117 18.402 19.134 in (null):A-9999 (12) other bump:1.93926 Ang ND2(45) at 19.1201 19.141 18.6772 in (null):N-9999 (6) and O(90) at 20.355 17.656 18.503 in (null):A-9999 (12) other bump:2.53812 Ang CG(44) at 19.4551 19.8469 17.5907 in (null):N-9999 (6) and O(90) at 20.355 17.656 18.503 in (null):A-9999 (12) other bump:2.54332 Ang NE2(38) at 14.0513 23.8958 16.3515 in (null):H-9999 (5) and NE2(55) at 13.32 25.0558 18.4935 in (null):Q-9999 (7) other bump:2.42204 Ang CE1(37) at 14.8048 24.0118 15.2811 in (null):H-9999 (5) and OE1(54) at 14.0413 25.9367 16.5374 in (null):Q-9999 (7) other bump:2.04934 Ang NE2(38) at 14.0513 23.8958 16.3515 in (null):H-9999 (5) and OE1(54) at 14.0413 25.9367 16.5374 in (null):Q-9999 (7) other bump:2.55029 Ang NE2(38) at 14.0513 23.8958 16.3515 in (null):H-9999 (5) and CG(52) at 15.6763 25.0007 17.9771 in (null):Q-9999 (7) T0159 113 :WVSNELKPGKDVVWLQVP 1kq3A 114 :TIASTDAPCSALSVIYTP Fragment has 8 clashes (null) has 8 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 20 residues neighbor-bump: 2.92786 Ang CG1(139) at 29.3519 5.43152 27.154 in (null):V-9999 (17) and CD(147) at 26.528 5.214 26.412 in (null):P-9999 (18) other bump:3.16177 Ang CG1(94) at 30.8065 15.1227 12.1133 in (null):V-9999 (12) and NE1(113) at 32.3801 15.9586 14.7252 in (null):W-9999 (14) other bump:2.51182 Ang CG1(19) at 25.673 27.244 22.124 in (null):V-9999 (2) and OD1(34) at 27.9444 28.0266 22.8572 in (null):N-9999 (4) other bump:2.47725 Ang CB(18) at 25.658 28.766 22.255 in (null):V-9999 (2) and OD1(34) at 27.9444 28.0266 22.8572 in (null):N-9999 (4) neighbor-bump: 3.03858 Ang CE3(9) at 22.7509 27.3033 23.8166 in (null):W-9999 (1) and CG2(20) at 25.047 29.279 23.576 in (null):V-9999 (2) neighbor-bump: 3.13158 Ang CZ3(12) at 23.6393 26.7076 24.6773 in (null):W-9999 (1) and CG2(20) at 25.047 29.279 23.576 in (null):V-9999 (2) neighbor-bump: 3.37742 Ang CE3(9) at 22.7509 27.3033 23.8166 in (null):W-9999 (1) and CG1(19) at 25.673 27.244 22.124 in (null):V-9999 (2) neighbor-bump: 3.30805 Ang CZ3(12) at 23.6393 26.7076 24.6773 in (null):W-9999 (1) and CG1(19) at 25.673 27.244 22.124 in (null):V-9999 (2) T0159 137 :DKNADTKLPNGANYG 1kq3A 132 :NGEFKRYLFLPRNPD Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 16 residues Number of specific fragments= 7 total=42 Number of alignments=17 # Reading fragments from alignment file # T0159 read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1kq3A/T0159-1kq3A-2track-protein-STR-global-adpstyle5.pw.a2m.gz # 1kq3A read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1kq3A/T0159-1kq3A-2track-protein-STR-global-adpstyle5.pw.a2m.gz # found chain 1kq3A in template set T0159 8 :VFVNGAAQGYLIDKKTAD 1kq3A 1 :MITTTIFPGRYVQGAGAI Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 20 residues neighbor-bump: 2.42792 Ang O(96) at 19.792 36.65 9.767 in (null):D-9999 (13) and CD(102) at 19.3936 39.0274 9.47736 in (null):K-9999 (14) neighbor-bump: 1.85682 Ang O(96) at 19.792 36.65 9.767 in (null):D-9999 (13) and CG(101) at 18.4407 37.9213 9.84096 in (null):K-9999 (14) neighbor-bump: 2.65856 Ang C(97) at 19.889 35.855 10.678 in (null):D-9999 (13) and CG(101) at 18.4407 37.9213 9.84096 in (null):K-9999 (14) other bump:2.67274 Ang CD2(67) at 16.835 29.026 4.98187 in (null):Y-9999 (10) and CG2(86) at 17.227 31.326 6.28556 in (null):I-9999 (12) other bump:1.85837 Ang CE2(69) at 16.1704 30.2253 5.22458 in (null):Y-9999 (10) and CG2(86) at 17.227 31.326 6.28556 in (null):I-9999 (12) other bump:2.34451 Ang CZ(70) at 16.1145 31.1889 4.22637 in (null):Y-9999 (10) and CG2(86) at 17.227 31.326 6.28556 in (null):I-9999 (12) T0159 26 :QYKIT 1kq3A 25 :LSRFG Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 7 residues neighbor-bump: 2.68016 Ang C(39) at 7.348 20.211 4.592 in (null):I-9999 (4) and CB(42) at 5.68172 18.6431 5.98791 in (null):T-9999 (5) T0159 34 :Q 1kq3A 38 :D Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 3 residues T0159 35 :LKDPKIAKLFD 1kq3A 44 :VLGENFFSSFT Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 13 residues other bump:1.89817 Ang CA(11) at 12.05 29.665 24.123 in (null):K-9999 (2) and CD1(48) at 10.3188 29.0898 23.5984 in (null):I-9999 (6) other bump:1.62 Ang CB(12) at 11.7927 28.6065 23.1309 in (null):K-9999 (2) and CD1(48) at 10.3188 29.0898 23.5984 in (null):I-9999 (6) other bump:1.89638 Ang O(17) at 9.91 30.614 24.65 in (null):K-9999 (2) and CD1(48) at 10.3188 29.0898 23.5984 in (null):I-9999 (6) other bump:1.6778 Ang C(18) at 10.82 29.864 25 in (null):K-9999 (2) and CD1(48) at 10.3188 29.0898 23.5984 in (null):I-9999 (6) other bump:2.58557 Ang N(19) at 10.812 29.178 26.135 in (null):D-9999 (3) and CD1(48) at 10.3188 29.0898 23.5984 in (null):I-9999 (6) other bump:2.24988 Ang OD1(23) at 8.06164 30.5631 25.3384 in (null):D-9999 (3) and CG1(46) at 8.82469 29.3876 23.5783 in (null):I-9999 (6) other bump:1.95719 Ang O(17) at 9.91 30.614 24.65 in (null):K-9999 (2) and CG1(46) at 8.82469 29.3876 23.5783 in (null):I-9999 (6) other bump:2.49592 Ang C(18) at 10.82 29.864 25 in (null):K-9999 (2) and CG1(46) at 8.82469 29.3876 23.5783 in (null):I-9999 (6) neighbor-bump: 2.33116 Ang O(17) at 9.91 30.614 24.65 in (null):K-9999 (2) and CG(22) at 8.43465 31.1804 26.3637 in (null):D-9999 (3) self-bump: 1.39115 Ang CA(20) at 9.664 29.246 27.026 in (null):D-9999 (3) and CB(21) at 9.19458 30.4835 27.4543 in (null):D-9999 (3) T0159 47 :NGDGKADLTGCN 1kq3A 55 :KVRVNKQIFGGE Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues neighbor-bump: 2.08747 Ang O(65) at 19.955 13.793 28.831 in (null):G-9999 (10) and CB(69) at 21.5549 15.1321 28.7616 in (null):C-9999 (11) neighbor-bump: 2.55059 Ang C(66) at 19.53 14.009 27.692 in (null):G-9999 (10) and CB(69) at 21.5549 15.1321 28.7616 in (null):C-9999 (11) T0159 63 :CEGAINHQLAAYELT 1kq3A 67 :CSDEEIERLSGLVEE Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 17 residues other bump:2.40689 Ang O(59) at 12.876 7.34 20.983 in (null):Q-9999 (8) and CD1(83) at 10.8344 8.20905 21.9156 in (null):Y-9999 (12) other bump:2.94541 Ang OE2(14) at 21.9928 7.3873 26.0847 in (null):E-9999 (2) and CG1(29) at 20.4921 9.54057 24.7481 in (null):I-9999 (5) other bump:3.17867 Ang CG(11) at 23.1146 8.04205 24.0794 in (null):E-9999 (2) and N(26) at 20.294 7.338 22.794 in (null):I-9999 (5) T0159 78 :NTVTHNQGNYAAMMADTISRYKEGKPVFYYT 1kq3A 83 :TDVVVGIGGGKTLDTAKAVAYKLKKPVVIVP Fragment has 66 clashes (null) has 66 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 33 residues other bump:2.62226 Ang SD(96) at 23.3895 23.2617 16.5851 in (null):M-9999 (13) and OG1(249) at 23.6394 25.805 15.9973 in (null):T-9999 (31) other bump:2.30233 Ang CA(122) at 20.93 15.257 12.461 in (null):T-9999 (17) and OH(230) at 20.6057 16.9838 10.9732 in (null):Y-9999 (29) other bump:2.66629 Ang CG1(206) at 18.955 17.949 9.115 in (null):V-9999 (27) and OH(230) at 20.6057 16.9838 10.9732 in (null):Y-9999 (29) other bump:2.80166 Ang CG2(124) at 22.9422 15.438 10.9638 in (null):T-9999 (17) and OH(230) at 20.6057 16.9838 10.9732 in (null):Y-9999 (29) other bump:2.47852 Ang CB(123) at 22.3466 15.8251 12.3033 in (null):T-9999 (17) and OH(230) at 20.6057 16.9838 10.9732 in (null):Y-9999 (29) other bump:2.16977 Ang OG1(125) at 22.2403 17.2738 12.3702 in (null):T-9999 (17) and OH(230) at 20.6057 16.9838 10.9732 in (null):Y-9999 (29) other bump:3.09062 Ang CZ(148) at 17.5683 17.9782 11.9253 in (null):R-9999 (20) and CZ(229) at 20.5826 18.3081 11.3277 in (null):Y-9999 (29) other bump:2.00606 Ang NH2(150) at 18.7743 18.4787 12.1792 in (null):R-9999 (20) and CZ(229) at 20.5826 18.3081 11.3277 in (null):Y-9999 (29) other bump:2.77022 Ang CG1(206) at 18.955 17.949 9.115 in (null):V-9999 (27) and CZ(229) at 20.5826 18.3081 11.3277 in (null):Y-9999 (29) other bump:2.21463 Ang OG1(125) at 22.2403 17.2738 12.3702 in (null):T-9999 (17) and CZ(229) at 20.5826 18.3081 11.3277 in (null):Y-9999 (29) other bump:2.66822 Ang NH2(150) at 18.7743 18.4787 12.1792 in (null):R-9999 (20) and CE2(228) at 20.5385 19.3083 10.3574 in (null):Y-9999 (29) other bump:2.42868 Ang CG1(206) at 18.955 17.949 9.115 in (null):V-9999 (27) and CE2(228) at 20.5385 19.3083 10.3574 in (null):Y-9999 (29) other bump:1.92198 Ang NH2(150) at 18.7743 18.4787 12.1792 in (null):R-9999 (20) and CE1(227) at 20.6269 18.6276 12.6689 in (null):Y-9999 (29) other bump:2.1272 Ang OG1(125) at 22.2403 17.2738 12.3702 in (null):T-9999 (17) and CE1(227) at 20.6269 18.6276 12.6689 in (null):Y-9999 (29) other bump:2.53202 Ang NH2(150) at 18.7743 18.4787 12.1792 in (null):R-9999 (20) and CD1(225) at 20.6331 19.96 13.0519 in (null):Y-9999 (29) other bump:2.90832 Ang ND1(36) at 14.5355 22.9569 14.5365 in (null):H-9999 (5) and CD2(215) at 14.5901 24.6241 12.1541 in (null):F-9999 (28) other bump:2.27733 Ang CD(146) at 16.152 16.5439 10.4906 in (null):R-9999 (20) and CG2(207) at 17.769 17.909 11.332 in (null):V-9999 (27) other bump:1.88519 Ang NH1(149) at 16.5406 18.3101 12.7046 in (null):R-9999 (20) and CG2(207) at 17.769 17.909 11.332 in (null):V-9999 (27) other bump:0.939629 Ang NE(147) at 17.4062 17.1677 10.8828 in (null):R-9999 (20) and CG2(207) at 17.769 17.909 11.332 in (null):V-9999 (27) other bump:0.630083 Ang CZ(148) at 17.5683 17.9782 11.9253 in (null):R-9999 (20) and CG2(207) at 17.769 17.909 11.332 in (null):V-9999 (27) other bump:1.43282 Ang NH2(150) at 18.7743 18.4787 12.1792 in (null):R-9999 (20) and CG2(207) at 17.769 17.909 11.332 in (null):V-9999 (27) other bump:2.4768 Ang NE(147) at 17.4062 17.1677 10.8828 in (null):R-9999 (20) and CG1(206) at 18.955 17.949 9.115 in (null):V-9999 (27) other bump:3.11491 Ang NH2(150) at 18.7743 18.4787 12.1792 in (null):R-9999 (20) and CG1(206) at 18.955 17.949 9.115 in (null):V-9999 (27) other bump:1.95889 Ang CD(146) at 16.152 16.5439 10.4906 in (null):R-9999 (20) and CB(205) at 17.643 17.631 9.833 in (null):V-9999 (27) other bump:1.17171 Ang NE(147) at 17.4062 17.1677 10.8828 in (null):R-9999 (20) and CB(205) at 17.643 17.631 9.833 in (null):V-9999 (27) other bump:2.12218 Ang CZ(148) at 17.5683 17.9782 11.9253 in (null):R-9999 (20) and CB(205) at 17.643 17.631 9.833 in (null):V-9999 (27) other bump:2.73919 Ang NH2(150) at 18.7743 18.4787 12.1792 in (null):R-9999 (20) and CB(205) at 17.643 17.631 9.833 in (null):V-9999 (27) other bump:2.28534 Ang CD(146) at 16.152 16.5439 10.4906 in (null):R-9999 (20) and CA(204) at 16.456 18.421 9.223 in (null):V-9999 (27) other bump:2.28664 Ang NE(147) at 17.4062 17.1677 10.8828 in (null):R-9999 (20) and CA(204) at 16.456 18.421 9.223 in (null):V-9999 (27) other bump:2.95561 Ang CZ(148) at 17.5683 17.9782 11.9253 in (null):R-9999 (20) and CA(204) at 16.456 18.421 9.223 in (null):V-9999 (27) other bump:2.96518 Ang CD(146) at 16.152 16.5439 10.4906 in (null):R-9999 (20) and N(203) at 16.192 17.942 7.876 in (null):V-9999 (27) other bump:3.06575 Ang CD(146) at 16.152 16.5439 10.4906 in (null):R-9999 (20) and C(202) at 15.169 17.113 7.643 in (null):P-9999 (26) other bump:2.62864 Ang CD(146) at 16.152 16.5439 10.4906 in (null):R-9999 (20) and O(201) at 14.391 16.731 8.548 in (null):P-9999 (26) other bump:2.74244 Ang C(30) at 13.81 18.134 12.521 in (null):T-9999 (4) and NH1(149) at 16.5406 18.3101 12.7046 in (null):R-9999 (20) other bump:1.94507 Ang OG1(28) at 14.9815 15.544 11.6795 in (null):T-9999 (4) and CD(146) at 16.152 16.5439 10.4906 in (null):R-9999 (20) other bump:2.76438 Ang CB(26) at 13.8169 15.5846 12.5118 in (null):T-9999 (4) and CG(145) at 16.053 15.0903 10.9635 in (null):R-9999 (20) other bump:1.36621 Ang OG1(28) at 14.9815 15.544 11.6795 in (null):T-9999 (4) and CG(145) at 16.053 15.0903 10.9635 in (null):R-9999 (20) other bump:2.79949 Ang C(40) at 15.17 19.649 15.44 in (null):H-9999 (5) and OD2(118) at 17.3963 18.8669 16.9463 in (null):D-9999 (16) other bump:2.29285 Ang N(41) at 16.334 20.291 15.497 in (null):N-9999 (6) and OD2(118) at 17.3963 18.8669 16.9463 in (null):D-9999 (16) other bump:1.43991 Ang CA(42) at 17.174 20.264 16.678 in (null):N-9999 (6) and OD2(118) at 17.3963 18.8669 16.9463 in (null):D-9999 (16) other bump:1.50544 Ang CB(43) at 18.5461 19.6559 16.3792 in (null):N-9999 (6) and OD2(118) at 17.3963 18.8669 16.9463 in (null):D-9999 (16) other bump:2.84107 Ang C(48) at 17.334 21.699 17.163 in (null):N-9999 (6) and OD2(118) at 17.3963 18.8669 16.9463 in (null):D-9999 (16) other bump:2.36949 Ang CG(44) at 19.4551 19.8469 17.5907 in (null):N-9999 (6) and OD2(118) at 17.3963 18.8669 16.9463 in (null):D-9999 (16) other bump:2.65479 Ang CA(42) at 17.174 20.264 16.678 in (null):N-9999 (6) and CG(116) at 17.5914 17.644 16.7747 in (null):D-9999 (16) other bump:2.26178 Ang CB(43) at 18.5461 19.6559 16.3792 in (null):N-9999 (6) and CG(116) at 17.5914 17.644 16.7747 in (null):D-9999 (16) other bump:2.99868 Ang CG(44) at 19.4551 19.8469 17.5907 in (null):N-9999 (6) and CG(116) at 17.5914 17.644 16.7747 in (null):D-9999 (16) other bump:2.61992 Ang CB(43) at 18.5461 19.6559 16.3792 in (null):N-9999 (6) and CB(115) at 18.259 17.2097 15.4861 in (null):D-9999 (16) other bump:3.27647 Ang CE1(76) at 29.3618 19.3339 17.0427 in (null):Y-9999 (10) and SD(104) at 27.9406 16.4666 17.7454 in (null):M-9999 (14) other bump:2.7058 Ang OH(79) at 30.3085 17.1746 16.644 in (null):Y-9999 (10) and SD(104) at 27.9406 16.4666 17.7454 in (null):M-9999 (14) other bump:2.94077 Ang CD2(75) at 28.7179 18.5844 19.6319 in (null):Y-9999 (10) and SD(104) at 27.9406 16.4666 17.7454 in (null):M-9999 (14) other bump:2.15978 Ang CE2(77) at 29.3725 17.7032 18.7871 in (null):Y-9999 (10) and SD(104) at 27.9406 16.4666 17.7454 in (null):M-9999 (14) other bump:2.38273 Ang CZ(78) at 29.6846 18.0707 17.4951 in (null):Y-9999 (10) and SD(104) at 27.9406 16.4666 17.7454 in (null):M-9999 (14) other bump:2.38514 Ang OD1(46) at 20.3377 20.6819 17.5968 in (null):N-9999 (6) and CG(95) at 22.3274 21.9163 17.1424 in (null):M-9999 (13) other bump:2.63015 Ang OD1(46) at 20.3377 20.6819 17.5968 in (null):N-9999 (6) and CB(94) at 22.7602 20.5601 16.5796 in (null):M-9999 (13) other bump:2.53535 Ang CG(44) at 19.4551 19.8469 17.5907 in (null):N-9999 (6) and CA(93) at 21.898 19.406 17.075 in (null):M-9999 (13) other bump:2.082 Ang OD1(46) at 20.3377 20.6819 17.5968 in (null):N-9999 (6) and CA(93) at 21.898 19.406 17.075 in (null):M-9999 (13) other bump:2.69266 Ang CG(44) at 19.4551 19.8469 17.5907 in (null):N-9999 (6) and N(92) at 21.916 19.283 18.527 in (null):M-9999 (13) other bump:2.17775 Ang ND2(45) at 19.1201 19.141 18.6772 in (null):N-9999 (6) and C(91) at 21.117 18.402 19.134 in (null):A-9999 (12) other bump:2.68909 Ang CG(44) at 19.4551 19.8469 17.5907 in (null):N-9999 (6) and C(91) at 21.117 18.402 19.134 in (null):A-9999 (12) other bump:2.85802 Ang OD1(46) at 20.3377 20.6819 17.5968 in (null):N-9999 (6) and C(91) at 21.117 18.402 19.134 in (null):A-9999 (12) other bump:1.93926 Ang ND2(45) at 19.1201 19.141 18.6772 in (null):N-9999 (6) and O(90) at 20.355 17.656 18.503 in (null):A-9999 (12) other bump:2.53812 Ang CG(44) at 19.4551 19.8469 17.5907 in (null):N-9999 (6) and O(90) at 20.355 17.656 18.503 in (null):A-9999 (12) other bump:2.54332 Ang NE2(38) at 14.0513 23.8958 16.3515 in (null):H-9999 (5) and NE2(55) at 13.32 25.0558 18.4935 in (null):Q-9999 (7) other bump:2.42204 Ang CE1(37) at 14.8048 24.0118 15.2811 in (null):H-9999 (5) and OE1(54) at 14.0413 25.9367 16.5374 in (null):Q-9999 (7) other bump:2.04934 Ang NE2(38) at 14.0513 23.8958 16.3515 in (null):H-9999 (5) and OE1(54) at 14.0413 25.9367 16.5374 in (null):Q-9999 (7) other bump:2.55029 Ang NE2(38) at 14.0513 23.8958 16.3515 in (null):H-9999 (5) and CG(52) at 15.6763 25.0007 17.9771 in (null):Q-9999 (7) T0159 112 :Y 1kq3A 114 :T Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 3 residues T0159 114 :VSNELKPGKDVVWLQVPFSAL 1kq3A 115 :IASTDAPCSALSVIYTPNGEF Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 23 residues neighbor-bump: 2.92786 Ang CG1(125) at 29.3519 5.43152 27.154 in (null):V-9999 (16) and CD(133) at 26.528 5.214 26.412 in (null):P-9999 (17) other bump:3.16177 Ang CG1(80) at 30.8065 15.1227 12.1133 in (null):V-9999 (11) and NE1(99) at 32.3801 15.9586 14.7252 in (null):W-9999 (13) other bump:2.51182 Ang CG1(5) at 25.673 27.244 22.124 in (null):V-9999 (1) and OD1(20) at 27.9444 28.0266 22.8572 in (null):N-9999 (3) other bump:2.47725 Ang CB(4) at 25.658 28.766 22.255 in (null):V-9999 (1) and OD1(20) at 27.9444 28.0266 22.8572 in (null):N-9999 (3) T0159 141 :DTKLPNGANY 1kq3A 136 :KRYLFLPRNP Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 12 residues Number of specific fragments= 10 total=52 Number of alignments=18 # Reading fragments from alignment file # T0159 read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1b16A/T0159-1b16A-2track-protein-STR-global-adpstyle1.pw.a2m.gz # 1b16A read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1b16A/T0159-1b16A-2track-protein-STR-global-adpstyle1.pw.a2m.gz # found chain 1b16A in template set T0159 48 :GDGKADLTGCNPGWGCEGAINHQLAAYELTNTVTHNQGNYAAMMADT 1b16A 2 :DLTNKNVIFVAALGGIGLDTSRELVKRNLKNFVILDRVENPTALAEL Fragment has 23 clashes (null) has 23 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 49 residues other bump:2.53302 Ang CE1(148) at 12.6031 -12.9292 -13.0238 in (null):H-9999 (22) and OD1(330) at 12.5617 -14.57 -14.9531 in (null):D-9999 (46) other bump:2.80027 Ang CD1(287) at 10.4524 -20.0145 -8.36363 in (null):Y-9999 (40) and N(305) at 12.085 -19.654 -10.61 in (null):M-9999 (43) other bump:2.58076 Ang CE1(289) at 9.41251 -20.0567 -9.29941 in (null):Y-9999 (40) and CB(302) at 9.759 -21.524 -11.394 in (null):A-9999 (42) other bump:2.1619 Ang CG2(51) at 24.4655 -12.2441 -0.0954647 in (null):T-9999 (8) and NE2(251) at 24.2248 -14.3713 0.206193 in (null):H-9999 (35) other bump:2.50953 Ang CG2(51) at 24.4655 -12.2441 -0.0954647 in (null):T-9999 (8) and CD2(248) at 22.8704 -14.1563 0.216652 in (null):H-9999 (35) other bump:2.23524 Ang CG(76) at 17.4341 -13.8696 -3.36836 in (null):P-9999 (12) and CG2(240) at 18.2674 -15.8011 -4.12421 in (null):T-9999 (34) other bump:2.57666 Ang CD1(204) at 24.141 -9.164 -10.12 in (null):L-9999 (29) and OG1(227) at 24.0878 -11.7323 -9.92016 in (null):T-9999 (32) other bump:2.76257 Ang CA(19) at 31.361 -7.8 -13.401 in (null):K-9999 (4) and CG2(211) at 31.8376 -10.3483 -12.4467 in (null):T-9999 (30) other bump:2.70214 Ang C(26) at 31.413 -7.74 -11.883 in (null):K-9999 (4) and CG2(211) at 31.8376 -10.3483 -12.4467 in (null):T-9999 (30) other bump:2.51946 Ang O(25) at 32.402 -8.174 -11.306 in (null):K-9999 (4) and CG2(211) at 31.8376 -10.3483 -12.4467 in (null):T-9999 (30) other bump:2.3837 Ang CD1(44) at 26.1099 -7.64971 -8.27055 in (null):L-9999 (7) and CD2(205) at 25.812 -7.362 -10.618 in (null):L-9999 (29) other bump:2.84616 Ang O(159) at 19.249 -5.965 -14.221 in (null):Q-9999 (23) and CE2(186) at 19.8323 -3.17965 -14.1746 in (null):Y-9999 (27) other bump:2.55602 Ang O(159) at 19.249 -5.965 -14.221 in (null):Q-9999 (23) and CD2(184) at 20.9188 -4.03608 -14.0648 in (null):Y-9999 (27) other bump:2.44318 Ang O(119) at 13.31 -10.383 -10.264 in (null):G-9999 (18) and CD2(146) at 12.1936 -10.872 -12.3814 in (null):H-9999 (22) other bump:3.14142 Ang C(120) at 12.52 -10.243 -9.321 in (null):G-9999 (18) and CD2(146) at 12.1936 -10.872 -12.3814 in (null):H-9999 (22) other bump:2.92762 Ang C(72) at 15.086 -11.892 -1.509 in (null):N-9999 (11) and CD(112) at 14.6265 -9.0991 -2.25703 in (null):E-9999 (17) other bump:2.05159 Ang O(71) at 14.232 -11.07 -1.846 in (null):N-9999 (11) and CD(112) at 14.6265 -9.0991 -2.25703 in (null):E-9999 (17) other bump:2.70422 Ang C(72) at 15.086 -11.892 -1.509 in (null):N-9999 (11) and CG(111) at 13.4648 -10.0036 -2.56648 in (null):E-9999 (17) other bump:1.49833 Ang O(71) at 14.232 -11.07 -1.846 in (null):N-9999 (11) and CG(111) at 13.4648 -10.0036 -2.56648 in (null):E-9999 (17) other bump:2.74357 Ang C(79) at 14.622 -12.706 -4.567 in (null):P-9999 (12) and CB(110) at 13.2922 -10.3667 -4.03146 in (null):E-9999 (17) other bump:2.48071 Ang O(71) at 14.232 -11.07 -1.846 in (null):N-9999 (11) and CB(110) at 13.2922 -10.3667 -4.03146 in (null):E-9999 (17) other bump:3.09025 Ang CA(74) at 15.823 -12.129 -3.833 in (null):P-9999 (12) and CB(110) at 13.2922 -10.3667 -4.03146 in (null):E-9999 (17) neighbor-bump: 2.47038 Ang N(65) at 16.651 -12.535 0.28 in (null):N-9999 (11) and CD(77) at 17.0305 -13.2992 -2.03835 in (null):P-9999 (12) T0159 96 :SRYKEGKPVFYYTWTPYWVSNELK 1b16A 49 :KAINPKVNITFHTYDVTVPVAESK Fragment has 9 clashes (null) has 9 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 26 residues other bump:2.68414 Ang NE1(126) at 21.6639 -15.925 6.78213 in (null):W-9999 (14) and CD2(207) at 23.7539 -14.3087 7.25564 in (null):L-9999 (23) other bump:3.04251 Ang CZ3(168) at 22.1538 -20.925 8.51626 in (null):W-9999 (18) and OE1(198) at 22.013 -21.786 11.431 in (null):E-9999 (22) other bump:2.6961 Ang CE3(165) at 21.7077 -19.9956 9.43847 in (null):W-9999 (18) and OE1(198) at 22.013 -21.786 11.431 in (null):E-9999 (22) other bump:3.15438 Ang CE3(165) at 21.7077 -19.9956 9.43847 in (null):W-9999 (18) and CB(195) at 23.749 -19.615 11.813 in (null):E-9999 (22) other bump:2.02468 Ang CG2(176) at 23.1425 -18.5468 15.894 in (null):V-9999 (19) and OD1(190) at 25.1259 -18.28 16.201 in (null):N-9999 (21) other bump:3.11272 Ang CG2(176) at 23.1425 -18.5468 15.894 in (null):V-9999 (19) and CG(188) at 26.2489 -18.7419 15.9286 in (null):N-9999 (21) other bump:2.41464 Ang OG1(136) at 16.7242 -19.6516 8.7727 in (null):T-9999 (15) and NE1(166) at 18.332 -20.9734 9.99671 in (null):W-9999 (18) other bump:2.65801 Ang OG1(136) at 16.7242 -19.6516 8.7727 in (null):T-9999 (15) and CD1(162) at 18.3686 -19.898 10.8464 in (null):W-9999 (18) other bump:3.09498 Ang CZ3(128) at 18.684 -13.4962 5.34071 in (null):W-9999 (14) and CG(142) at 15.9434 -13.7403 6.75796 in (null):P-9999 (16) T0159 128 :QVPFSALPGDKNADTKLPNGANYG 1b16A 73 :KLLKKIFDQLKTVDILINGAGILD Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 25 residues other bump:2.68399 Ang CG(69) at 32.8929 -13.798 -3.26754 in (null):D-9999 (10) and O(89) at 33.181 -11.197 -3.864 in (null):N-9999 (12) other bump:1.39903 Ang O(34) at 33.74 -17.501 3.498 in (null):F-9999 (4) and CD(59) at 34.251 -17.3279 2.20718 in (null):P-9999 (8) other bump:2.54907 Ang C(35) at 32.763 -17.775 4.228 in (null):F-9999 (4) and CD(59) at 34.251 -17.3279 2.20718 in (null):P-9999 (8) other bump:3.21272 Ang CA(37) at 32.121 -19.648 2.841 in (null):S-9999 (5) and CD(59) at 34.251 -17.3279 2.20718 in (null):P-9999 (8) other bump:2.94971 Ang C(41) at 31.876 -18.94 1.528 in (null):S-9999 (5) and CD(59) at 34.251 -17.3279 2.20718 in (null):P-9999 (8) other bump:1.9024 Ang O(34) at 33.74 -17.501 3.498 in (null):F-9999 (4) and CG(58) at 35.3288 -18.2421 2.75934 in (null):P-9999 (8) other bump:2.99308 Ang C(35) at 32.763 -17.775 4.228 in (null):F-9999 (4) and CG(58) at 35.3288 -18.2421 2.75934 in (null):P-9999 (8) Number of specific fragments= 3 total=55 Number of alignments=19 # Reading fragments from alignment file # T0159 read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1b16A/T0159-1b16A-2track-protein-STR-global-adpstyle5.pw.a2m.gz # 1b16A read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1b16A/T0159-1b16A-2track-protein-STR-global-adpstyle5.pw.a2m.gz # found chain 1b16A in template set T0159 1 :K 1b16A 1 :M Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 2 residues T0159 48 :GDGKADLTGCNPGWGCEGAINHQLAAYELTNTVTHNQGNYAAMMADTI 1b16A 2 :DLTNKNVIFVAALGGIGLDTSRELVKRNLKNFVILDRVENPTALAELK Fragment has 23 clashes (null) has 23 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 50 residues other bump:2.53302 Ang CE1(148) at 12.6031 -12.9292 -13.0238 in (null):H-9999 (22) and OD1(330) at 12.5617 -14.57 -14.9531 in (null):D-9999 (46) other bump:2.80027 Ang CD1(287) at 10.4524 -20.0145 -8.36363 in (null):Y-9999 (40) and N(305) at 12.085 -19.654 -10.61 in (null):M-9999 (43) other bump:2.58076 Ang CE1(289) at 9.41251 -20.0567 -9.29941 in (null):Y-9999 (40) and CB(302) at 9.759 -21.524 -11.394 in (null):A-9999 (42) other bump:2.1619 Ang CG2(51) at 24.4655 -12.2441 -0.0954647 in (null):T-9999 (8) and NE2(251) at 24.2248 -14.3713 0.206193 in (null):H-9999 (35) other bump:2.50953 Ang CG2(51) at 24.4655 -12.2441 -0.0954647 in (null):T-9999 (8) and CD2(248) at 22.8704 -14.1563 0.216652 in (null):H-9999 (35) other bump:2.23524 Ang CG(76) at 17.4341 -13.8696 -3.36836 in (null):P-9999 (12) and CG2(240) at 18.2674 -15.8011 -4.12421 in (null):T-9999 (34) other bump:2.57666 Ang CD1(204) at 24.141 -9.164 -10.12 in (null):L-9999 (29) and OG1(227) at 24.0878 -11.7323 -9.92016 in (null):T-9999 (32) other bump:2.76257 Ang CA(19) at 31.361 -7.8 -13.401 in (null):K-9999 (4) and CG2(211) at 31.8376 -10.3483 -12.4467 in (null):T-9999 (30) other bump:2.70214 Ang C(26) at 31.413 -7.74 -11.883 in (null):K-9999 (4) and CG2(211) at 31.8376 -10.3483 -12.4467 in (null):T-9999 (30) other bump:2.51946 Ang O(25) at 32.402 -8.174 -11.306 in (null):K-9999 (4) and CG2(211) at 31.8376 -10.3483 -12.4467 in (null):T-9999 (30) other bump:2.3837 Ang CD1(44) at 26.1099 -7.64971 -8.27055 in (null):L-9999 (7) and CD2(205) at 25.812 -7.362 -10.618 in (null):L-9999 (29) other bump:2.84616 Ang O(159) at 19.249 -5.965 -14.221 in (null):Q-9999 (23) and CE2(186) at 19.8323 -3.17965 -14.1746 in (null):Y-9999 (27) other bump:2.55602 Ang O(159) at 19.249 -5.965 -14.221 in (null):Q-9999 (23) and CD2(184) at 20.9188 -4.03608 -14.0648 in (null):Y-9999 (27) other bump:2.44318 Ang O(119) at 13.31 -10.383 -10.264 in (null):G-9999 (18) and CD2(146) at 12.1936 -10.872 -12.3814 in (null):H-9999 (22) other bump:3.14142 Ang C(120) at 12.52 -10.243 -9.321 in (null):G-9999 (18) and CD2(146) at 12.1936 -10.872 -12.3814 in (null):H-9999 (22) other bump:2.92762 Ang C(72) at 15.086 -11.892 -1.509 in (null):N-9999 (11) and CD(112) at 14.6265 -9.0991 -2.25703 in (null):E-9999 (17) other bump:2.05159 Ang O(71) at 14.232 -11.07 -1.846 in (null):N-9999 (11) and CD(112) at 14.6265 -9.0991 -2.25703 in (null):E-9999 (17) other bump:2.70422 Ang C(72) at 15.086 -11.892 -1.509 in (null):N-9999 (11) and CG(111) at 13.4648 -10.0036 -2.56648 in (null):E-9999 (17) other bump:1.49833 Ang O(71) at 14.232 -11.07 -1.846 in (null):N-9999 (11) and CG(111) at 13.4648 -10.0036 -2.56648 in (null):E-9999 (17) other bump:2.74357 Ang C(79) at 14.622 -12.706 -4.567 in (null):P-9999 (12) and CB(110) at 13.2922 -10.3667 -4.03146 in (null):E-9999 (17) other bump:2.48071 Ang O(71) at 14.232 -11.07 -1.846 in (null):N-9999 (11) and CB(110) at 13.2922 -10.3667 -4.03146 in (null):E-9999 (17) other bump:3.09025 Ang CA(74) at 15.823 -12.129 -3.833 in (null):P-9999 (12) and CB(110) at 13.2922 -10.3667 -4.03146 in (null):E-9999 (17) neighbor-bump: 2.47038 Ang N(65) at 16.651 -12.535 0.28 in (null):N-9999 (11) and CD(77) at 17.0305 -13.2992 -2.03835 in (null):P-9999 (12) T0159 97 :RYKEGKPVFYYTWTPYWVSNELK 1b16A 50 :AINPKVNITFHTYDVTVPVAESK Fragment has 9 clashes (null) has 9 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 25 residues other bump:2.68414 Ang NE1(120) at 21.6639 -15.925 6.78213 in (null):W-9999 (13) and CD2(201) at 23.7539 -14.3087 7.25564 in (null):L-9999 (22) other bump:3.04251 Ang CZ3(162) at 22.1538 -20.925 8.51626 in (null):W-9999 (17) and OE1(192) at 22.013 -21.786 11.431 in (null):E-9999 (21) other bump:2.6961 Ang CE3(159) at 21.7077 -19.9956 9.43847 in (null):W-9999 (17) and OE1(192) at 22.013 -21.786 11.431 in (null):E-9999 (21) other bump:3.15438 Ang CE3(159) at 21.7077 -19.9956 9.43847 in (null):W-9999 (17) and CB(189) at 23.749 -19.615 11.813 in (null):E-9999 (21) other bump:2.02468 Ang CG2(170) at 23.1425 -18.5468 15.894 in (null):V-9999 (18) and OD1(184) at 25.1259 -18.28 16.201 in (null):N-9999 (20) other bump:3.11272 Ang CG2(170) at 23.1425 -18.5468 15.894 in (null):V-9999 (18) and CG(182) at 26.2489 -18.7419 15.9286 in (null):N-9999 (20) other bump:2.41464 Ang OG1(130) at 16.7242 -19.6516 8.7727 in (null):T-9999 (14) and NE1(160) at 18.332 -20.9734 9.99671 in (null):W-9999 (17) other bump:2.65801 Ang OG1(130) at 16.7242 -19.6516 8.7727 in (null):T-9999 (14) and CD1(156) at 18.3686 -19.898 10.8464 in (null):W-9999 (17) other bump:3.09498 Ang CZ3(122) at 18.684 -13.4962 5.34071 in (null):W-9999 (13) and CG(136) at 15.9434 -13.7403 6.75796 in (null):P-9999 (15) T0159 125 :VWL 1b16A 73 :KLL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 5 residues T0159 131 :FSALPGDKNADTKL 1b16A 76 :KKIFDQLKTVDILI Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 16 residues other bump:2.68399 Ang CG(46) at 32.8929 -13.798 -3.26754 in (null):D-9999 (7) and O(66) at 33.181 -11.197 -3.864 in (null):N-9999 (9) other bump:2.94971 Ang C(18) at 31.876 -18.94 1.528 in (null):S-9999 (2) and CD(36) at 34.251 -17.3279 2.20718 in (null):P-9999 (5) other bump:1.39903 Ang O(11) at 33.74 -17.501 3.498 in (null):F-9999 (1) and CD(36) at 34.251 -17.3279 2.20718 in (null):P-9999 (5) other bump:2.54907 Ang C(12) at 32.763 -17.775 4.228 in (null):F-9999 (1) and CD(36) at 34.251 -17.3279 2.20718 in (null):P-9999 (5) other bump:3.21272 Ang CA(14) at 32.121 -19.648 2.841 in (null):S-9999 (2) and CD(36) at 34.251 -17.3279 2.20718 in (null):P-9999 (5) other bump:1.9024 Ang O(11) at 33.74 -17.501 3.498 in (null):F-9999 (1) and CG(35) at 35.3288 -18.2421 2.75934 in (null):P-9999 (5) other bump:2.99308 Ang C(12) at 32.763 -17.775 4.228 in (null):F-9999 (1) and CG(35) at 35.3288 -18.2421 2.75934 in (null):P-9999 (5) T0159 146 :NGANYG 1b16A 90 :NGAGIL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 7 residues Number of specific fragments= 6 total=61 Number of alignments=20 # Reading fragments from alignment file # T0159 read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1pot/T0159-1pot-2track-protein-STR-global-adpstyle1.pw.a2m.gz # 1pot read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1pot/T0159-1pot-2track-protein-STR-global-adpstyle1.pw.a2m.gz # found chain 1pot in training set T0159 3 :FYREGVFVNGAAQGYLIDKKTA 1pot 65 :MYAKLKTYKDGAYDLVVPSTYY Fragment has 17 clashes (null) has 17 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 24 residues other bump:2.98489 Ang CE2(116) at 53.7426 39.5259 4.53391 in (null):Y-9999 (15) and CG2(133) at 55.2471 41.6819 5.94744 in (null):I-9999 (17) other bump:3.08777 Ang CZ(117) at 53.0699 39.5017 5.7451 in (null):Y-9999 (15) and CG2(133) at 55.2471 41.6819 5.94744 in (null):I-9999 (17) neighbor-bump: 2.26745 Ang O(127) at 53.804 43.424 5.793 in (null):L-9999 (16) and CG2(133) at 55.2471 41.6819 5.94744 in (null):I-9999 (17) neighbor-bump: 2.60739 Ang C(128) at 54.583 44.053 5.09 in (null):L-9999 (16) and CG2(133) at 55.2471 41.6819 5.94744 in (null):I-9999 (17) other bump:2.29386 Ang CZ(10) at 55.7753 47.4514 3.60453 in (null):F-9999 (1) and CD2(126) at 53.7223 48.3642 3.14208 in (null):L-9999 (16) other bump:2.56355 Ang CZ(10) at 55.7753 47.4514 3.60453 in (null):F-9999 (1) and CB(123) at 53.677 46.0958 4.18015 in (null):L-9999 (16) self-bump: 1.25499 Ang CA(87) at 56.056 47.981 -4.365 in (null):A-9999 (11) and CB(88) at 56.6788 48.1944 -3.29657 in (null):A-9999 (11) other bump:2.58168 Ang CG1(70) at 55.3526 52.1435 -7.12119 in (null):V-9999 (8) and N(82) at 54.466 49.779 -7.658 in (null):G-9999 (10) neighbor-bump: 2.52615 Ang CG1(70) at 55.3526 52.1435 -7.12119 in (null):V-9999 (8) and N(74) at 52.912 51.831 -6.549 in (null):N-9999 (9) other bump:2.82755 Ang CD(40) at 57.6182 52.4681 -4.31122 in (null):E-9999 (4) and CG2(71) at 56.4041 54.1825 -6.20379 in (null):V-9999 (8) other bump:2.1857 Ang OE2(42) at 56.7485 52.2788 -5.18655 in (null):E-9999 (4) and CG2(71) at 56.4041 54.1825 -6.20379 in (null):V-9999 (8) other bump:2.3895 Ang OE2(42) at 56.7485 52.2788 -5.18655 in (null):E-9999 (4) and CG1(70) at 55.3526 52.1435 -7.12119 in (null):V-9999 (8) other bump:2.85258 Ang CD(40) at 57.6182 52.4681 -4.31122 in (null):E-9999 (4) and CB(69) at 55.357 53.1064 -5.92882 in (null):V-9999 (8) other bump:1.78105 Ang OE2(42) at 56.7485 52.2788 -5.18655 in (null):E-9999 (4) and CB(69) at 55.357 53.1064 -5.92882 in (null):V-9999 (8) neighbor-bump: 2.43431 Ang O(54) at 53.969 58.598 -1.272 in (null):V-9999 (6) and CD1(60) at 56.3629 58.2396 -1.52987 in (null):F-9999 (7) neighbor-bump: 2.64547 Ang C(55) at 53.887 57.358 -1.228 in (null):V-9999 (6) and CD1(60) at 56.3629 58.2396 -1.52987 in (null):F-9999 (7) other bump:2.31417 Ang O(34) at 57.902 56.555 -1.144 in (null):R-9999 (3) and CD1(60) at 56.3629 58.2396 -1.52987 in (null):F-9999 (7) T0159 25 :DQYKITNIAQLKDPKIAKLFDTNGDGKADLTGCNPGWGC 1pot 100 :DKSKLTNFSNLDPDMLNKPFDPNNDYSIPYIWGATAIGV Fragment has 17 clashes (null) has 17 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 41 residues other bump:2.45568 Ang NE2(16) at 45.884 40.9001 16.0389 in (null):Q-9999 (2) and C(193) at 47.029 42.933 16.805 in (null):G-9999 (24) other bump:2.62689 Ang CD(14) at 45.1906 39.7738 16.1545 in (null):Q-9999 (2) and O(192) at 46.669 41.945 16.122 in (null):G-9999 (24) other bump:1.30952 Ang NE2(16) at 45.884 40.9001 16.0389 in (null):Q-9999 (2) and O(192) at 46.669 41.945 16.122 in (null):G-9999 (24) other bump:2.67664 Ang CA(103) at 53.209 34.855 24.018 in (null):D-9999 (13) and CD1(131) at 51.6954 35.7205 21.9872 in (null):I-9999 (16) other bump:2.724 Ang C(101) at 54.427 33.873 22.162 in (null):K-9999 (12) and CD(114) at 55.5107 34.4278 24.5988 in (null):P-9999 (14) neighbor-bump: 2.23364 Ang N(102) at 53.817 33.715 23.329 in (null):D-9999 (13) and CD(114) at 55.5107 34.4278 24.5988 in (null):P-9999 (14) neighbor-bump: 2.41198 Ang CA(103) at 53.209 34.855 24.018 in (null):D-9999 (13) and CD(114) at 55.5107 34.4278 24.5988 in (null):P-9999 (14) neighbor-bump: 1.99113 Ang C(109) at 54.204 35.92 24.424 in (null):D-9999 (13) and CD(114) at 55.5107 34.4278 24.5988 in (null):P-9999 (14) other bump:2.89709 Ang CG(96) at 57.1296 32.7111 22.918 in (null):K-9999 (12) and CD(114) at 55.5107 34.4278 24.5988 in (null):P-9999 (14) self-bump: 1.29461 Ang N(110) at 55.499 35.686 24.294 in (null):P-9999 (14) and CD(114) at 55.5107 34.4278 24.5988 in (null):P-9999 (14) other bump:3.06 Ang CG(96) at 57.1296 32.7111 22.918 in (null):K-9999 (12) and CG(113) at 56.7594 34.375 25.4592 in (null):P-9999 (14) self-bump: 2.15983 Ang N(110) at 55.499 35.686 24.294 in (null):P-9999 (14) and CG(113) at 56.7594 34.375 25.4592 in (null):P-9999 (14) other bump:2.27505 Ang O(46) at 44.422 33.241 13.703 in (null):I-9999 (5) and CD1(68) at 44.8917 35.3798 14.3203 in (null):I-9999 (8) other bump:2.6311 Ang O(17) at 42.266 35.485 14.188 in (null):Q-9999 (2) and CD1(68) at 44.8917 35.3798 14.3203 in (null):I-9999 (8) other bump:2.75404 Ang CB(42) at 44.9989 35.0966 11.5829 in (null):I-9999 (5) and CD1(68) at 44.8917 35.3798 14.3203 in (null):I-9999 (8) other bump:3.05257 Ang CB(42) at 44.9989 35.0966 11.5829 in (null):I-9999 (5) and CG1(66) at 46.1926 34.5869 14.3458 in (null):I-9999 (8) other bump:2.95327 Ang CG2(44) at 46.3971 34.5101 11.4006 in (null):I-9999 (5) and CG1(66) at 46.1926 34.5869 14.3458 in (null):I-9999 (8) T0159 64 :EGAINHQLAAYELT 1pot 170 :REVFQMALRKLGYS Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 16 residues other bump:2.58283 Ang O(53) at 78.119 54.582 20.239 in (null):Q-9999 (7) and CD1(77) at 79.4591 56.6543 21.0011 in (null):Y-9999 (11) T0159 78 :NTVTHNQGNYAA 1pot 204 :PNVAAFNSDNPA Fragment has 9 clashes (null) has 9 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:2.63213 Ang OE1(54) at 73.8913 42.8014 1.4177 in (null):Q-9999 (7) and C(81) at 73.818 40.346 2.363 in (null):Y-9999 (10) neighbor-bump: 2.27775 Ang O(68) at 69.726 40.837 1.358 in (null):N-9999 (9) and CD1(74) at 70.0382 39.2246 -0.220186 in (null):Y-9999 (10) neighbor-bump: 2.46122 Ang O(68) at 69.726 40.837 1.358 in (null):N-9999 (9) and CG(73) at 70.6399 38.6066 0.860476 in (null):Y-9999 (10) other bump:2.49614 Ang OE1(54) at 73.8913 42.8014 1.4177 in (null):Q-9999 (7) and N(70) at 71.886 41.315 1.417 in (null):Y-9999 (10) neighbor-bump: 2.46588 Ang CB(64) at 70.8391 42.4775 -0.489034 in (null):N-9999 (9) and N(70) at 71.886 41.315 1.417 in (null):Y-9999 (10) self-bump: 1.88218 Ang CB(64) at 70.8391 42.4775 -0.489034 in (null):N-9999 (9) and C(69) at 70.638 41.639 1.184 in (null):N-9999 (9) self-bump: 1.34405 Ang CA(63) at 70.481 43.072 0.662 in (null):N-9999 (9) and CB(64) at 70.8391 42.4775 -0.489034 in (null):N-9999 (9) other bump:2.77575 Ang NE2(55) at 72.9409 44.2298 -0.0238314 in (null):Q-9999 (7) and CB(64) at 70.8391 42.4775 -0.489034 in (null):N-9999 (9) other bump:2.80396 Ang NE2(55) at 72.9409 44.2298 -0.0238314 in (null):Q-9999 (7) and CA(63) at 70.481 43.072 0.662 in (null):N-9999 (9) T0159 96 :SRYKEGKPVFYYTWTPYWVSNELK 1pot 216 :NPYMEGEVNLGMIWNGSAFVARQA Fragment has 89 clashes (null) has 89 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 26 residues other bump:2.21955 Ang O(200) at 78.375 27.001 5.247 in (null):E-9999 (22) and N(219) at 79.616 26.781 3.42 in (null):G-9999 (25) other bump:2.18427 Ang CE(36) at 77.8539 32.2591 2.25346 in (null):K-9999 (4) and OD1(190) at 76.098 33.5367 2.48981 in (null):N-9999 (21) other bump:1.85266 Ang NZ(37) at 77.4623 32.8423 3.53335 in (null):K-9999 (4) and OD1(190) at 76.098 33.5367 2.48981 in (null):N-9999 (21) other bump:2.30766 Ang NZ(37) at 77.4623 32.8423 3.53335 in (null):K-9999 (4) and ND2(189) at 76.9017 35.0483 3.91364 in (null):N-9999 (21) other bump:2.91472 Ang C(1) at 77.753 37.676 2.983 in (null):G-9999 (0) and ND2(189) at 76.9017 35.0483 3.91364 in (null):N-9999 (21) other bump:2.3073 Ang CE(36) at 77.8539 32.2591 2.25346 in (null):K-9999 (4) and CG(188) at 76.6937 33.7836 3.53941 in (null):N-9999 (21) other bump:1.21522 Ang NZ(37) at 77.4623 32.8423 3.53335 in (null):K-9999 (4) and CG(188) at 76.6937 33.7836 3.53941 in (null):N-9999 (21) other bump:2.88641 Ang CD(35) at 78.4639 33.2887 1.31391 in (null):K-9999 (4) and CG(188) at 76.6937 33.7836 3.53941 in (null):N-9999 (21) other bump:2.20474 Ang CE(36) at 77.8539 32.2591 2.25346 in (null):K-9999 (4) and CB(187) at 77.3273 32.6758 4.35347 in (null):N-9999 (21) other bump:0.847673 Ang NZ(37) at 77.4623 32.8423 3.53335 in (null):K-9999 (4) and CB(187) at 77.3273 32.6758 4.35347 in (null):N-9999 (21) other bump:2.56821 Ang CE(36) at 77.8539 32.2591 2.25346 in (null):K-9999 (4) and CA(186) at 76.582 31.418 4.32 in (null):N-9999 (21) other bump:1.84995 Ang NZ(37) at 77.4623 32.8423 3.53335 in (null):K-9999 (4) and CA(186) at 76.582 31.418 4.32 in (null):N-9999 (21) other bump:2.75431 Ang CA(112) at 76.018 40.768 10.254 in (null):T-9999 (13) and CH2(169) at 76.8461 39.3381 12.4576 in (null):W-9999 (18) other bump:2.4772 Ang O(116) at 74.602 40.353 12.192 in (null):T-9999 (13) and CH2(169) at 76.8461 39.3381 12.4576 in (null):W-9999 (18) other bump:2.82406 Ang C(117) at 74.698 40.387 10.954 in (null):T-9999 (13) and CH2(169) at 76.8461 39.3381 12.4576 in (null):W-9999 (18) other bump:2.25909 Ang CB(113) at 77.1339 39.6978 10.246 in (null):T-9999 (13) and CH2(169) at 76.8461 39.3381 12.4576 in (null):W-9999 (18) other bump:1.74585 Ang CG2(114) at 76.9486 38.3962 10.9912 in (null):T-9999 (13) and CH2(169) at 76.8461 39.3381 12.4576 in (null):W-9999 (18) other bump:3.02255 Ang N(111) at 76.654 41.914 10.888 in (null):T-9999 (13) and CH2(169) at 76.8461 39.3381 12.4576 in (null):W-9999 (18) other bump:2.05521 Ang CG2(114) at 76.9486 38.3962 10.9912 in (null):T-9999 (13) and CZ3(168) at 76.5218 38.0687 12.9748 in (null):W-9999 (18) other bump:1.78364 Ang CA(112) at 76.018 40.768 10.254 in (null):T-9999 (13) and CZ2(167) at 76.9956 39.5454 11.109 in (null):W-9999 (18) other bump:2.74851 Ang O(116) at 74.602 40.353 12.192 in (null):T-9999 (13) and CZ2(167) at 76.9956 39.5454 11.109 in (null):W-9999 (18) other bump:2.45177 Ang C(117) at 74.698 40.387 10.954 in (null):T-9999 (13) and CZ2(167) at 76.9956 39.5454 11.109 in (null):W-9999 (18) other bump:0.887203 Ang CB(113) at 77.1339 39.6978 10.246 in (null):T-9999 (13) and CZ2(167) at 76.9956 39.5454 11.109 in (null):W-9999 (18) other bump:2.27493 Ang OG1(115) at 77.3386 39.3281 8.8706 in (null):T-9999 (13) and CZ2(167) at 76.9956 39.5454 11.109 in (null):W-9999 (18) other bump:1.15618 Ang CG2(114) at 76.9486 38.3962 10.9912 in (null):T-9999 (13) and CZ2(167) at 76.9956 39.5454 11.109 in (null):W-9999 (18) other bump:2.40326 Ang N(111) at 76.654 41.914 10.888 in (null):T-9999 (13) and CZ2(167) at 76.9956 39.5454 11.109 in (null):W-9999 (18) other bump:2.90334 Ang CA(112) at 76.018 40.768 10.254 in (null):T-9999 (13) and NE1(166) at 76.8971 38.3579 8.89459 in (null):W-9999 (18) other bump:1.91775 Ang CB(113) at 77.1339 39.6978 10.246 in (null):T-9999 (13) and NE1(166) at 76.8971 38.3579 8.89459 in (null):W-9999 (18) other bump:1.06623 Ang OG1(115) at 77.3386 39.3281 8.8706 in (null):T-9999 (13) and NE1(166) at 76.8971 38.3579 8.89459 in (null):W-9999 (18) other bump:2.0976 Ang CG2(114) at 76.9486 38.3962 10.9912 in (null):T-9999 (13) and NE1(166) at 76.8971 38.3579 8.89459 in (null):W-9999 (18) other bump:1.9198 Ang CG2(114) at 76.9486 38.3962 10.9912 in (null):T-9999 (13) and CE3(165) at 76.3392 36.9748 12.1286 in (null):W-9999 (18) other bump:2.45369 Ang CA(112) at 76.018 40.768 10.254 in (null):T-9999 (13) and CE2(164) at 76.8117 38.4462 10.2583 in (null):W-9999 (18) other bump:2.9527 Ang C(117) at 74.698 40.387 10.954 in (null):T-9999 (13) and CE2(164) at 76.8117 38.4462 10.2583 in (null):W-9999 (18) other bump:1.29243 Ang CB(113) at 77.1339 39.6978 10.246 in (null):T-9999 (13) and CE2(164) at 76.8117 38.4462 10.2583 in (null):W-9999 (18) other bump:1.72655 Ang OG1(115) at 77.3386 39.3281 8.8706 in (null):T-9999 (13) and CE2(164) at 76.8117 38.4462 10.2583 in (null):W-9999 (18) other bump:0.747261 Ang CG2(114) at 76.9486 38.3962 10.9912 in (null):T-9999 (13) and CE2(164) at 76.8117 38.4462 10.2583 in (null):W-9999 (18) other bump:2.66822 Ang CB(113) at 77.1339 39.6978 10.246 in (null):T-9999 (13) and CD2(163) at 76.4854 37.1584 10.7463 in (null):W-9999 (18) other bump:1.34415 Ang CG2(114) at 76.9486 38.3962 10.9912 in (null):T-9999 (13) and CD2(163) at 76.4854 37.1584 10.7463 in (null):W-9999 (18) other bump:2.39807 Ang OG1(115) at 77.3386 39.3281 8.8706 in (null):T-9999 (13) and CD1(162) at 76.6351 37.0637 8.51229 in (null):W-9999 (18) other bump:2.83175 Ang CG2(114) at 76.9486 38.3962 10.9912 in (null):T-9999 (13) and CD1(162) at 76.6351 37.0637 8.51229 in (null):W-9999 (18) other bump:2.58292 Ang CG2(114) at 76.9486 38.3962 10.9912 in (null):T-9999 (13) and CG(161) at 76.3778 36.2902 9.609 in (null):W-9999 (18) other bump:3.32969 Ang CE3(125) at 70.182 41.548 6.85 in (null):W-9999 (14) and CE1(152) at 69.155 38.6187 5.64543 in (null):Y-9999 (17) neighbor-bump: 2.79874 Ang OG1(136) at 70.5732 36.0793 13.7337 in (null):T-9999 (15) and CD(143) at 69.9656 36.5027 11.0348 in (null):P-9999 (16) neighbor-bump: 2.57721 Ang N(132) at 72.085 37.632 11.97 in (null):T-9999 (15) and CD(143) at 69.9656 36.5027 11.0348 in (null):P-9999 (16) other bump:2.30979 Ang CE2(94) at 79.0687 40.6647 8.12531 in (null):Y-9999 (11) and OG1(115) at 77.3386 39.3281 8.8706 in (null):T-9999 (13) other bump:3.02914 Ang CE2(94) at 79.0687 40.6647 8.12531 in (null):Y-9999 (11) and CB(113) at 77.1339 39.6978 10.246 in (null):T-9999 (13) neighbor-bump: 2.78291 Ang CD2(92) at 79.5197 41.9372 8.46055 in (null):Y-9999 (11) and C(110) at 77.56 42.656 10.301 in (null):Y-9999 (12) neighbor-bump: 2.29261 Ang CE2(94) at 79.0687 40.6647 8.12531 in (null):Y-9999 (11) and O(109) at 78.034 42.429 9.161 in (null):Y-9999 (12) neighbor-bump: 1.71464 Ang CD2(92) at 79.5197 41.9372 8.46055 in (null):Y-9999 (11) and O(109) at 78.034 42.429 9.161 in (null):Y-9999 (12) other bump:2.06082 Ang CD1(23) at 80.147 39.453 5.702 in (null):Y-9999 (3) and OH(96) at 79.5611 38.4439 7.40063 in (null):Y-9999 (11) other bump:2.08187 Ang CE1(25) at 79.789 40.375 6.657 in (null):Y-9999 (3) and OH(96) at 79.5611 38.4439 7.40063 in (null):Y-9999 (11) other bump:2.40684 Ang CZ(27) at 80.622 40.576 7.749 in (null):Y-9999 (3) and OH(96) at 79.5611 38.4439 7.40063 in (null):Y-9999 (11) other bump:2.42636 Ang CG(22) at 81.347 38.734 5.784 in (null):Y-9999 (3) and OH(96) at 79.5611 38.4439 7.40063 in (null):Y-9999 (11) other bump:2.72199 Ang CE2(26) at 81.821 39.887 7.869 in (null):Y-9999 (3) and OH(96) at 79.5611 38.4439 7.40063 in (null):Y-9999 (11) other bump:2.03431 Ang CD1(23) at 80.147 39.453 5.702 in (null):Y-9999 (3) and CZ(95) at 79.9844 39.7087 7.71361 in (null):Y-9999 (11) other bump:1.26433 Ang CE1(25) at 79.789 40.375 6.657 in (null):Y-9999 (3) and CZ(95) at 79.9844 39.7087 7.71361 in (null):Y-9999 (11) other bump:1.07703 Ang CZ(27) at 80.622 40.576 7.749 in (null):Y-9999 (3) and CZ(95) at 79.9844 39.7087 7.71361 in (null):Y-9999 (11) other bump:2.04012 Ang OH(28) at 80.303 41.444 8.738 in (null):Y-9999 (3) and CZ(95) at 79.9844 39.7087 7.71361 in (null):Y-9999 (11) other bump:2.55543 Ang CG(22) at 81.347 38.734 5.784 in (null):Y-9999 (3) and CZ(95) at 79.9844 39.7087 7.71361 in (null):Y-9999 (11) other bump:2.45486 Ang CD2(24) at 82.17 38.953 6.89 in (null):Y-9999 (3) and CZ(95) at 79.9844 39.7087 7.71361 in (null):Y-9999 (11) other bump:1.85178 Ang CE2(26) at 81.821 39.887 7.869 in (null):Y-9999 (3) and CZ(95) at 79.9844 39.7087 7.71361 in (null):Y-9999 (11) other bump:1.66092 Ang CE1(25) at 79.789 40.375 6.657 in (null):Y-9999 (3) and CE2(94) at 79.0687 40.6647 8.12531 in (null):Y-9999 (11) other bump:1.60069 Ang CZ(27) at 80.622 40.576 7.749 in (null):Y-9999 (3) and CE2(94) at 79.0687 40.6647 8.12531 in (null):Y-9999 (11) other bump:1.5831 Ang OH(28) at 80.303 41.444 8.738 in (null):Y-9999 (3) and CE2(94) at 79.0687 40.6647 8.12531 in (null):Y-9999 (11) other bump:2.32965 Ang CD1(23) at 80.147 39.453 5.702 in (null):Y-9999 (3) and CE1(93) at 81.3309 40.016 7.62781 in (null):Y-9999 (11) other bump:1.85705 Ang CE1(25) at 79.789 40.375 6.657 in (null):Y-9999 (3) and CE1(93) at 81.3309 40.016 7.62781 in (null):Y-9999 (11) other bump:0.911439 Ang CZ(27) at 80.622 40.576 7.749 in (null):Y-9999 (3) and CE1(93) at 81.3309 40.016 7.62781 in (null):Y-9999 (11) other bump:2.0804 Ang OH(28) at 80.303 41.444 8.738 in (null):Y-9999 (3) and CE1(93) at 81.3309 40.016 7.62781 in (null):Y-9999 (11) other bump:2.24578 Ang CG(22) at 81.347 38.734 5.784 in (null):Y-9999 (3) and CE1(93) at 81.3309 40.016 7.62781 in (null):Y-9999 (11) other bump:1.54226 Ang CD2(24) at 82.17 38.953 6.89 in (null):Y-9999 (3) and CE1(93) at 81.3309 40.016 7.62781 in (null):Y-9999 (11) other bump:0.561304 Ang CE2(26) at 81.821 39.887 7.869 in (null):Y-9999 (3) and CE1(93) at 81.3309 40.016 7.62781 in (null):Y-9999 (11) other bump:2.40118 Ang CE1(25) at 79.789 40.375 6.657 in (null):Y-9999 (3) and CD2(92) at 79.5197 41.9372 8.46055 in (null):Y-9999 (11) other bump:1.89051 Ang CZ(27) at 80.622 40.576 7.749 in (null):Y-9999 (3) and CD2(92) at 79.5197 41.9372 8.46055 in (null):Y-9999 (11) other bump:0.966271 Ang OH(28) at 80.303 41.444 8.738 in (null):Y-9999 (3) and CD2(92) at 79.5197 41.9372 8.46055 in (null):Y-9999 (11) other bump:2.54618 Ang CE1(25) at 79.789 40.375 6.657 in (null):Y-9999 (3) and CD1(91) at 81.7688 41.3018 7.96257 in (null):Y-9999 (11) other bump:1.37387 Ang CZ(27) at 80.622 40.576 7.749 in (null):Y-9999 (3) and CD1(91) at 81.7688 41.3018 7.96257 in (null):Y-9999 (11) other bump:1.66434 Ang OH(28) at 80.303 41.444 8.738 in (null):Y-9999 (3) and CD1(91) at 81.7688 41.3018 7.96257 in (null):Y-9999 (11) other bump:2.6131 Ang CD2(24) at 82.17 38.953 6.89 in (null):Y-9999 (3) and CD1(91) at 81.7688 41.3018 7.96257 in (null):Y-9999 (11) other bump:1.41886 Ang CE2(26) at 81.821 39.887 7.869 in (null):Y-9999 (3) and CD1(91) at 81.7688 41.3018 7.96257 in (null):Y-9999 (11) other bump:1.84089 Ang CZ(27) at 80.622 40.576 7.749 in (null):Y-9999 (3) and CG(90) at 80.8809 42.2859 8.37995 in (null):Y-9999 (11) other bump:1.08212 Ang OH(28) at 80.303 41.444 8.738 in (null):Y-9999 (3) and CG(90) at 80.8809 42.2859 8.37995 in (null):Y-9999 (11) other bump:2.62669 Ang CE2(26) at 81.821 39.887 7.869 in (null):Y-9999 (3) and CG(90) at 80.8809 42.2859 8.37995 in (null):Y-9999 (11) other bump:2.45374 Ang OH(28) at 80.303 41.444 8.738 in (null):Y-9999 (3) and CB(89) at 81.3094 43.6818 8.75665 in (null):Y-9999 (11) neighbor-bump: 2.64744 Ang C(86) at 83.662 42.718 9.495 in (null):F-9999 (10) and CB(89) at 81.3094 43.6818 8.75665 in (null):Y-9999 (11) neighbor-bump: 2.89828 Ang CG2(73) at 88.4736 41.8589 8.31969 in (null):V-9999 (9) and CD2(81) at 87.5426 43.7501 10.3088 in (null):F-9999 (10) neighbor-bump: 2.4412 Ang N(53) at 85.68 40.233 0.492 in (null):K-9999 (7) and CD(66) at 84.2296 41.6341 1.86773 in (null):P-9999 (8) neighbor-bump: 1.92408 Ang C(61) at 85.924 42.408 1.386 in (null):K-9999 (7) and CD(66) at 84.2296 41.6341 1.86773 in (null):P-9999 (8) other bump:1.81594 Ang OE1(45) at 82.02 40.453 -4.266 in (null):E-9999 (5) and NZ(59) at 83.1467 41.3315 -5.38689 in (null):K-9999 (7) other bump:2.45595 Ang OE1(45) at 82.02 40.453 -4.266 in (null):E-9999 (5) and CE(58) at 84.3662 41.1147 -4.56481 in (null):K-9999 (7) T0159 124 :VVWLQVPFSALPGDKNADTKLPNGANYG 1pot 240 :GTPIDVVWPKEGGIFWMDSLAIPANAKN Fragment has 18 clashes (null) has 18 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 29 residues other bump:2.75918 Ang OD1(193) at 44.6076 43.6303 1.11391 in (null):N-9999 (26) and C(211) at 43.032 41.75 -0.149 in (null):G-9999 (28) neighbor-bump: 3.15224 Ang CB(93) at 75.7174 44.702 21.4427 in (null):P-9999 (12) and CA(99) at 73.757 42.689 20.014 in (null):G-9999 (13) neighbor-bump: 1.84228 Ang CB(93) at 75.7174 44.702 21.4427 in (null):P-9999 (12) and N(98) at 74.338 43.532 21.093 in (null):G-9999 (13) self-bump: 2.18089 Ang CB(93) at 75.7174 44.702 21.4427 in (null):P-9999 (12) and C(97) at 74.459 43.168 22.348 in (null):P-9999 (12) other bump:2.35264 Ang O(76) at 78.253 42.26 23.519 in (null):S-9999 (9) and CD(95) at 77.4353 44.4076 23.0149 in (null):P-9999 (12) other bump:2.22045 Ang OG(75) at 78.0752 43.9939 20.9292 in (null):S-9999 (9) and CD(95) at 77.4353 44.4076 23.0149 in (null):P-9999 (12) neighbor-bump: 2.13113 Ang N(83) at 78.938 44.986 24.411 in (null):L-9999 (11) and CD(95) at 77.4353 44.4076 23.0149 in (null):P-9999 (12) neighbor-bump: 2.39652 Ang CA(84) at 77.935 46.02 24.716 in (null):L-9999 (11) and CD(95) at 77.4353 44.4076 23.0149 in (null):P-9999 (12) neighbor-bump: 2.05495 Ang C(90) at 76.503 45.626 24.382 in (null):L-9999 (11) and CD(95) at 77.4353 44.4076 23.0149 in (null):P-9999 (12) self-bump: 1.26643 Ang N(91) at 76.301 44.603 23.543 in (null):P-9999 (12) and CD(95) at 77.4353 44.4076 23.0149 in (null):P-9999 (12) other bump:2.757 Ang C(77) at 79.327 42.405 22.904 in (null):S-9999 (9) and CD(95) at 77.4353 44.4076 23.0149 in (null):P-9999 (12) other bump:1.88324 Ang OG(75) at 78.0752 43.9939 20.9292 in (null):S-9999 (9) and CG(94) at 77.0405 45.2703 21.8494 in (null):P-9999 (12) neighbor-bump: 3.09508 Ang CA(84) at 77.935 46.02 24.716 in (null):L-9999 (11) and CG(94) at 77.0405 45.2703 21.8494 in (null):P-9999 (12) neighbor-bump: 2.61331 Ang C(90) at 76.503 45.626 24.382 in (null):L-9999 (11) and CG(94) at 77.0405 45.2703 21.8494 in (null):P-9999 (12) self-bump: 1.96476 Ang N(91) at 76.301 44.603 23.543 in (null):P-9999 (12) and CG(94) at 77.0405 45.2703 21.8494 in (null):P-9999 (12) other bump:2.51481 Ang OG(75) at 78.0752 43.9939 20.9292 in (null):S-9999 (9) and CB(93) at 75.7174 44.702 21.4427 in (null):P-9999 (12) other bump:2.54522 Ang CG1(12) at 82.3074 32.613 4.60055 in (null):V-9999 (2) and CD2(35) at 82.2323 34.368 6.44247 in (null):L-9999 (4) other bump:2.70348 Ang CG1(12) at 82.3074 32.613 4.60055 in (null):V-9999 (2) and CG(33) at 80.9597 33.5961 6.72805 in (null):L-9999 (4) Number of specific fragments= 6 total=67 Number of alignments=21 # Reading fragments from alignment file # T0159 read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1pot/T0159-1pot-2track-protein-STR-global-adpstyle5.pw.a2m.gz # 1pot read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1pot/T0159-1pot-2track-protein-STR-global-adpstyle5.pw.a2m.gz # found chain 1pot in training set T0159 8 :VFVNGAAQGYLIDKKTA 1pot 70 :KTYKDGAYDLVVPSTYY Fragment has 9 clashes (null) has 9 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 19 residues other bump:2.98489 Ang CE2(69) at 53.7426 39.5259 4.53391 in (null):Y-9999 (10) and CG2(86) at 55.2471 41.6819 5.94744 in (null):I-9999 (12) other bump:3.08777 Ang CZ(70) at 53.0699 39.5017 5.7451 in (null):Y-9999 (10) and CG2(86) at 55.2471 41.6819 5.94744 in (null):I-9999 (12) neighbor-bump: 2.26745 Ang O(80) at 53.804 43.424 5.793 in (null):L-9999 (11) and CG2(86) at 55.2471 41.6819 5.94744 in (null):I-9999 (12) neighbor-bump: 2.60739 Ang C(81) at 54.583 44.053 5.09 in (null):L-9999 (11) and CG2(86) at 55.2471 41.6819 5.94744 in (null):I-9999 (12) self-bump: 1.25499 Ang CA(40) at 56.056 47.981 -4.365 in (null):A-9999 (6) and CB(41) at 56.6788 48.1944 -3.29657 in (null):A-9999 (6) other bump:2.58168 Ang CG1(23) at 55.3526 52.1435 -7.12119 in (null):V-9999 (3) and N(35) at 54.466 49.779 -7.658 in (null):G-9999 (5) neighbor-bump: 2.52615 Ang CG1(23) at 55.3526 52.1435 -7.12119 in (null):V-9999 (3) and N(27) at 52.912 51.831 -6.549 in (null):N-9999 (4) neighbor-bump: 2.43431 Ang O(7) at 53.969 58.598 -1.272 in (null):V-9999 (1) and CD1(13) at 56.3629 58.2396 -1.52987 in (null):F-9999 (2) neighbor-bump: 2.64547 Ang C(8) at 53.887 57.358 -1.228 in (null):V-9999 (1) and CD1(13) at 56.3629 58.2396 -1.52987 in (null):F-9999 (2) T0159 25 :DQYKITNIAQLKDPKIAKLFDTNGDGKADLTGC 1pot 100 :DKSKLTNFSNLDPDMLNKPFDPNNDYSIPYIWG Fragment has 17 clashes (null) has 17 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 35 residues other bump:2.45568 Ang NE2(16) at 45.884 40.9001 16.0389 in (null):Q-9999 (2) and C(193) at 47.029 42.933 16.805 in (null):G-9999 (24) other bump:2.62689 Ang CD(14) at 45.1906 39.7738 16.1545 in (null):Q-9999 (2) and O(192) at 46.669 41.945 16.122 in (null):G-9999 (24) other bump:1.30952 Ang NE2(16) at 45.884 40.9001 16.0389 in (null):Q-9999 (2) and O(192) at 46.669 41.945 16.122 in (null):G-9999 (24) other bump:2.67664 Ang CA(103) at 53.209 34.855 24.018 in (null):D-9999 (13) and CD1(131) at 51.6954 35.7205 21.9872 in (null):I-9999 (16) neighbor-bump: 2.41198 Ang CA(103) at 53.209 34.855 24.018 in (null):D-9999 (13) and CD(114) at 55.5107 34.4278 24.5988 in (null):P-9999 (14) other bump:2.89709 Ang CG(96) at 57.1296 32.7111 22.918 in (null):K-9999 (12) and CD(114) at 55.5107 34.4278 24.5988 in (null):P-9999 (14) other bump:2.724 Ang C(101) at 54.427 33.873 22.162 in (null):K-9999 (12) and CD(114) at 55.5107 34.4278 24.5988 in (null):P-9999 (14) neighbor-bump: 2.23364 Ang N(102) at 53.817 33.715 23.329 in (null):D-9999 (13) and CD(114) at 55.5107 34.4278 24.5988 in (null):P-9999 (14) neighbor-bump: 1.99113 Ang C(109) at 54.204 35.92 24.424 in (null):D-9999 (13) and CD(114) at 55.5107 34.4278 24.5988 in (null):P-9999 (14) self-bump: 1.29461 Ang N(110) at 55.499 35.686 24.294 in (null):P-9999 (14) and CD(114) at 55.5107 34.4278 24.5988 in (null):P-9999 (14) other bump:3.06 Ang CG(96) at 57.1296 32.7111 22.918 in (null):K-9999 (12) and CG(113) at 56.7594 34.375 25.4592 in (null):P-9999 (14) self-bump: 2.15983 Ang N(110) at 55.499 35.686 24.294 in (null):P-9999 (14) and CG(113) at 56.7594 34.375 25.4592 in (null):P-9999 (14) other bump:2.27505 Ang O(46) at 44.422 33.241 13.703 in (null):I-9999 (5) and CD1(68) at 44.8917 35.3798 14.3203 in (null):I-9999 (8) other bump:2.6311 Ang O(17) at 42.266 35.485 14.188 in (null):Q-9999 (2) and CD1(68) at 44.8917 35.3798 14.3203 in (null):I-9999 (8) other bump:2.75404 Ang CB(42) at 44.9989 35.0966 11.5829 in (null):I-9999 (5) and CD1(68) at 44.8917 35.3798 14.3203 in (null):I-9999 (8) other bump:3.05257 Ang CB(42) at 44.9989 35.0966 11.5829 in (null):I-9999 (5) and CG1(66) at 46.1926 34.5869 14.3458 in (null):I-9999 (8) other bump:2.95327 Ang CG2(44) at 46.3971 34.5101 11.4006 in (null):I-9999 (5) and CG1(66) at 46.1926 34.5869 14.3458 in (null):I-9999 (8) T0159 58 :NP 1pot 144 :DP Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues T0159 63 :CEGAINHQLAAYELTNTVT 1pot 169 :AREVFQMALRKLGYSGNTT Fragment has 8 clashes (null) has 8 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 21 residues other bump:2.56512 Ang CG(37) at 71.6495 49.6616 18.7935 in (null):N-9999 (6) and OD1(120) at 69.9284 48.9598 20.5613 in (null):N-9999 (16) other bump:1.61903 Ang ND2(38) at 70.9308 50.0189 19.8581 in (null):N-9999 (6) and OD1(120) at 69.9284 48.9598 20.5613 in (null):N-9999 (16) other bump:3.00529 Ang CG(37) at 71.6495 49.6616 18.7935 in (null):N-9999 (6) and CG(118) at 69.6011 50.1368 20.9407 in (null):N-9999 (16) other bump:1.71871 Ang ND2(38) at 70.9308 50.0189 19.8581 in (null):N-9999 (6) and CG(118) at 69.6011 50.1368 20.9407 in (null):N-9999 (16) other bump:3.17867 Ang CB(36) at 71.691 50.6321 17.6378 in (null):N-9999 (6) and CB(117) at 70.3838 51.3295 20.4501 in (null):N-9999 (16) other bump:2.66982 Ang CG(37) at 71.6495 49.6616 18.7935 in (null):N-9999 (6) and CB(117) at 70.3838 51.3295 20.4501 in (null):N-9999 (16) other bump:1.5386 Ang ND2(38) at 70.9308 50.0189 19.8581 in (null):N-9999 (6) and CB(117) at 70.3838 51.3295 20.4501 in (null):N-9999 (16) other bump:2.58283 Ang O(59) at 78.119 54.582 20.239 in (null):Q-9999 (8) and CD1(83) at 79.4591 56.6543 21.0011 in (null):Y-9999 (12) T0159 84 :QGNYAAMMADTIS 1pot 189 :PKEIEAAYNELKK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues T0159 97 :RYKEGKPVFYYTWTPYWVSNELK 1pot 217 :PYMEGEVNLGMIWNGSAFVARQA Fragment has 88 clashes (null) has 88 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 25 residues other bump:2.21955 Ang O(194) at 78.375 27.001 5.247 in (null):E-9999 (21) and N(213) at 79.616 26.781 3.42 in (null):G-9999 (24) other bump:2.18427 Ang CE(30) at 77.8539 32.2591 2.25346 in (null):K-9999 (3) and OD1(184) at 76.098 33.5367 2.48981 in (null):N-9999 (20) other bump:1.85266 Ang NZ(31) at 77.4623 32.8423 3.53335 in (null):K-9999 (3) and OD1(184) at 76.098 33.5367 2.48981 in (null):N-9999 (20) other bump:2.30766 Ang NZ(31) at 77.4623 32.8423 3.53335 in (null):K-9999 (3) and ND2(183) at 76.9017 35.0483 3.91364 in (null):N-9999 (20) other bump:2.3073 Ang CE(30) at 77.8539 32.2591 2.25346 in (null):K-9999 (3) and CG(182) at 76.6937 33.7836 3.53941 in (null):N-9999 (20) other bump:1.21522 Ang NZ(31) at 77.4623 32.8423 3.53335 in (null):K-9999 (3) and CG(182) at 76.6937 33.7836 3.53941 in (null):N-9999 (20) other bump:2.88641 Ang CD(29) at 78.4639 33.2887 1.31391 in (null):K-9999 (3) and CG(182) at 76.6937 33.7836 3.53941 in (null):N-9999 (20) other bump:2.20474 Ang CE(30) at 77.8539 32.2591 2.25346 in (null):K-9999 (3) and CB(181) at 77.3273 32.6758 4.35347 in (null):N-9999 (20) other bump:0.847673 Ang NZ(31) at 77.4623 32.8423 3.53335 in (null):K-9999 (3) and CB(181) at 77.3273 32.6758 4.35347 in (null):N-9999 (20) other bump:2.56821 Ang CE(30) at 77.8539 32.2591 2.25346 in (null):K-9999 (3) and CA(180) at 76.582 31.418 4.32 in (null):N-9999 (20) other bump:1.84995 Ang NZ(31) at 77.4623 32.8423 3.53335 in (null):K-9999 (3) and CA(180) at 76.582 31.418 4.32 in (null):N-9999 (20) other bump:2.75431 Ang CA(106) at 76.018 40.768 10.254 in (null):T-9999 (12) and CH2(163) at 76.8461 39.3381 12.4576 in (null):W-9999 (17) other bump:2.4772 Ang O(110) at 74.602 40.353 12.192 in (null):T-9999 (12) and CH2(163) at 76.8461 39.3381 12.4576 in (null):W-9999 (17) other bump:2.82406 Ang C(111) at 74.698 40.387 10.954 in (null):T-9999 (12) and CH2(163) at 76.8461 39.3381 12.4576 in (null):W-9999 (17) other bump:2.25909 Ang CB(107) at 77.1339 39.6978 10.246 in (null):T-9999 (12) and CH2(163) at 76.8461 39.3381 12.4576 in (null):W-9999 (17) other bump:1.74585 Ang CG2(108) at 76.9486 38.3962 10.9912 in (null):T-9999 (12) and CH2(163) at 76.8461 39.3381 12.4576 in (null):W-9999 (17) other bump:3.02255 Ang N(105) at 76.654 41.914 10.888 in (null):T-9999 (12) and CH2(163) at 76.8461 39.3381 12.4576 in (null):W-9999 (17) other bump:2.05521 Ang CG2(108) at 76.9486 38.3962 10.9912 in (null):T-9999 (12) and CZ3(162) at 76.5218 38.0687 12.9748 in (null):W-9999 (17) other bump:1.78364 Ang CA(106) at 76.018 40.768 10.254 in (null):T-9999 (12) and CZ2(161) at 76.9956 39.5454 11.109 in (null):W-9999 (17) other bump:2.74851 Ang O(110) at 74.602 40.353 12.192 in (null):T-9999 (12) and CZ2(161) at 76.9956 39.5454 11.109 in (null):W-9999 (17) other bump:2.45177 Ang C(111) at 74.698 40.387 10.954 in (null):T-9999 (12) and CZ2(161) at 76.9956 39.5454 11.109 in (null):W-9999 (17) other bump:0.887203 Ang CB(107) at 77.1339 39.6978 10.246 in (null):T-9999 (12) and CZ2(161) at 76.9956 39.5454 11.109 in (null):W-9999 (17) other bump:2.27493 Ang OG1(109) at 77.3386 39.3281 8.8706 in (null):T-9999 (12) and CZ2(161) at 76.9956 39.5454 11.109 in (null):W-9999 (17) other bump:1.15618 Ang CG2(108) at 76.9486 38.3962 10.9912 in (null):T-9999 (12) and CZ2(161) at 76.9956 39.5454 11.109 in (null):W-9999 (17) other bump:2.40326 Ang N(105) at 76.654 41.914 10.888 in (null):T-9999 (12) and CZ2(161) at 76.9956 39.5454 11.109 in (null):W-9999 (17) other bump:2.90334 Ang CA(106) at 76.018 40.768 10.254 in (null):T-9999 (12) and NE1(160) at 76.8971 38.3579 8.89459 in (null):W-9999 (17) other bump:1.91775 Ang CB(107) at 77.1339 39.6978 10.246 in (null):T-9999 (12) and NE1(160) at 76.8971 38.3579 8.89459 in (null):W-9999 (17) other bump:1.06623 Ang OG1(109) at 77.3386 39.3281 8.8706 in (null):T-9999 (12) and NE1(160) at 76.8971 38.3579 8.89459 in (null):W-9999 (17) other bump:2.0976 Ang CG2(108) at 76.9486 38.3962 10.9912 in (null):T-9999 (12) and NE1(160) at 76.8971 38.3579 8.89459 in (null):W-9999 (17) other bump:1.9198 Ang CG2(108) at 76.9486 38.3962 10.9912 in (null):T-9999 (12) and CE3(159) at 76.3392 36.9748 12.1286 in (null):W-9999 (17) other bump:2.45369 Ang CA(106) at 76.018 40.768 10.254 in (null):T-9999 (12) and CE2(158) at 76.8117 38.4462 10.2583 in (null):W-9999 (17) other bump:2.9527 Ang C(111) at 74.698 40.387 10.954 in (null):T-9999 (12) and CE2(158) at 76.8117 38.4462 10.2583 in (null):W-9999 (17) other bump:1.29243 Ang CB(107) at 77.1339 39.6978 10.246 in (null):T-9999 (12) and CE2(158) at 76.8117 38.4462 10.2583 in (null):W-9999 (17) other bump:1.72655 Ang OG1(109) at 77.3386 39.3281 8.8706 in (null):T-9999 (12) and CE2(158) at 76.8117 38.4462 10.2583 in (null):W-9999 (17) other bump:0.747261 Ang CG2(108) at 76.9486 38.3962 10.9912 in (null):T-9999 (12) and CE2(158) at 76.8117 38.4462 10.2583 in (null):W-9999 (17) other bump:2.66822 Ang CB(107) at 77.1339 39.6978 10.246 in (null):T-9999 (12) and CD2(157) at 76.4854 37.1584 10.7463 in (null):W-9999 (17) other bump:1.34415 Ang CG2(108) at 76.9486 38.3962 10.9912 in (null):T-9999 (12) and CD2(157) at 76.4854 37.1584 10.7463 in (null):W-9999 (17) other bump:2.39807 Ang OG1(109) at 77.3386 39.3281 8.8706 in (null):T-9999 (12) and CD1(156) at 76.6351 37.0637 8.51229 in (null):W-9999 (17) other bump:2.83175 Ang CG2(108) at 76.9486 38.3962 10.9912 in (null):T-9999 (12) and CD1(156) at 76.6351 37.0637 8.51229 in (null):W-9999 (17) other bump:2.58292 Ang CG2(108) at 76.9486 38.3962 10.9912 in (null):T-9999 (12) and CG(155) at 76.3778 36.2902 9.609 in (null):W-9999 (17) other bump:3.32969 Ang CE3(119) at 70.182 41.548 6.85 in (null):W-9999 (13) and CE1(146) at 69.155 38.6187 5.64543 in (null):Y-9999 (16) neighbor-bump: 2.79874 Ang OG1(130) at 70.5732 36.0793 13.7337 in (null):T-9999 (14) and CD(137) at 69.9656 36.5027 11.0348 in (null):P-9999 (15) neighbor-bump: 2.57721 Ang N(126) at 72.085 37.632 11.97 in (null):T-9999 (14) and CD(137) at 69.9656 36.5027 11.0348 in (null):P-9999 (15) other bump:2.30979 Ang CE2(88) at 79.0687 40.6647 8.12531 in (null):Y-9999 (10) and OG1(109) at 77.3386 39.3281 8.8706 in (null):T-9999 (12) other bump:3.02914 Ang CE2(88) at 79.0687 40.6647 8.12531 in (null):Y-9999 (10) and CB(107) at 77.1339 39.6978 10.246 in (null):T-9999 (12) neighbor-bump: 2.78291 Ang CD2(86) at 79.5197 41.9372 8.46055 in (null):Y-9999 (10) and C(104) at 77.56 42.656 10.301 in (null):Y-9999 (11) neighbor-bump: 2.29261 Ang CE2(88) at 79.0687 40.6647 8.12531 in (null):Y-9999 (10) and O(103) at 78.034 42.429 9.161 in (null):Y-9999 (11) neighbor-bump: 1.71464 Ang CD2(86) at 79.5197 41.9372 8.46055 in (null):Y-9999 (10) and O(103) at 78.034 42.429 9.161 in (null):Y-9999 (11) other bump:2.06082 Ang CD1(17) at 80.147 39.453 5.702 in (null):Y-9999 (2) and OH(90) at 79.5611 38.4439 7.40063 in (null):Y-9999 (10) other bump:2.08187 Ang CE1(19) at 79.789 40.375 6.657 in (null):Y-9999 (2) and OH(90) at 79.5611 38.4439 7.40063 in (null):Y-9999 (10) other bump:2.40684 Ang CZ(21) at 80.622 40.576 7.749 in (null):Y-9999 (2) and OH(90) at 79.5611 38.4439 7.40063 in (null):Y-9999 (10) other bump:2.42636 Ang CG(16) at 81.347 38.734 5.784 in (null):Y-9999 (2) and OH(90) at 79.5611 38.4439 7.40063 in (null):Y-9999 (10) other bump:2.72199 Ang CE2(20) at 81.821 39.887 7.869 in (null):Y-9999 (2) and OH(90) at 79.5611 38.4439 7.40063 in (null):Y-9999 (10) other bump:2.03431 Ang CD1(17) at 80.147 39.453 5.702 in (null):Y-9999 (2) and CZ(89) at 79.9844 39.7087 7.71361 in (null):Y-9999 (10) other bump:1.26433 Ang CE1(19) at 79.789 40.375 6.657 in (null):Y-9999 (2) and CZ(89) at 79.9844 39.7087 7.71361 in (null):Y-9999 (10) other bump:1.07703 Ang CZ(21) at 80.622 40.576 7.749 in (null):Y-9999 (2) and CZ(89) at 79.9844 39.7087 7.71361 in (null):Y-9999 (10) other bump:2.04012 Ang OH(22) at 80.303 41.444 8.738 in (null):Y-9999 (2) and CZ(89) at 79.9844 39.7087 7.71361 in (null):Y-9999 (10) other bump:2.55543 Ang CG(16) at 81.347 38.734 5.784 in (null):Y-9999 (2) and CZ(89) at 79.9844 39.7087 7.71361 in (null):Y-9999 (10) other bump:2.45486 Ang CD2(18) at 82.17 38.953 6.89 in (null):Y-9999 (2) and CZ(89) at 79.9844 39.7087 7.71361 in (null):Y-9999 (10) other bump:1.85178 Ang CE2(20) at 81.821 39.887 7.869 in (null):Y-9999 (2) and CZ(89) at 79.9844 39.7087 7.71361 in (null):Y-9999 (10) other bump:1.66092 Ang CE1(19) at 79.789 40.375 6.657 in (null):Y-9999 (2) and CE2(88) at 79.0687 40.6647 8.12531 in (null):Y-9999 (10) other bump:1.60069 Ang CZ(21) at 80.622 40.576 7.749 in (null):Y-9999 (2) and CE2(88) at 79.0687 40.6647 8.12531 in (null):Y-9999 (10) other bump:1.5831 Ang OH(22) at 80.303 41.444 8.738 in (null):Y-9999 (2) and CE2(88) at 79.0687 40.6647 8.12531 in (null):Y-9999 (10) other bump:2.32965 Ang CD1(17) at 80.147 39.453 5.702 in (null):Y-9999 (2) and CE1(87) at 81.3309 40.016 7.62781 in (null):Y-9999 (10) other bump:1.85705 Ang CE1(19) at 79.789 40.375 6.657 in (null):Y-9999 (2) and CE1(87) at 81.3309 40.016 7.62781 in (null):Y-9999 (10) other bump:0.911439 Ang CZ(21) at 80.622 40.576 7.749 in (null):Y-9999 (2) and CE1(87) at 81.3309 40.016 7.62781 in (null):Y-9999 (10) other bump:2.0804 Ang OH(22) at 80.303 41.444 8.738 in (null):Y-9999 (2) and CE1(87) at 81.3309 40.016 7.62781 in (null):Y-9999 (10) other bump:2.24578 Ang CG(16) at 81.347 38.734 5.784 in (null):Y-9999 (2) and CE1(87) at 81.3309 40.016 7.62781 in (null):Y-9999 (10) other bump:1.54226 Ang CD2(18) at 82.17 38.953 6.89 in (null):Y-9999 (2) and CE1(87) at 81.3309 40.016 7.62781 in (null):Y-9999 (10) other bump:0.561304 Ang CE2(20) at 81.821 39.887 7.869 in (null):Y-9999 (2) and CE1(87) at 81.3309 40.016 7.62781 in (null):Y-9999 (10) other bump:2.40118 Ang CE1(19) at 79.789 40.375 6.657 in (null):Y-9999 (2) and CD2(86) at 79.5197 41.9372 8.46055 in (null):Y-9999 (10) other bump:1.89051 Ang CZ(21) at 80.622 40.576 7.749 in (null):Y-9999 (2) and CD2(86) at 79.5197 41.9372 8.46055 in (null):Y-9999 (10) other bump:0.966271 Ang OH(22) at 80.303 41.444 8.738 in (null):Y-9999 (2) and CD2(86) at 79.5197 41.9372 8.46055 in (null):Y-9999 (10) other bump:2.54618 Ang CE1(19) at 79.789 40.375 6.657 in (null):Y-9999 (2) and CD1(85) at 81.7688 41.3018 7.96257 in (null):Y-9999 (10) other bump:1.37387 Ang CZ(21) at 80.622 40.576 7.749 in (null):Y-9999 (2) and CD1(85) at 81.7688 41.3018 7.96257 in (null):Y-9999 (10) other bump:1.66434 Ang OH(22) at 80.303 41.444 8.738 in (null):Y-9999 (2) and CD1(85) at 81.7688 41.3018 7.96257 in (null):Y-9999 (10) other bump:2.6131 Ang CD2(18) at 82.17 38.953 6.89 in (null):Y-9999 (2) and CD1(85) at 81.7688 41.3018 7.96257 in (null):Y-9999 (10) other bump:1.41886 Ang CE2(20) at 81.821 39.887 7.869 in (null):Y-9999 (2) and CD1(85) at 81.7688 41.3018 7.96257 in (null):Y-9999 (10) other bump:1.84089 Ang CZ(21) at 80.622 40.576 7.749 in (null):Y-9999 (2) and CG(84) at 80.8809 42.2859 8.37995 in (null):Y-9999 (10) other bump:1.08212 Ang OH(22) at 80.303 41.444 8.738 in (null):Y-9999 (2) and CG(84) at 80.8809 42.2859 8.37995 in (null):Y-9999 (10) other bump:2.62669 Ang CE2(20) at 81.821 39.887 7.869 in (null):Y-9999 (2) and CG(84) at 80.8809 42.2859 8.37995 in (null):Y-9999 (10) other bump:2.45374 Ang OH(22) at 80.303 41.444 8.738 in (null):Y-9999 (2) and CB(83) at 81.3094 43.6818 8.75665 in (null):Y-9999 (10) neighbor-bump: 2.64744 Ang C(80) at 83.662 42.718 9.495 in (null):F-9999 (9) and CB(83) at 81.3094 43.6818 8.75665 in (null):Y-9999 (10) neighbor-bump: 2.89828 Ang CG2(67) at 88.4736 41.8589 8.31969 in (null):V-9999 (8) and CD2(75) at 87.5426 43.7501 10.3088 in (null):F-9999 (9) neighbor-bump: 2.4412 Ang N(47) at 85.68 40.233 0.492 in (null):K-9999 (6) and CD(60) at 84.2296 41.6341 1.86773 in (null):P-9999 (7) neighbor-bump: 1.92408 Ang C(55) at 85.924 42.408 1.386 in (null):K-9999 (6) and CD(60) at 84.2296 41.6341 1.86773 in (null):P-9999 (7) other bump:1.81594 Ang OE1(39) at 82.02 40.453 -4.266 in (null):E-9999 (4) and NZ(53) at 83.1467 41.3315 -5.38689 in (null):K-9999 (6) other bump:2.45595 Ang OE1(39) at 82.02 40.453 -4.266 in (null):E-9999 (4) and CE(52) at 84.3662 41.1147 -4.56481 in (null):K-9999 (6) T0159 124 :VVWLQVPFSALPGDKNADTKLPNGA 1pot 240 :GTPIDVVWPKEGGIFWMDSLAIPAN Fragment has 17 clashes (null) has 17 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 27 residues neighbor-bump: 3.15224 Ang CB(93) at 75.7174 44.702 21.4427 in (null):P-9999 (12) and CA(99) at 73.757 42.689 20.014 in (null):G-9999 (13) neighbor-bump: 1.84228 Ang CB(93) at 75.7174 44.702 21.4427 in (null):P-9999 (12) and N(98) at 74.338 43.532 21.093 in (null):G-9999 (13) self-bump: 2.18089 Ang CB(93) at 75.7174 44.702 21.4427 in (null):P-9999 (12) and C(97) at 74.459 43.168 22.348 in (null):P-9999 (12) other bump:2.35264 Ang O(76) at 78.253 42.26 23.519 in (null):S-9999 (9) and CD(95) at 77.4353 44.4076 23.0149 in (null):P-9999 (12) other bump:2.22045 Ang OG(75) at 78.0752 43.9939 20.9292 in (null):S-9999 (9) and CD(95) at 77.4353 44.4076 23.0149 in (null):P-9999 (12) neighbor-bump: 2.39652 Ang CA(84) at 77.935 46.02 24.716 in (null):L-9999 (11) and CD(95) at 77.4353 44.4076 23.0149 in (null):P-9999 (12) neighbor-bump: 2.05495 Ang C(90) at 76.503 45.626 24.382 in (null):L-9999 (11) and CD(95) at 77.4353 44.4076 23.0149 in (null):P-9999 (12) self-bump: 1.26643 Ang N(91) at 76.301 44.603 23.543 in (null):P-9999 (12) and CD(95) at 77.4353 44.4076 23.0149 in (null):P-9999 (12) other bump:2.757 Ang C(77) at 79.327 42.405 22.904 in (null):S-9999 (9) and CD(95) at 77.4353 44.4076 23.0149 in (null):P-9999 (12) neighbor-bump: 2.13113 Ang N(83) at 78.938 44.986 24.411 in (null):L-9999 (11) and CD(95) at 77.4353 44.4076 23.0149 in (null):P-9999 (12) other bump:1.88324 Ang OG(75) at 78.0752 43.9939 20.9292 in (null):S-9999 (9) and CG(94) at 77.0405 45.2703 21.8494 in (null):P-9999 (12) neighbor-bump: 3.09508 Ang CA(84) at 77.935 46.02 24.716 in (null):L-9999 (11) and CG(94) at 77.0405 45.2703 21.8494 in (null):P-9999 (12) neighbor-bump: 2.61331 Ang C(90) at 76.503 45.626 24.382 in (null):L-9999 (11) and CG(94) at 77.0405 45.2703 21.8494 in (null):P-9999 (12) self-bump: 1.96476 Ang N(91) at 76.301 44.603 23.543 in (null):P-9999 (12) and CG(94) at 77.0405 45.2703 21.8494 in (null):P-9999 (12) other bump:2.51481 Ang OG(75) at 78.0752 43.9939 20.9292 in (null):S-9999 (9) and CB(93) at 75.7174 44.702 21.4427 in (null):P-9999 (12) other bump:2.54522 Ang CG1(12) at 82.3074 32.613 4.60055 in (null):V-9999 (2) and CD2(35) at 82.2323 34.368 6.44247 in (null):L-9999 (4) other bump:2.70348 Ang CG1(12) at 82.3074 32.613 4.60055 in (null):V-9999 (2) and CG(33) at 80.9597 33.5961 6.72805 in (null):L-9999 (4) Number of specific fragments= 7 total=74 Number of alignments=22 # Reading fragments from alignment file # T0159 read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1a4uA/T0159-1a4uA-2track-protein-STR-global-adpstyle5.pw.a2m.gz # 1a4uA read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1a4uA/T0159-1a4uA-2track-protein-STR-global-adpstyle5.pw.a2m.gz # found chain 1a4uA in template set T0159 1 :K 1a4uA 1 :M Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 2 residues T0159 48 :GDGKADLTGCNPGWGCEGAINHQLAAYELTNTVTHNQGNYAAMMADTI 1a4uA 2 :DLTNKNVIFVAALGGIGLDTSRELVKRNLKNFVILDRVENPTALAELK Fragment has 26 clashes (null) has 26 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 50 residues other bump:2.81877 Ang CA(81) at 12.524 -14.987 -4.597 in (null):G-9999 (13) and CE(310) at 10.8863 -15.3361 -6.86446 in (null):M-9999 (43) other bump:2.84447 Ang C(83) at 11.121 -14.611 -4.124 in (null):G-9999 (13) and CE(310) at 10.8863 -15.3361 -6.86446 in (null):M-9999 (43) other bump:3.26707 Ang CD2(288) at 9.22028 -19.9501 -7.23044 in (null):Y-9999 (40) and SD(309) at 9.98486 -16.8484 -6.54608 in (null):M-9999 (43) other bump:2.59464 Ang O(82) at 10.147 -15.265 -4.497 in (null):G-9999 (13) and SD(309) at 9.98486 -16.8484 -6.54608 in (null):M-9999 (43) other bump:2.60459 Ang CD2(288) at 9.22028 -19.9501 -7.23044 in (null):Y-9999 (40) and CG(308) at 10.1149 -17.6795 -8.14019 in (null):M-9999 (43) other bump:2.31057 Ang CG2(51) at 23.9885 -12.514 0.11064 in (null):T-9999 (8) and NE2(251) at 23.7429 -14.7728 0.530312 in (null):H-9999 (35) other bump:2.66161 Ang CG2(51) at 23.9885 -12.514 0.11064 in (null):T-9999 (8) and CD2(248) at 22.3892 -14.5772 0.629521 in (null):H-9999 (35) other bump:2.06087 Ang CG(76) at 17.0257 -14.1504 -3.50066 in (null):P-9999 (12) and CG2(240) at 17.7229 -16.0891 -3.55264 in (null):T-9999 (34) other bump:2.91775 Ang CD(77) at 16.7128 -13.783 -2.07791 in (null):P-9999 (12) and CG2(240) at 17.7229 -16.0891 -3.55264 in (null):T-9999 (34) other bump:2.83204 Ang CD1(204) at 23.479 -9.573 -10.197 in (null):L-9999 (29) and OG1(227) at 23.6104 -12.3329 -9.57571 in (null):T-9999 (32) other bump:2.66945 Ang CA(19) at 30.876 -8.51 -13.096 in (null):K-9999 (4) and CG2(211) at 31.3114 -10.9438 -12.0894 in (null):T-9999 (30) other bump:2.66723 Ang C(26) at 30.896 -8.359 -11.579 in (null):K-9999 (4) and CG2(211) at 31.3114 -10.9438 -12.0894 in (null):T-9999 (30) other bump:2.63806 Ang CD1(44) at 25.5945 -8.36617 -8.23537 in (null):L-9999 (7) and CD2(205) at 25.137 -7.791 -10.769 in (null):L-9999 (29) other bump:2.55186 Ang O(159) at 18.47 -6.449 -14.003 in (null):Q-9999 (23) and CE2(186) at 19.4265 -4.1147 -13.6181 in (null):Y-9999 (27) other bump:2.58275 Ang O(159) at 18.47 -6.449 -14.003 in (null):Q-9999 (23) and CD2(184) at 20.5345 -4.95004 -13.6012 in (null):Y-9999 (27) other bump:2.38533 Ang O(119) at 12.466 -10.797 -9.812 in (null):G-9999 (18) and CD2(146) at 11.4814 -11.3677 -11.9083 in (null):H-9999 (22) other bump:3.09134 Ang C(120) at 11.644 -10.552 -8.931 in (null):G-9999 (18) and CD2(146) at 11.4814 -11.3677 -11.9083 in (null):H-9999 (22) other bump:2.65582 Ang CB(67) at 13.9963 -12.3484 1.17652 in (null):N-9999 (11) and OE1(113) at 13.1813 -11.7039 -1.26763 in (null):E-9999 (17) other bump:0.541215 Ang O(71) at 13.653 -11.744 -1.53 in (null):N-9999 (11) and OE1(113) at 13.1813 -11.7039 -1.26763 in (null):E-9999 (17) other bump:1.61493 Ang C(72) at 14.564 -12.538 -1.29 in (null):N-9999 (11) and OE1(113) at 13.1813 -11.7039 -1.26763 in (null):E-9999 (17) other bump:2.52622 Ang CA(66) at 14.794 -13.062 0.124 in (null):N-9999 (11) and OE1(113) at 13.1813 -11.7039 -1.26763 in (null):E-9999 (17) other bump:1.50692 Ang O(71) at 13.653 -11.744 -1.53 in (null):N-9999 (11) and CD(112) at 12.9699 -10.4823 -1.06924 in (null):E-9999 (17) other bump:2.61071 Ang C(72) at 14.564 -12.538 -1.29 in (null):N-9999 (11) and CD(112) at 12.9699 -10.4823 -1.06924 in (null):E-9999 (17) other bump:2.46192 Ang O(71) at 13.653 -11.744 -1.53 in (null):N-9999 (11) and CG(111) at 12.7883 -9.55555 -2.2539 in (null):E-9999 (17) other bump:2.59534 Ang O(96) at 10.085 -10.835 -3.287 in (null):W-9999 (14) and CB(110) at 12.603 -10.2742 -3.5712 in (null):E-9999 (17) other bump:2.62997 Ang O(57) at 19.17 -13.097 -1.439 in (null):G-9999 (9) and CD(77) at 16.7128 -13.783 -2.07791 in (null):P-9999 (12) T0159 97 :RYKEGKPVFYYTWTPYWVSNELK 1a4uA 50 :AINPKVNITFHTYDVTVPVAESK Fragment has 31 clashes (null) has 31 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 25 residues other bump:2.52491 Ang NE1(120) at 21.514 -16.2522 7.0993 in (null):W-9999 (13) and CD2(201) at 23.473 -14.7167 7.52335 in (null):L-9999 (22) other bump:3.10709 Ang CE3(159) at 21.4832 -20.198 9.89918 in (null):W-9999 (17) and CG(190) at 23.145 -20.885 12.433 in (null):E-9999 (21) other bump:2.05239 Ang OG1(130) at 16.8373 -19.9413 9.49359 in (null):T-9999 (14) and NE1(160) at 18.1142 -21.0951 10.612 in (null):W-9999 (17) other bump:2.87558 Ang OG1(130) at 16.8373 -19.9413 9.49359 in (null):T-9999 (14) and CE2(158) at 19.3293 -21.2872 9.99117 in (null):W-9999 (17) other bump:2.33199 Ang OG1(130) at 16.8373 -19.9413 9.49359 in (null):T-9999 (14) and CD1(156) at 18.1884 -19.9715 11.3941 in (null):W-9999 (17) other bump:3.10144 Ang CB(128) at 15.832 -19.2778 8.71861 in (null):T-9999 (14) and CE2(147) at 13.2908 -18.895 10.455 in (null):Y-9999 (16) other bump:2.90888 Ang CZ3(122) at 18.3749 -13.9123 5.86341 in (null):W-9999 (13) and CG(136) at 15.7077 -14.1844 6.99183 in (null):P-9999 (15) other bump:3.14177 Ang CZ3(122) at 18.3749 -13.9123 5.86341 in (null):W-9999 (13) and CB(135) at 16.2945 -13.5223 8.18518 in (null):P-9999 (15) other bump:3.19128 Ang CH2(123) at 19.1985 -13.3794 6.86957 in (null):W-9999 (13) and CB(135) at 16.2945 -13.5223 8.18518 in (null):P-9999 (15) other bump:2.96575 Ang CD1(74) at 25.5333 -22.0476 -4.73096 in (null):F-9999 (9) and OH(102) at 27.3226 -20.5892 -2.86895 in (null):Y-9999 (11) other bump:2.57808 Ang CZ(78) at 25.5425 -22.377 -2.33833 in (null):F-9999 (9) and OH(102) at 27.3226 -20.5892 -2.86895 in (null):Y-9999 (11) other bump:2.47472 Ang CD2(75) at 24.9059 -20.2517 -3.28133 in (null):F-9999 (9) and OH(102) at 27.3226 -20.5892 -2.86895 in (null):Y-9999 (11) other bump:2.35632 Ang CE2(77) at 25.1234 -21.0669 -2.17073 in (null):F-9999 (9) and OH(102) at 27.3226 -20.5892 -2.86895 in (null):Y-9999 (11) other bump:2.81605 Ang CE1(76) at 25.7498 -22.8687 -3.61451 in (null):F-9999 (9) and CZ(101) at 26.2173 -20.5729 -2.05208 in (null):Y-9999 (11) other bump:1.94728 Ang CZ(78) at 25.5425 -22.377 -2.33833 in (null):F-9999 (9) and CZ(101) at 26.2173 -20.5729 -2.05208 in (null):Y-9999 (11) other bump:2.75432 Ang CG(73) at 25.1149 -20.7282 -4.5714 in (null):F-9999 (9) and CZ(101) at 26.2173 -20.5729 -2.05208 in (null):Y-9999 (11) other bump:1.82593 Ang CD2(75) at 24.9059 -20.2517 -3.28133 in (null):F-9999 (9) and CZ(101) at 26.2173 -20.5729 -2.05208 in (null):Y-9999 (11) other bump:1.20613 Ang CE2(77) at 25.1234 -21.0669 -2.17073 in (null):F-9999 (9) and CZ(101) at 26.2173 -20.5729 -2.05208 in (null):Y-9999 (11) other bump:2.86176 Ang CZ(78) at 25.5425 -22.377 -2.33833 in (null):F-9999 (9) and CE2(100) at 25.3336 -19.5357 -2.06817 in (null):Y-9999 (11) other bump:2.78138 Ang CG(73) at 25.1149 -20.7282 -4.5714 in (null):F-9999 (9) and CE2(100) at 25.3336 -19.5357 -2.06817 in (null):Y-9999 (11) other bump:1.47219 Ang CD2(75) at 24.9059 -20.2517 -3.28133 in (null):F-9999 (9) and CE2(100) at 25.3336 -19.5357 -2.06817 in (null):Y-9999 (11) other bump:1.54899 Ang CE2(77) at 25.1234 -21.0669 -2.17073 in (null):F-9999 (9) and CE2(100) at 25.3336 -19.5357 -2.06817 in (null):Y-9999 (11) other bump:2.63498 Ang CE1(76) at 25.7498 -22.8687 -3.61451 in (null):F-9999 (9) and CE1(99) at 25.9843 -21.6866 -1.27124 in (null):Y-9999 (11) other bump:1.34556 Ang CZ(78) at 25.5425 -22.377 -2.33833 in (null):F-9999 (9) and CE1(99) at 25.9843 -21.6866 -1.27124 in (null):Y-9999 (11) other bump:2.69493 Ang CD2(75) at 24.9059 -20.2517 -3.28133 in (null):F-9999 (9) and CE1(99) at 25.9843 -21.6866 -1.27124 in (null):Y-9999 (11) other bump:1.39083 Ang CE2(77) at 25.1234 -21.0669 -2.17073 in (null):F-9999 (9) and CE1(99) at 25.9843 -21.6866 -1.27124 in (null):Y-9999 (11) other bump:2.27958 Ang CD2(75) at 24.9059 -20.2517 -3.28133 in (null):F-9999 (9) and CD2(98) at 24.2075 -19.5559 -1.22593 in (null):Y-9999 (11) other bump:2.00363 Ang CE2(77) at 25.1234 -21.0669 -2.17073 in (null):F-9999 (9) and CD2(98) at 24.2075 -19.5559 -1.22593 in (null):Y-9999 (11) other bump:2.11269 Ang CZ(78) at 25.5425 -22.377 -2.33833 in (null):F-9999 (9) and CD1(97) at 24.85 -21.6996 -0.460833 in (null):Y-9999 (11) other bump:1.84359 Ang CE2(77) at 25.1234 -21.0669 -2.17073 in (null):F-9999 (9) and CD1(97) at 24.85 -21.6996 -0.460833 in (null):Y-9999 (11) other bump:2.11859 Ang CE2(77) at 25.1234 -21.0669 -2.17073 in (null):F-9999 (9) and CG(96) at 23.9689 -20.6522 -0.443387 in (null):Y-9999 (11) T0159 125 :VWL 1a4uA 73 :KLL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 5 residues T0159 131 :FSALPGDKNADTKL 1a4uA 76 :KKIFDQLKTVDILI Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 16 residues other bump:1.38665 Ang O(11) at 33.262 -18.25 3.558 in (null):F-9999 (1) and CD(36) at 33.7527 -17.9313 2.30086 in (null):P-9999 (5) other bump:3.00319 Ang C(18) at 31.294 -19.571 1.767 in (null):S-9999 (2) and CD(36) at 33.7527 -17.9313 2.30086 in (null):P-9999 (5) other bump:2.53341 Ang C(12) at 32.319 -18.388 4.339 in (null):F-9999 (1) and CD(36) at 33.7527 -17.9313 2.30086 in (null):P-9999 (5) other bump:1.72642 Ang O(11) at 33.262 -18.25 3.558 in (null):F-9999 (1) and CG(35) at 34.7149 -18.9287 2.91855 in (null):P-9999 (5) other bump:2.83734 Ang C(12) at 32.319 -18.388 4.339 in (null):F-9999 (1) and CG(35) at 34.7149 -18.9287 2.91855 in (null):P-9999 (5) T0159 146 :NGANYG 1a4uA 90 :NGAGIL Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 7 residues other bump:2.83842 Ang C(13) at 13.983 -8.979 2.282 in (null):G-9999 (2) and ND2(23) at 11.5984 -7.58109 2.92721 in (null):N-9999 (4) neighbor-bump: 2.47507 Ang O(17) at 12.559 -8.514 5.167 in (null):A-9999 (3) and CG(22) at 10.767 -7.33565 3.93164 in (null):N-9999 (4) Number of specific fragments= 6 total=80 Number of alignments=23 # Reading fragments from alignment file # T0159 read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1a4uA/T0159-1a4uA-2track-protein-STR-global-adpstyle1.pw.a2m.gz # 1a4uA read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1a4uA/T0159-1a4uA-2track-protein-STR-global-adpstyle1.pw.a2m.gz # found chain 1a4uA in template set T0159 48 :GDGKADLTGCNPGWGCEGAINHQLAAYELTNTVTHNQGNYAAMMADT 1a4uA 2 :DLTNKNVIFVAALGGIGLDTSRELVKRNLKNFVILDRVENPTALAEL Fragment has 26 clashes (null) has 26 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 49 residues other bump:2.81877 Ang CA(81) at 12.524 -14.987 -4.597 in (null):G-9999 (13) and CE(310) at 10.8863 -15.3361 -6.86446 in (null):M-9999 (43) other bump:2.84447 Ang C(83) at 11.121 -14.611 -4.124 in (null):G-9999 (13) and CE(310) at 10.8863 -15.3361 -6.86446 in (null):M-9999 (43) other bump:3.26707 Ang CD2(288) at 9.22028 -19.9501 -7.23044 in (null):Y-9999 (40) and SD(309) at 9.98486 -16.8484 -6.54608 in (null):M-9999 (43) other bump:2.59464 Ang O(82) at 10.147 -15.265 -4.497 in (null):G-9999 (13) and SD(309) at 9.98486 -16.8484 -6.54608 in (null):M-9999 (43) other bump:2.60459 Ang CD2(288) at 9.22028 -19.9501 -7.23044 in (null):Y-9999 (40) and CG(308) at 10.1149 -17.6795 -8.14019 in (null):M-9999 (43) other bump:2.31057 Ang CG2(51) at 23.9885 -12.514 0.11064 in (null):T-9999 (8) and NE2(251) at 23.7429 -14.7728 0.530312 in (null):H-9999 (35) other bump:2.66161 Ang CG2(51) at 23.9885 -12.514 0.11064 in (null):T-9999 (8) and CD2(248) at 22.3892 -14.5772 0.629521 in (null):H-9999 (35) other bump:2.06087 Ang CG(76) at 17.0257 -14.1504 -3.50066 in (null):P-9999 (12) and CG2(240) at 17.7229 -16.0891 -3.55264 in (null):T-9999 (34) other bump:2.91775 Ang CD(77) at 16.7128 -13.783 -2.07791 in (null):P-9999 (12) and CG2(240) at 17.7229 -16.0891 -3.55264 in (null):T-9999 (34) other bump:2.83204 Ang CD1(204) at 23.479 -9.573 -10.197 in (null):L-9999 (29) and OG1(227) at 23.6104 -12.3329 -9.57571 in (null):T-9999 (32) other bump:2.66945 Ang CA(19) at 30.876 -8.51 -13.096 in (null):K-9999 (4) and CG2(211) at 31.3114 -10.9438 -12.0894 in (null):T-9999 (30) other bump:2.66723 Ang C(26) at 30.896 -8.359 -11.579 in (null):K-9999 (4) and CG2(211) at 31.3114 -10.9438 -12.0894 in (null):T-9999 (30) other bump:2.63806 Ang CD1(44) at 25.5945 -8.36617 -8.23537 in (null):L-9999 (7) and CD2(205) at 25.137 -7.791 -10.769 in (null):L-9999 (29) other bump:2.55186 Ang O(159) at 18.47 -6.449 -14.003 in (null):Q-9999 (23) and CE2(186) at 19.4265 -4.1147 -13.6181 in (null):Y-9999 (27) other bump:2.58275 Ang O(159) at 18.47 -6.449 -14.003 in (null):Q-9999 (23) and CD2(184) at 20.5345 -4.95004 -13.6012 in (null):Y-9999 (27) other bump:2.38533 Ang O(119) at 12.466 -10.797 -9.812 in (null):G-9999 (18) and CD2(146) at 11.4814 -11.3677 -11.9083 in (null):H-9999 (22) other bump:3.09134 Ang C(120) at 11.644 -10.552 -8.931 in (null):G-9999 (18) and CD2(146) at 11.4814 -11.3677 -11.9083 in (null):H-9999 (22) other bump:2.65582 Ang CB(67) at 13.9963 -12.3484 1.17652 in (null):N-9999 (11) and OE1(113) at 13.1813 -11.7039 -1.26763 in (null):E-9999 (17) other bump:0.541215 Ang O(71) at 13.653 -11.744 -1.53 in (null):N-9999 (11) and OE1(113) at 13.1813 -11.7039 -1.26763 in (null):E-9999 (17) other bump:1.61493 Ang C(72) at 14.564 -12.538 -1.29 in (null):N-9999 (11) and OE1(113) at 13.1813 -11.7039 -1.26763 in (null):E-9999 (17) other bump:2.52622 Ang CA(66) at 14.794 -13.062 0.124 in (null):N-9999 (11) and OE1(113) at 13.1813 -11.7039 -1.26763 in (null):E-9999 (17) other bump:1.50692 Ang O(71) at 13.653 -11.744 -1.53 in (null):N-9999 (11) and CD(112) at 12.9699 -10.4823 -1.06924 in (null):E-9999 (17) other bump:2.61071 Ang C(72) at 14.564 -12.538 -1.29 in (null):N-9999 (11) and CD(112) at 12.9699 -10.4823 -1.06924 in (null):E-9999 (17) other bump:2.46192 Ang O(71) at 13.653 -11.744 -1.53 in (null):N-9999 (11) and CG(111) at 12.7883 -9.55555 -2.2539 in (null):E-9999 (17) other bump:2.59534 Ang O(96) at 10.085 -10.835 -3.287 in (null):W-9999 (14) and CB(110) at 12.603 -10.2742 -3.5712 in (null):E-9999 (17) other bump:2.62997 Ang O(57) at 19.17 -13.097 -1.439 in (null):G-9999 (9) and CD(77) at 16.7128 -13.783 -2.07791 in (null):P-9999 (12) T0159 96 :SRYKEGKPVFYYTWTPYWVSNELK 1a4uA 49 :KAINPKVNITFHTYDVTVPVAESK Fragment has 31 clashes (null) has 31 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 26 residues other bump:2.52491 Ang NE1(126) at 21.514 -16.2522 7.0993 in (null):W-9999 (14) and CD2(207) at 23.473 -14.7167 7.52335 in (null):L-9999 (23) other bump:3.10709 Ang CE3(165) at 21.4832 -20.198 9.89918 in (null):W-9999 (18) and CG(196) at 23.145 -20.885 12.433 in (null):E-9999 (22) other bump:2.05239 Ang OG1(136) at 16.8373 -19.9413 9.49359 in (null):T-9999 (15) and NE1(166) at 18.1142 -21.0951 10.612 in (null):W-9999 (18) other bump:2.87558 Ang OG1(136) at 16.8373 -19.9413 9.49359 in (null):T-9999 (15) and CE2(164) at 19.3293 -21.2872 9.99117 in (null):W-9999 (18) other bump:2.33199 Ang OG1(136) at 16.8373 -19.9413 9.49359 in (null):T-9999 (15) and CD1(162) at 18.1884 -19.9715 11.3941 in (null):W-9999 (18) other bump:3.10144 Ang CB(134) at 15.832 -19.2778 8.71861 in (null):T-9999 (15) and CE2(153) at 13.2908 -18.895 10.455 in (null):Y-9999 (17) other bump:2.90888 Ang CZ3(128) at 18.3749 -13.9123 5.86341 in (null):W-9999 (14) and CG(142) at 15.7077 -14.1844 6.99183 in (null):P-9999 (16) other bump:3.14177 Ang CZ3(128) at 18.3749 -13.9123 5.86341 in (null):W-9999 (14) and CB(141) at 16.2945 -13.5223 8.18518 in (null):P-9999 (16) other bump:3.19128 Ang CH2(129) at 19.1985 -13.3794 6.86957 in (null):W-9999 (14) and CB(141) at 16.2945 -13.5223 8.18518 in (null):P-9999 (16) other bump:2.96575 Ang CD1(80) at 25.5333 -22.0476 -4.73096 in (null):F-9999 (10) and OH(108) at 27.3226 -20.5892 -2.86895 in (null):Y-9999 (12) other bump:2.57808 Ang CZ(84) at 25.5425 -22.377 -2.33833 in (null):F-9999 (10) and OH(108) at 27.3226 -20.5892 -2.86895 in (null):Y-9999 (12) other bump:2.47472 Ang CD2(81) at 24.9059 -20.2517 -3.28133 in (null):F-9999 (10) and OH(108) at 27.3226 -20.5892 -2.86895 in (null):Y-9999 (12) other bump:2.35632 Ang CE2(83) at 25.1234 -21.0669 -2.17073 in (null):F-9999 (10) and OH(108) at 27.3226 -20.5892 -2.86895 in (null):Y-9999 (12) other bump:2.81605 Ang CE1(82) at 25.7498 -22.8687 -3.61451 in (null):F-9999 (10) and CZ(107) at 26.2173 -20.5729 -2.05208 in (null):Y-9999 (12) other bump:1.94728 Ang CZ(84) at 25.5425 -22.377 -2.33833 in (null):F-9999 (10) and CZ(107) at 26.2173 -20.5729 -2.05208 in (null):Y-9999 (12) other bump:2.75432 Ang CG(79) at 25.1149 -20.7282 -4.5714 in (null):F-9999 (10) and CZ(107) at 26.2173 -20.5729 -2.05208 in (null):Y-9999 (12) other bump:1.82593 Ang CD2(81) at 24.9059 -20.2517 -3.28133 in (null):F-9999 (10) and CZ(107) at 26.2173 -20.5729 -2.05208 in (null):Y-9999 (12) other bump:1.20613 Ang CE2(83) at 25.1234 -21.0669 -2.17073 in (null):F-9999 (10) and CZ(107) at 26.2173 -20.5729 -2.05208 in (null):Y-9999 (12) other bump:2.86176 Ang CZ(84) at 25.5425 -22.377 -2.33833 in (null):F-9999 (10) and CE2(106) at 25.3336 -19.5357 -2.06817 in (null):Y-9999 (12) other bump:2.78138 Ang CG(79) at 25.1149 -20.7282 -4.5714 in (null):F-9999 (10) and CE2(106) at 25.3336 -19.5357 -2.06817 in (null):Y-9999 (12) other bump:1.47219 Ang CD2(81) at 24.9059 -20.2517 -3.28133 in (null):F-9999 (10) and CE2(106) at 25.3336 -19.5357 -2.06817 in (null):Y-9999 (12) other bump:1.54899 Ang CE2(83) at 25.1234 -21.0669 -2.17073 in (null):F-9999 (10) and CE2(106) at 25.3336 -19.5357 -2.06817 in (null):Y-9999 (12) other bump:2.63498 Ang CE1(82) at 25.7498 -22.8687 -3.61451 in (null):F-9999 (10) and CE1(105) at 25.9843 -21.6866 -1.27124 in (null):Y-9999 (12) other bump:1.34556 Ang CZ(84) at 25.5425 -22.377 -2.33833 in (null):F-9999 (10) and CE1(105) at 25.9843 -21.6866 -1.27124 in (null):Y-9999 (12) other bump:2.69493 Ang CD2(81) at 24.9059 -20.2517 -3.28133 in (null):F-9999 (10) and CE1(105) at 25.9843 -21.6866 -1.27124 in (null):Y-9999 (12) other bump:1.39083 Ang CE2(83) at 25.1234 -21.0669 -2.17073 in (null):F-9999 (10) and CE1(105) at 25.9843 -21.6866 -1.27124 in (null):Y-9999 (12) other bump:2.27958 Ang CD2(81) at 24.9059 -20.2517 -3.28133 in (null):F-9999 (10) and CD2(104) at 24.2075 -19.5559 -1.22593 in (null):Y-9999 (12) other bump:2.00363 Ang CE2(83) at 25.1234 -21.0669 -2.17073 in (null):F-9999 (10) and CD2(104) at 24.2075 -19.5559 -1.22593 in (null):Y-9999 (12) other bump:2.11269 Ang CZ(84) at 25.5425 -22.377 -2.33833 in (null):F-9999 (10) and CD1(103) at 24.85 -21.6996 -0.460833 in (null):Y-9999 (12) other bump:1.84359 Ang CE2(83) at 25.1234 -21.0669 -2.17073 in (null):F-9999 (10) and CD1(103) at 24.85 -21.6996 -0.460833 in (null):Y-9999 (12) other bump:2.11859 Ang CE2(83) at 25.1234 -21.0669 -2.17073 in (null):F-9999 (10) and CG(102) at 23.9689 -20.6522 -0.443387 in (null):Y-9999 (12) T0159 128 :QVPFSALPGDKNADTKLPNGANYG 1a4uA 73 :KLLKKIFDQLKTVDILINGAGILD Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 25 residues other bump:3.00319 Ang C(41) at 31.294 -19.571 1.767 in (null):S-9999 (5) and CD(59) at 33.7527 -17.9313 2.30086 in (null):P-9999 (8) other bump:1.38665 Ang O(34) at 33.262 -18.25 3.558 in (null):F-9999 (4) and CD(59) at 33.7527 -17.9313 2.30086 in (null):P-9999 (8) other bump:2.53341 Ang C(35) at 32.319 -18.388 4.339 in (null):F-9999 (4) and CD(59) at 33.7527 -17.9313 2.30086 in (null):P-9999 (8) other bump:1.72642 Ang O(34) at 33.262 -18.25 3.558 in (null):F-9999 (4) and CG(58) at 34.7149 -18.9287 2.91855 in (null):P-9999 (8) other bump:2.83734 Ang C(35) at 32.319 -18.388 4.339 in (null):F-9999 (4) and CG(58) at 34.7149 -18.9287 2.91855 in (null):P-9999 (8) Number of specific fragments= 3 total=83 Number of alignments=24 # Reading fragments from alignment file # T0159 read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1cl1A/T0159-1cl1A-2track-protein-STR-global-adpstyle5.pw.a2m.gz # 1cl1A read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1cl1A/T0159-1cl1A-2track-protein-STR-global-adpstyle5.pw.a2m.gz # found chain 1cl1A in template set T0159 6 :EGVFVNGAAQ 1cl1A 6 :LDTQLVNAGR Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 12 residues other bump:2.25943 Ang O(46) at 13.456 27.145 54.578 in (null):N-9999 (6) and OE1(67) at 13.932 27.4652 52.3926 in (null):Q-9999 (10) neighbor-bump: 2.5661 Ang C(56) at 14.926 22.239 52.018 in (null):A-9999 (8) and CB(59) at 14.2018 21.4135 49.6987 in (null):A-9999 (9) T0159 19 :IDKKTAD 1cl1A 16 :SKKYTLG Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 9 residues self-bump: 1.39603 Ang CA(49) at 18.76 34.014 43.987 in (null):D-9999 (7) and CB(50) at 19.093 35.146 43.2409 in (null):D-9999 (7) T0159 28 :KITNIAQ 1cl1A 23 :AVNSVIQ Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 9 residues T0159 38 :PKIAKLFD 1cl1A 30 :RASSLVFD Fragment has 12 clashes (null) has 12 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 10 residues other bump:3.06408 Ang CD(13) at 12.8155 21.5204 29.8712 in (null):K-9999 (2) and CG(34) at 14.3732 19.0316 30.7477 in (null):K-9999 (5) other bump:2.55777 Ang CE(14) at 13.4525 21.3088 28.5114 in (null):K-9999 (2) and CA(32) at 15.077 19.341 28.336 in (null):K-9999 (5) other bump:2.5111 Ang NZ(15) at 14.8427 21.8379 28.4624 in (null):K-9999 (2) and CA(32) at 15.077 19.341 28.336 in (null):K-9999 (5) other bump:3.16599 Ang CG(12) at 11.4067 21.0014 29.8666 in (null):K-9999 (2) and C(30) at 12.753 19.308 27.555 in (null):A-9999 (4) other bump:2.32533 Ang CE(14) at 13.4525 21.3088 28.5114 in (null):K-9999 (2) and C(30) at 12.753 19.308 27.555 in (null):A-9999 (4) other bump:2.2044 Ang CG(12) at 11.4067 21.0014 29.8666 in (null):K-9999 (2) and O(29) at 12.502 20.417 28.045 in (null):A-9999 (4) other bump:2.15661 Ang CD(13) at 12.8155 21.5204 29.8712 in (null):K-9999 (2) and O(29) at 12.502 20.417 28.045 in (null):A-9999 (4) other bump:1.38428 Ang CE(14) at 13.4525 21.3088 28.5114 in (null):K-9999 (2) and O(29) at 12.502 20.417 28.045 in (null):A-9999 (4) neighbor-bump: 2.541 Ang CG1(21) at 8.06319 17.6303 26.9713 in (null):I-9999 (3) and N(26) at 10.385 18.545 27.45 in (null):A-9999 (4) self-bump: 2.21101 Ang CB(20) at 8.05166 17.0811 28.4065 in (null):I-9999 (3) and C(25) at 10.145 17.783 28.524 in (null):I-9999 (3) self-bump: 2.29741 Ang CA(19) at 8.737 17.892 29.152 in (null):I-9999 (3) and CG1(21) at 8.06319 17.6303 26.9713 in (null):I-9999 (3) self-bump: 1.29729 Ang CA(19) at 8.737 17.892 29.152 in (null):I-9999 (3) and CB(20) at 8.05166 17.0811 28.4065 in (null):I-9999 (3) T0159 46 :TNGDGKADLTGCNPGWGCEGAINHQLAAYELTNTVTHNQGNYAAMMADTISRYKEGKPVFYY 1cl1A 46 :TRNRANGELFYGRRGTLTHFSLQQAMCELEGGAGCVLFPCGAAAVANSILAFIEQGDHVLMT Fragment has 45 clashes (null) has 45 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 64 residues other bump:2.1093 Ang CG1(434) at 0.014 -6.549 51 in (null):V-9999 (59) and OH(458) at 0.778562 -4.88599 49.9517 in (null):Y-9999 (61) other bump:1.74085 Ang CG1(434) at 0.014 -6.549 51 in (null):V-9999 (59) and CZ(457) at -0.0605636 -4.81028 51.0431 in (null):Y-9999 (61) other bump:3.03784 Ang CG1(434) at 0.014 -6.549 51 in (null):V-9999 (59) and CE2(456) at -0.29582 -3.60009 51.6606 in (null):Y-9999 (61) other bump:2.39121 Ang CB(433) at 0.042 -7.927 50.318 in (null):V-9999 (59) and CE1(455) at -0.655893 -5.96729 51.4971 in (null):Y-9999 (61) other bump:1.017 Ang CG1(434) at 0.014 -6.549 51 in (null):V-9999 (59) and CE1(455) at -0.655893 -5.96729 51.4971 in (null):Y-9999 (61) other bump:2.28968 Ang CG1(434) at 0.014 -6.549 51 in (null):V-9999 (59) and CD1(453) at -1.5015 -5.91191 52.5937 in (null):Y-9999 (61) neighbor-bump: 2.03116 Ang C(423) at 2.171 -13.008 47.581 in (null):K-9999 (57) and CD(428) at 3.12743 -14.0036 49.0709 in (null):P-9999 (58) other bump:0.77655 Ang CD1(361) at 0.303735 -3.63133 41.6233 in (null):I-9999 (50) and OH(390) at 0.975101 -3.79047 41.267 in (null):Y-9999 (53) other bump:1.76857 Ang CG1(359) at 0.784284 -2.21858 42.0548 in (null):I-9999 (50) and OH(390) at 0.975101 -3.79047 41.267 in (null):Y-9999 (53) other bump:2.82983 Ang CA(357) at 3.081 -2.854 42.909 in (null):I-9999 (50) and OH(390) at 0.975101 -3.79047 41.267 in (null):Y-9999 (53) other bump:2.56065 Ang CG2(360) at 2.72453 -2.10159 40.4644 in (null):I-9999 (50) and OH(390) at 0.975101 -3.79047 41.267 in (null):Y-9999 (53) other bump:2.35969 Ang CB(358) at 2.27117 -1.92127 41.895 in (null):I-9999 (50) and OH(390) at 0.975101 -3.79047 41.267 in (null):Y-9999 (53) other bump:1.76187 Ang CD1(361) at 0.303735 -3.63133 41.6233 in (null):I-9999 (50) and CZ(389) at 1.62769 -4.70993 42.0569 in (null):Y-9999 (53) other bump:2.63024 Ang CG1(359) at 0.784284 -2.21858 42.0548 in (null):I-9999 (50) and CZ(389) at 1.62769 -4.70993 42.0569 in (null):Y-9999 (53) other bump:2.50653 Ang CA(357) at 3.081 -2.854 42.909 in (null):I-9999 (50) and CZ(389) at 1.62769 -4.70993 42.0569 in (null):Y-9999 (53) other bump:2.86651 Ang CB(358) at 2.27117 -1.92127 41.895 in (null):I-9999 (50) and CZ(389) at 1.62769 -4.70993 42.0569 in (null):Y-9999 (53) other bump:2.59265 Ang CD1(361) at 0.303735 -3.63133 41.6233 in (null):I-9999 (50) and CE2(388) at 2.23111 -4.2849 43.2295 in (null):Y-9999 (53) other bump:2.78264 Ang CG1(359) at 0.784284 -2.21858 42.0548 in (null):I-9999 (50) and CE2(388) at 2.23111 -4.2849 43.2295 in (null):Y-9999 (53) other bump:1.69486 Ang CA(357) at 3.081 -2.854 42.909 in (null):I-9999 (50) and CE2(388) at 2.23111 -4.2849 43.2295 in (null):Y-9999 (53) other bump:2.7662 Ang C(363) at 4.563 -2.97 42.533 in (null):I-9999 (50) and CE2(388) at 2.23111 -4.2849 43.2295 in (null):Y-9999 (53) other bump:2.35461 Ang N(356) at 2.87 -2.247 44.221 in (null):I-9999 (50) and CE2(388) at 2.23111 -4.2849 43.2295 in (null):Y-9999 (53) other bump:2.71464 Ang CB(358) at 2.27117 -1.92127 41.895 in (null):I-9999 (50) and CE2(388) at 2.23111 -4.2849 43.2295 in (null):Y-9999 (53) other bump:2.8722 Ang C(355) at 3.424 -2.731 45.33 in (null):T-9999 (49) and CE2(388) at 2.23111 -4.2849 43.2295 in (null):Y-9999 (53) other bump:2.782 Ang CD1(361) at 0.303735 -3.63133 41.6233 in (null):I-9999 (50) and CE1(387) at 1.6921 -6.04154 41.6768 in (null):Y-9999 (53) other bump:2.60234 Ang CA(357) at 3.081 -2.854 42.909 in (null):I-9999 (50) and CD2(386) at 2.90337 -5.19851 44.0243 in (null):Y-9999 (53) other bump:3.15351 Ang C(363) at 4.563 -2.97 42.533 in (null):I-9999 (50) and CD2(386) at 2.90337 -5.19851 44.0243 in (null):Y-9999 (53) other bump:2.36566 Ang O(354) at 4.192 -3.704 45.329 in (null):T-9999 (49) and CD2(386) at 2.90337 -5.19851 44.0243 in (null):Y-9999 (53) other bump:2.83981 Ang C(355) at 3.424 -2.731 45.33 in (null):T-9999 (49) and CD2(386) at 2.90337 -5.19851 44.0243 in (null):Y-9999 (53) other bump:3.08106 Ang CG(272) at 1.58495 8.58009 43.1014 in (null):N-9999 (38) and N(315) at 0.56 6.735 45.346 in (null):A-9999 (44) other bump:3.18698 Ang CG(272) at 1.58495 8.58009 43.1014 in (null):N-9999 (38) and C(314) at 0.148 6.004 44.308 in (null):A-9999 (43) other bump:2.92532 Ang CD(281) at -1.04913 9.27327 40.2464 in (null):Q-9999 (39) and CB(312) at -0.861 7.51 42.573 in (null):A-9999 (43) other bump:2.90919 Ang OE1(282) at 0.177967 9.11626 40.3812 in (null):Q-9999 (39) and CB(312) at -0.861 7.51 42.573 in (null):A-9999 (43) other bump:2.0389 Ang OD1(274) at 0.439878 9.01053 43.0348 in (null):N-9999 (38) and CB(312) at -0.861 7.51 42.573 in (null):A-9999 (43) other bump:2.72158 Ang CG(272) at 1.58495 8.58009 43.1014 in (null):N-9999 (38) and CB(312) at -0.861 7.51 42.573 in (null):A-9999 (43) other bump:2.57665 Ang CG(152) at 12.3443 14.2522 44.6608 in (null):N-9999 (23) and NE2(266) at 9.79961 14.6513 44.7268 in (null):H-9999 (37) other bump:1.61263 Ang OD1(154) at 11.2225 13.9986 45.1139 in (null):N-9999 (23) and NE2(266) at 9.79961 14.6513 44.7268 in (null):H-9999 (37) other bump:2.75489 Ang OD1(154) at 11.2225 13.9986 45.1139 in (null):N-9999 (23) and CE1(265) at 8.734 15.1658 45.2989 in (null):H-9999 (37) other bump:2.2547 Ang OD1(154) at 11.2225 13.9986 45.1139 in (null):N-9999 (23) and CD2(263) at 9.40846 13.7015 43.8082 in (null):H-9999 (37) other bump:2.92997 Ang CG(170) at 12.0202 20.0357 52.2275 in (null):Q-9999 (25) and CZ(202) at 12.5393 20.436 55.0832 in (null):Y-9999 (29) other bump:2.10072 Ang CG(170) at 12.0202 20.0357 52.2275 in (null):Q-9999 (25) and CE1(200) at 12.5663 19.4039 54.1551 in (null):Y-9999 (29) other bump:2.59264 Ang O(174) at 13.343 17.107 53.237 in (null):Q-9999 (25) and CE1(200) at 12.5663 19.4039 54.1551 in (null):Y-9999 (29) other bump:3.09508 Ang C(175) at 13.177 17.247 52.021 in (null):Q-9999 (25) and CE1(200) at 12.5663 19.4039 54.1551 in (null):Y-9999 (29) other bump:1.93429 Ang O(174) at 13.343 17.107 53.237 in (null):Q-9999 (25) and CD1(198) at 12.3587 18.0922 54.5794 in (null):Y-9999 (29) other bump:2.83094 Ang CD1(103) at 12.0853 22.8478 37.3783 in (null):W-9999 (16) and N(117) at 12.622 21.959 40.012 in (null):C-9999 (18) neighbor-bump: 2.47222 Ang C(41) at 20.743 12.675 39.72 in (null):K-9999 (6) and CB(44) at 20.5515 14.7296 41.0815 in (null):A-9999 (7) T0159 108 :TWTP 1cl1A 131 :WFDP Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 6 residues neighbor-bump: 3.17074 Ang CE3(16) at -1.47735 -5.81308 62.93 in (null):W-9999 (2) and C(29) at -4.281 -5.348 64.336 in (null):T-9999 (3) neighbor-bump: 2.38563 Ang CE3(16) at -1.47735 -5.81308 62.93 in (null):W-9999 (2) and O(28) at -3.172 -5.796 64.609 in (null):T-9999 (3) T0159 112 :YWVSNELKPGKDVVWLQVPFSALPGDKNADTKLP 1cl1A 138 :ADIVKHLQPNTKIVFLESPGSITMEVHDVPAIVA Fragment has 38 clashes (null) has 38 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 36 residues other bump:1.61687 Ang O(239) at 9.654 -4.014 66.866 in (null):D-9999 (30) and CD(269) at 10.1859 -5.06062 65.7542 in (null):P-9999 (34) other bump:2.80002 Ang C(240) at 8.892 -3.195 67.393 in (null):D-9999 (30) and CD(269) at 10.1859 -5.06062 65.7542 in (null):P-9999 (34) other bump:2.08454 Ang O(239) at 9.654 -4.014 66.866 in (null):D-9999 (30) and CG(268) at 11.2283 -5.37915 66.8097 in (null):P-9999 (34) other bump:3.25102 Ang C(240) at 8.892 -3.195 67.393 in (null):D-9999 (30) and CG(268) at 11.2283 -5.37915 66.8097 in (null):P-9999 (34) other bump:2.83919 Ang CD1(6) at 6.46272 -7.34786 70.227 in (null):Y-9999 (1) and OG1(245) at 6.72034 -4.53313 70.4952 in (null):T-9999 (31) other bump:2.11387 Ang CE1(8) at 7.55968 -6.47259 70.4457 in (null):Y-9999 (1) and OG1(245) at 6.72034 -4.53313 70.4952 in (null):T-9999 (31) other bump:2.74562 Ang N(2) at 3.887 -8.171 68.592 in (null):Y-9999 (1) and CG2(244) at 5.94612 -6.56494 69.4399 in (null):T-9999 (31) other bump:3.20995 Ang CA(3) at 4.749 -9.309 68.282 in (null):Y-9999 (1) and CG2(244) at 5.94612 -6.56494 69.4399 in (null):T-9999 (31) other bump:2.31248 Ang CG(5) at 6.66826 -8.69867 69.9627 in (null):Y-9999 (1) and CG2(244) at 5.94612 -6.56494 69.4399 in (null):T-9999 (31) other bump:1.22442 Ang CD1(6) at 6.46272 -7.34786 70.227 in (null):Y-9999 (1) and CG2(244) at 5.94612 -6.56494 69.4399 in (null):T-9999 (31) other bump:1.90361 Ang CE1(8) at 7.55968 -6.47259 70.4457 in (null):Y-9999 (1) and CG2(244) at 5.94612 -6.56494 69.4399 in (null):T-9999 (31) other bump:3.08954 Ang CZ(10) at 8.85866 -6.97457 70.3857 in (null):Y-9999 (1) and CG2(244) at 5.94612 -6.56494 69.4399 in (null):T-9999 (31) other bump:2.45803 Ang CD1(6) at 6.46272 -7.34786 70.227 in (null):Y-9999 (1) and CB(243) at 6.30965 -5.10876 69.2245 in (null):T-9999 (31) other bump:2.21676 Ang CE1(8) at 7.55968 -6.47259 70.4457 in (null):Y-9999 (1) and CB(243) at 6.30965 -5.10876 69.2245 in (null):T-9999 (31) other bump:2.64602 Ang CE1(8) at 7.55968 -6.47259 70.4457 in (null):Y-9999 (1) and CA(242) at 7.479 -4.966 68.272 in (null):T-9999 (31) other bump:2.77746 Ang CG2(152) at 0.645959 2.1581 63.1957 in (null):V-9999 (18) and CG(214) at 0.140418 -0.493342 63.8503 in (null):K-9999 (27) other bump:1.99908 Ang CG1(151) at 0.477368 4.01863 64.8127 in (null):V-9999 (18) and OD1(207) at 0.680959 4.85176 66.6184 in (null):D-9999 (26) other bump:2.98518 Ang CG1(151) at 0.477368 4.01863 64.8127 in (null):V-9999 (18) and CG(206) at 0.364698 4.46616 67.762 in (null):D-9999 (26) other bump:3.27604 Ang CG1(151) at 0.477368 4.01863 64.8127 in (null):V-9999 (18) and CA(204) at -1.69 3.138 67.106 in (null):D-9999 (26) neighbor-bump: 2.17799 Ang O(190) at -9.387 4.831 66.357 in (null):L-9999 (23) and CD(196) at -9.08132 6.6396 65.1826 in (null):P-9999 (24) neighbor-bump: 1.67711 Ang C(191) at -9.386 4.991 65.138 in (null):L-9999 (23) and CD(196) at -9.08132 6.6396 65.1826 in (null):P-9999 (24) self-bump: 2.11423 Ang CA(193) at -7.105 5.889 65.156 in (null):P-9999 (24) and CD(196) at -9.08132 6.6396 65.1826 in (null):P-9999 (24) self-bump: 2.21117 Ang N(192) at -8.313 5.409 64.472 in (null):P-9999 (24) and CG(195) at -8.30584 7.61647 64.3443 in (null):P-9999 (24) other bump:1.04939 Ang O(56) at 0.732 -14.199 57.798 in (null):E-9999 (6) and NZ(92) at 1.01981 -14.5272 56.8437 in (null):K-9999 (11) other bump:2.16516 Ang C(57) at 1.084 -14.213 58.985 in (null):E-9999 (6) and NZ(92) at 1.01981 -14.5272 56.8437 in (null):K-9999 (11) other bump:2.81656 Ang C(65) at 3.503 -15.621 57.599 in (null):L-9999 (7) and NZ(92) at 1.01981 -14.5272 56.8437 in (null):K-9999 (11) other bump:2.55253 Ang CB(68) at 2.73628 -16.6576 54.3669 in (null):K-9999 (8) and CE(91) at 2.26786 -14.8446 56.1016 in (null):K-9999 (11) other bump:2.68051 Ang CG(69) at 1.3458 -17.0307 54.8542 in (null):K-9999 (8) and CE(91) at 2.26786 -14.8446 56.1016 in (null):K-9999 (11) other bump:2.3777 Ang O(56) at 0.732 -14.199 57.798 in (null):E-9999 (6) and CE(91) at 2.26786 -14.8446 56.1016 in (null):K-9999 (11) other bump:2.51227 Ang CA(67) at 3.805 -16.718 55.439 in (null):K-9999 (8) and CE(91) at 2.26786 -14.8446 56.1016 in (null):K-9999 (11) other bump:2.59366 Ang CA(59) at 3.429 -14.296 58.355 in (null):L-9999 (7) and CE(91) at 2.26786 -14.8446 56.1016 in (null):K-9999 (11) other bump:2.0906 Ang C(65) at 3.503 -15.621 57.599 in (null):L-9999 (7) and CE(91) at 2.26786 -14.8446 56.1016 in (null):K-9999 (11) other bump:1.61572 Ang N(66) at 3.715 -15.538 56.29 in (null):K-9999 (8) and CE(91) at 2.26786 -14.8446 56.1016 in (null):K-9999 (11) other bump:3.21108 Ang CA(67) at 3.805 -16.718 55.439 in (null):K-9999 (8) and CD(90) at 3.11818 -13.6072 55.8414 in (null):K-9999 (11) other bump:2.62476 Ang CA(59) at 3.429 -14.296 58.355 in (null):L-9999 (7) and CD(90) at 3.11818 -13.6072 55.8414 in (null):K-9999 (11) other bump:2.70053 Ang C(65) at 3.503 -15.621 57.599 in (null):L-9999 (7) and CD(90) at 3.11818 -13.6072 55.8414 in (null):K-9999 (11) other bump:2.07018 Ang N(66) at 3.715 -15.538 56.29 in (null):K-9999 (8) and CD(90) at 3.11818 -13.6072 55.8414 in (null):K-9999 (11) other bump:2.95949 Ang N(66) at 3.715 -15.538 56.29 in (null):K-9999 (8) and CG(89) at 3.27136 -13.3452 54.3527 in (null):K-9999 (11) Number of specific fragments= 7 total=90 Number of alignments=25 # Reading fragments from alignment file # T0159 read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1cl1A/T0159-1cl1A-2track-protein-STR-global-adpstyle1.pw.a2m.gz # 1cl1A read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1cl1A/T0159-1cl1A-2track-protein-STR-global-adpstyle1.pw.a2m.gz # found chain 1cl1A in template set T0159 6 :EGVFVNGAAQ 1cl1A 6 :LDTQLVNAGR Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 12 residues other bump:2.25943 Ang O(46) at 13.456 27.145 54.578 in (null):N-9999 (6) and OE1(67) at 13.932 27.4652 52.3926 in (null):Q-9999 (10) neighbor-bump: 2.5661 Ang C(56) at 14.926 22.239 52.018 in (null):A-9999 (8) and CB(59) at 14.2018 21.4135 49.6987 in (null):A-9999 (9) T0159 24 :ADQYKITNIAQLKDPKIAKLFD 1cl1A 16 :SKKYTLGAVNSVIQRASSLVFD Fragment has 25 clashes (null) has 25 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 24 residues other bump:3.06408 Ang CD(126) at 12.8155 21.5204 29.8712 in (null):K-9999 (16) and CG(147) at 14.3732 19.0316 30.7477 in (null):K-9999 (19) other bump:2.55777 Ang CE(127) at 13.4525 21.3088 28.5114 in (null):K-9999 (16) and CA(145) at 15.077 19.341 28.336 in (null):K-9999 (19) other bump:2.5111 Ang NZ(128) at 14.8427 21.8379 28.4624 in (null):K-9999 (16) and CA(145) at 15.077 19.341 28.336 in (null):K-9999 (19) other bump:3.16599 Ang CG(125) at 11.4067 21.0014 29.8666 in (null):K-9999 (16) and C(143) at 12.753 19.308 27.555 in (null):A-9999 (18) other bump:2.32533 Ang CE(127) at 13.4525 21.3088 28.5114 in (null):K-9999 (16) and C(143) at 12.753 19.308 27.555 in (null):A-9999 (18) other bump:2.2044 Ang CG(125) at 11.4067 21.0014 29.8666 in (null):K-9999 (16) and O(142) at 12.502 20.417 28.045 in (null):A-9999 (18) other bump:2.15661 Ang CD(126) at 12.8155 21.5204 29.8712 in (null):K-9999 (16) and O(142) at 12.502 20.417 28.045 in (null):A-9999 (18) other bump:1.38428 Ang CE(127) at 13.4525 21.3088 28.5114 in (null):K-9999 (16) and O(142) at 12.502 20.417 28.045 in (null):A-9999 (18) neighbor-bump: 2.541 Ang CG1(134) at 8.06319 17.6303 26.9713 in (null):I-9999 (17) and N(139) at 10.385 18.545 27.45 in (null):A-9999 (18) self-bump: 2.21101 Ang CB(133) at 8.05166 17.0811 28.4065 in (null):I-9999 (17) and C(138) at 10.145 17.783 28.524 in (null):I-9999 (17) self-bump: 2.29741 Ang CA(132) at 8.737 17.892 29.152 in (null):I-9999 (17) and CG1(134) at 8.06319 17.6303 26.9713 in (null):I-9999 (17) self-bump: 1.29729 Ang CA(132) at 8.737 17.892 29.152 in (null):I-9999 (17) and CB(133) at 8.05166 17.0811 28.4065 in (null):I-9999 (17) other bump:2.82606 Ang CD1(50) at 18.0413 28.2484 38.9061 in (null):I-9999 (6) and CD1(94) at 15.4209 29.257 38.585 in (null):L-9999 (12) other bump:3.18537 Ang CD(40) at 14.6487 28.3714 46.6809 in (null):K-9999 (5) and CA(82) at 12.953 27.294 44.209 in (null):Q-9999 (11) other bump:2.63497 Ang CD(40) at 14.6487 28.3714 46.6809 in (null):K-9999 (5) and N(81) at 12.385 27.865 45.431 in (null):Q-9999 (11) other bump:2.54747 Ang CD(40) at 14.6487 28.3714 46.6809 in (null):K-9999 (5) and C(80) at 12.453 29.173 45.668 in (null):A-9999 (10) other bump:2.65565 Ang CE(41) at 14.1444 29.4005 47.7027 in (null):K-9999 (5) and C(80) at 12.453 29.173 45.668 in (null):A-9999 (10) other bump:1.93862 Ang OD1(65) at 14.1791 31.2541 44.0742 in (null):N-9999 (8) and O(79) at 13.009 29.945 44.896 in (null):A-9999 (10) other bump:3.12925 Ang CD(40) at 14.6487 28.3714 46.6809 in (null):K-9999 (5) and CA(77) at 11.825 29.689 46.969 in (null):A-9999 (10) other bump:2.44971 Ang CE(41) at 14.1444 29.4005 47.7027 in (null):K-9999 (5) and CA(77) at 11.825 29.689 46.969 in (null):A-9999 (10) other bump:2.40386 Ang CE(41) at 14.1444 29.4005 47.7027 in (null):K-9999 (5) and N(76) at 12.379 30.988 47.326 in (null):A-9999 (10) other bump:1.93602 Ang CE(41) at 14.1444 29.4005 47.7027 in (null):K-9999 (5) and C(75) at 13.385 31.114 48.188 in (null):I-9999 (9) other bump:2.46851 Ang NZ(42) at 14.8204 29.2971 49.0437 in (null):K-9999 (5) and C(75) at 13.385 31.114 48.188 in (null):I-9999 (9) other bump:1.27142 Ang CE(41) at 14.1444 29.4005 47.7027 in (null):K-9999 (5) and O(74) at 13.943 30.147 48.712 in (null):I-9999 (9) other bump:1.26574 Ang NZ(42) at 14.8204 29.2971 49.0437 in (null):K-9999 (5) and O(74) at 13.943 30.147 48.712 in (null):I-9999 (9) T0159 46 :TNGDGKADLTGCNPGWGCEGAINHQLAAYELTNTVTHNQGNYAAMMADTISRYKEGKPVFYY 1cl1A 46 :TRNRANGELFYGRRGTLTHFSLQQAMCELEGGAGCVLFPCGAAAVANSILAFIEQGDHVLMT Fragment has 45 clashes (null) has 45 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 64 residues other bump:2.1093 Ang CG1(434) at 0.014 -6.549 51 in (null):V-9999 (59) and OH(458) at 0.778562 -4.88599 49.9517 in (null):Y-9999 (61) other bump:1.74085 Ang CG1(434) at 0.014 -6.549 51 in (null):V-9999 (59) and CZ(457) at -0.0605636 -4.81028 51.0431 in (null):Y-9999 (61) other bump:3.03784 Ang CG1(434) at 0.014 -6.549 51 in (null):V-9999 (59) and CE2(456) at -0.29582 -3.60009 51.6606 in (null):Y-9999 (61) other bump:2.39121 Ang CB(433) at 0.042 -7.927 50.318 in (null):V-9999 (59) and CE1(455) at -0.655893 -5.96729 51.4971 in (null):Y-9999 (61) other bump:1.017 Ang CG1(434) at 0.014 -6.549 51 in (null):V-9999 (59) and CE1(455) at -0.655893 -5.96729 51.4971 in (null):Y-9999 (61) other bump:2.28968 Ang CG1(434) at 0.014 -6.549 51 in (null):V-9999 (59) and CD1(453) at -1.5015 -5.91191 52.5937 in (null):Y-9999 (61) neighbor-bump: 2.03116 Ang C(423) at 2.171 -13.008 47.581 in (null):K-9999 (57) and CD(428) at 3.12743 -14.0036 49.0709 in (null):P-9999 (58) other bump:0.77655 Ang CD1(361) at 0.303735 -3.63133 41.6233 in (null):I-9999 (50) and OH(390) at 0.975101 -3.79047 41.267 in (null):Y-9999 (53) other bump:1.76857 Ang CG1(359) at 0.784284 -2.21858 42.0548 in (null):I-9999 (50) and OH(390) at 0.975101 -3.79047 41.267 in (null):Y-9999 (53) other bump:2.82983 Ang CA(357) at 3.081 -2.854 42.909 in (null):I-9999 (50) and OH(390) at 0.975101 -3.79047 41.267 in (null):Y-9999 (53) other bump:2.56065 Ang CG2(360) at 2.72453 -2.10159 40.4644 in (null):I-9999 (50) and OH(390) at 0.975101 -3.79047 41.267 in (null):Y-9999 (53) other bump:2.35969 Ang CB(358) at 2.27117 -1.92127 41.895 in (null):I-9999 (50) and OH(390) at 0.975101 -3.79047 41.267 in (null):Y-9999 (53) other bump:1.76187 Ang CD1(361) at 0.303735 -3.63133 41.6233 in (null):I-9999 (50) and CZ(389) at 1.62769 -4.70993 42.0569 in (null):Y-9999 (53) other bump:2.63024 Ang CG1(359) at 0.784284 -2.21858 42.0548 in (null):I-9999 (50) and CZ(389) at 1.62769 -4.70993 42.0569 in (null):Y-9999 (53) other bump:2.50653 Ang CA(357) at 3.081 -2.854 42.909 in (null):I-9999 (50) and CZ(389) at 1.62769 -4.70993 42.0569 in (null):Y-9999 (53) other bump:2.86651 Ang CB(358) at 2.27117 -1.92127 41.895 in (null):I-9999 (50) and CZ(389) at 1.62769 -4.70993 42.0569 in (null):Y-9999 (53) other bump:2.59265 Ang CD1(361) at 0.303735 -3.63133 41.6233 in (null):I-9999 (50) and CE2(388) at 2.23111 -4.2849 43.2295 in (null):Y-9999 (53) other bump:2.78264 Ang CG1(359) at 0.784284 -2.21858 42.0548 in (null):I-9999 (50) and CE2(388) at 2.23111 -4.2849 43.2295 in (null):Y-9999 (53) other bump:1.69486 Ang CA(357) at 3.081 -2.854 42.909 in (null):I-9999 (50) and CE2(388) at 2.23111 -4.2849 43.2295 in (null):Y-9999 (53) other bump:2.7662 Ang C(363) at 4.563 -2.97 42.533 in (null):I-9999 (50) and CE2(388) at 2.23111 -4.2849 43.2295 in (null):Y-9999 (53) other bump:2.35461 Ang N(356) at 2.87 -2.247 44.221 in (null):I-9999 (50) and CE2(388) at 2.23111 -4.2849 43.2295 in (null):Y-9999 (53) other bump:2.71464 Ang CB(358) at 2.27117 -1.92127 41.895 in (null):I-9999 (50) and CE2(388) at 2.23111 -4.2849 43.2295 in (null):Y-9999 (53) other bump:2.8722 Ang C(355) at 3.424 -2.731 45.33 in (null):T-9999 (49) and CE2(388) at 2.23111 -4.2849 43.2295 in (null):Y-9999 (53) other bump:2.782 Ang CD1(361) at 0.303735 -3.63133 41.6233 in (null):I-9999 (50) and CE1(387) at 1.6921 -6.04154 41.6768 in (null):Y-9999 (53) other bump:2.60234 Ang CA(357) at 3.081 -2.854 42.909 in (null):I-9999 (50) and CD2(386) at 2.90337 -5.19851 44.0243 in (null):Y-9999 (53) other bump:3.15351 Ang C(363) at 4.563 -2.97 42.533 in (null):I-9999 (50) and CD2(386) at 2.90337 -5.19851 44.0243 in (null):Y-9999 (53) other bump:2.36566 Ang O(354) at 4.192 -3.704 45.329 in (null):T-9999 (49) and CD2(386) at 2.90337 -5.19851 44.0243 in (null):Y-9999 (53) other bump:2.83981 Ang C(355) at 3.424 -2.731 45.33 in (null):T-9999 (49) and CD2(386) at 2.90337 -5.19851 44.0243 in (null):Y-9999 (53) other bump:3.08106 Ang CG(272) at 1.58495 8.58009 43.1014 in (null):N-9999 (38) and N(315) at 0.56 6.735 45.346 in (null):A-9999 (44) other bump:3.18698 Ang CG(272) at 1.58495 8.58009 43.1014 in (null):N-9999 (38) and C(314) at 0.148 6.004 44.308 in (null):A-9999 (43) other bump:2.92532 Ang CD(281) at -1.04913 9.27327 40.2464 in (null):Q-9999 (39) and CB(312) at -0.861 7.51 42.573 in (null):A-9999 (43) other bump:2.90919 Ang OE1(282) at 0.177967 9.11626 40.3812 in (null):Q-9999 (39) and CB(312) at -0.861 7.51 42.573 in (null):A-9999 (43) other bump:2.0389 Ang OD1(274) at 0.439878 9.01053 43.0348 in (null):N-9999 (38) and CB(312) at -0.861 7.51 42.573 in (null):A-9999 (43) other bump:2.72158 Ang CG(272) at 1.58495 8.58009 43.1014 in (null):N-9999 (38) and CB(312) at -0.861 7.51 42.573 in (null):A-9999 (43) other bump:2.57665 Ang CG(152) at 12.3443 14.2522 44.6608 in (null):N-9999 (23) and NE2(266) at 9.79961 14.6513 44.7268 in (null):H-9999 (37) other bump:1.61263 Ang OD1(154) at 11.2225 13.9986 45.1139 in (null):N-9999 (23) and NE2(266) at 9.79961 14.6513 44.7268 in (null):H-9999 (37) other bump:2.75489 Ang OD1(154) at 11.2225 13.9986 45.1139 in (null):N-9999 (23) and CE1(265) at 8.734 15.1658 45.2989 in (null):H-9999 (37) other bump:2.2547 Ang OD1(154) at 11.2225 13.9986 45.1139 in (null):N-9999 (23) and CD2(263) at 9.40846 13.7015 43.8082 in (null):H-9999 (37) other bump:2.92997 Ang CG(170) at 12.0202 20.0357 52.2275 in (null):Q-9999 (25) and CZ(202) at 12.5393 20.436 55.0832 in (null):Y-9999 (29) other bump:2.10072 Ang CG(170) at 12.0202 20.0357 52.2275 in (null):Q-9999 (25) and CE1(200) at 12.5663 19.4039 54.1551 in (null):Y-9999 (29) other bump:2.59264 Ang O(174) at 13.343 17.107 53.237 in (null):Q-9999 (25) and CE1(200) at 12.5663 19.4039 54.1551 in (null):Y-9999 (29) other bump:3.09508 Ang C(175) at 13.177 17.247 52.021 in (null):Q-9999 (25) and CE1(200) at 12.5663 19.4039 54.1551 in (null):Y-9999 (29) other bump:1.93429 Ang O(174) at 13.343 17.107 53.237 in (null):Q-9999 (25) and CD1(198) at 12.3587 18.0922 54.5794 in (null):Y-9999 (29) other bump:2.83094 Ang CD1(103) at 12.0853 22.8478 37.3783 in (null):W-9999 (16) and N(117) at 12.622 21.959 40.012 in (null):C-9999 (18) neighbor-bump: 2.47222 Ang C(41) at 20.743 12.675 39.72 in (null):K-9999 (6) and CB(44) at 20.5515 14.7296 41.0815 in (null):A-9999 (7) T0159 108 :TWTP 1cl1A 131 :WFDP Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 6 residues neighbor-bump: 3.17074 Ang CE3(16) at -1.47735 -5.81308 62.93 in (null):W-9999 (2) and C(29) at -4.281 -5.348 64.336 in (null):T-9999 (3) neighbor-bump: 2.38563 Ang CE3(16) at -1.47735 -5.81308 62.93 in (null):W-9999 (2) and O(28) at -3.172 -5.796 64.609 in (null):T-9999 (3) T0159 112 :YWVSNELKPGKDVVWLQVPFSALPGDKNADTKL 1cl1A 138 :ADIVKHLQPNTKIVFLESPGSITMEVHDVPAIV Fragment has 34 clashes (null) has 34 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 35 residues other bump:2.83919 Ang CD1(6) at 6.46272 -7.34786 70.227 in (null):Y-9999 (1) and OG1(245) at 6.72034 -4.53313 70.4952 in (null):T-9999 (31) other bump:2.11387 Ang CE1(8) at 7.55968 -6.47259 70.4457 in (null):Y-9999 (1) and OG1(245) at 6.72034 -4.53313 70.4952 in (null):T-9999 (31) other bump:2.74562 Ang N(2) at 3.887 -8.171 68.592 in (null):Y-9999 (1) and CG2(244) at 5.94612 -6.56494 69.4399 in (null):T-9999 (31) other bump:3.20995 Ang CA(3) at 4.749 -9.309 68.282 in (null):Y-9999 (1) and CG2(244) at 5.94612 -6.56494 69.4399 in (null):T-9999 (31) other bump:2.31248 Ang CG(5) at 6.66826 -8.69867 69.9627 in (null):Y-9999 (1) and CG2(244) at 5.94612 -6.56494 69.4399 in (null):T-9999 (31) other bump:1.22442 Ang CD1(6) at 6.46272 -7.34786 70.227 in (null):Y-9999 (1) and CG2(244) at 5.94612 -6.56494 69.4399 in (null):T-9999 (31) other bump:1.90361 Ang CE1(8) at 7.55968 -6.47259 70.4457 in (null):Y-9999 (1) and CG2(244) at 5.94612 -6.56494 69.4399 in (null):T-9999 (31) other bump:3.08954 Ang CZ(10) at 8.85866 -6.97457 70.3857 in (null):Y-9999 (1) and CG2(244) at 5.94612 -6.56494 69.4399 in (null):T-9999 (31) other bump:2.45803 Ang CD1(6) at 6.46272 -7.34786 70.227 in (null):Y-9999 (1) and CB(243) at 6.30965 -5.10876 69.2245 in (null):T-9999 (31) other bump:2.21676 Ang CE1(8) at 7.55968 -6.47259 70.4457 in (null):Y-9999 (1) and CB(243) at 6.30965 -5.10876 69.2245 in (null):T-9999 (31) other bump:2.64602 Ang CE1(8) at 7.55968 -6.47259 70.4457 in (null):Y-9999 (1) and CA(242) at 7.479 -4.966 68.272 in (null):T-9999 (31) other bump:2.77746 Ang CG2(152) at 0.645959 2.1581 63.1957 in (null):V-9999 (18) and CG(214) at 0.140418 -0.493342 63.8503 in (null):K-9999 (27) other bump:1.99908 Ang CG1(151) at 0.477368 4.01863 64.8127 in (null):V-9999 (18) and OD1(207) at 0.680959 4.85176 66.6184 in (null):D-9999 (26) other bump:2.98518 Ang CG1(151) at 0.477368 4.01863 64.8127 in (null):V-9999 (18) and CG(206) at 0.364698 4.46616 67.762 in (null):D-9999 (26) other bump:3.27604 Ang CG1(151) at 0.477368 4.01863 64.8127 in (null):V-9999 (18) and CA(204) at -1.69 3.138 67.106 in (null):D-9999 (26) neighbor-bump: 2.17799 Ang O(190) at -9.387 4.831 66.357 in (null):L-9999 (23) and CD(196) at -9.08132 6.6396 65.1826 in (null):P-9999 (24) neighbor-bump: 1.67711 Ang C(191) at -9.386 4.991 65.138 in (null):L-9999 (23) and CD(196) at -9.08132 6.6396 65.1826 in (null):P-9999 (24) self-bump: 2.11423 Ang CA(193) at -7.105 5.889 65.156 in (null):P-9999 (24) and CD(196) at -9.08132 6.6396 65.1826 in (null):P-9999 (24) self-bump: 2.21117 Ang N(192) at -8.313 5.409 64.472 in (null):P-9999 (24) and CG(195) at -8.30584 7.61647 64.3443 in (null):P-9999 (24) other bump:1.04939 Ang O(56) at 0.732 -14.199 57.798 in (null):E-9999 (6) and NZ(92) at 1.01981 -14.5272 56.8437 in (null):K-9999 (11) other bump:2.16516 Ang C(57) at 1.084 -14.213 58.985 in (null):E-9999 (6) and NZ(92) at 1.01981 -14.5272 56.8437 in (null):K-9999 (11) other bump:2.81656 Ang C(65) at 3.503 -15.621 57.599 in (null):L-9999 (7) and NZ(92) at 1.01981 -14.5272 56.8437 in (null):K-9999 (11) other bump:2.55253 Ang CB(68) at 2.73628 -16.6576 54.3669 in (null):K-9999 (8) and CE(91) at 2.26786 -14.8446 56.1016 in (null):K-9999 (11) other bump:2.68051 Ang CG(69) at 1.3458 -17.0307 54.8542 in (null):K-9999 (8) and CE(91) at 2.26786 -14.8446 56.1016 in (null):K-9999 (11) other bump:2.3777 Ang O(56) at 0.732 -14.199 57.798 in (null):E-9999 (6) and CE(91) at 2.26786 -14.8446 56.1016 in (null):K-9999 (11) other bump:2.59366 Ang CA(59) at 3.429 -14.296 58.355 in (null):L-9999 (7) and CE(91) at 2.26786 -14.8446 56.1016 in (null):K-9999 (11) other bump:2.0906 Ang C(65) at 3.503 -15.621 57.599 in (null):L-9999 (7) and CE(91) at 2.26786 -14.8446 56.1016 in (null):K-9999 (11) other bump:2.51227 Ang CA(67) at 3.805 -16.718 55.439 in (null):K-9999 (8) and CE(91) at 2.26786 -14.8446 56.1016 in (null):K-9999 (11) other bump:1.61572 Ang N(66) at 3.715 -15.538 56.29 in (null):K-9999 (8) and CE(91) at 2.26786 -14.8446 56.1016 in (null):K-9999 (11) other bump:2.62476 Ang CA(59) at 3.429 -14.296 58.355 in (null):L-9999 (7) and CD(90) at 3.11818 -13.6072 55.8414 in (null):K-9999 (11) other bump:2.70053 Ang C(65) at 3.503 -15.621 57.599 in (null):L-9999 (7) and CD(90) at 3.11818 -13.6072 55.8414 in (null):K-9999 (11) other bump:3.21108 Ang CA(67) at 3.805 -16.718 55.439 in (null):K-9999 (8) and CD(90) at 3.11818 -13.6072 55.8414 in (null):K-9999 (11) other bump:2.07018 Ang N(66) at 3.715 -15.538 56.29 in (null):K-9999 (8) and CD(90) at 3.11818 -13.6072 55.8414 in (null):K-9999 (11) other bump:2.95949 Ang N(66) at 3.715 -15.538 56.29 in (null):K-9999 (8) and CG(89) at 3.27136 -13.3452 54.3527 in (null):K-9999 (11) Number of specific fragments= 5 total=95 Number of alignments=26 # Reading fragments from alignment file # T0159 read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1cl2A/T0159-1cl2A-2track-protein-STR-global-adpstyle1.pw.a2m.gz # 1cl2A read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1cl2A/T0159-1cl2A-2track-protein-STR-global-adpstyle1.pw.a2m.gz # found chain 1cl2A in template set T0159 6 :EGVFVNGAAQ 1cl2A 6 :LDTQLVNAGR Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 12 residues other bump:1.94415 Ang O(46) at 13.337 26.835 54.151 in (null):N-9999 (6) and OE1(67) at 14.1518 27.0723 52.4018 in (null):Q-9999 (10) neighbor-bump: 2.59367 Ang C(56) at 14.888 22.178 51.588 in (null):A-9999 (8) and CB(59) at 14.1386 21.2638 49.2794 in (null):A-9999 (9) T0159 24 :ADQYKITNIAQLKDPKIAKLFD 1cl2A 16 :SKKYTLGAVNSVIQRASSLVFD Fragment has 29 clashes (null) has 29 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 24 residues other bump:2.95366 Ang CD(126) at 12.8329 21.3929 29.6385 in (null):K-9999 (16) and CG(147) at 14.3414 19.015 30.5296 in (null):K-9999 (19) other bump:2.46956 Ang CE(127) at 13.4688 21.1722 28.2795 in (null):K-9999 (16) and CA(145) at 15.058 19.289 28.117 in (null):K-9999 (19) other bump:2.39326 Ang NZ(128) at 14.87 21.6719 28.2358 in (null):K-9999 (16) and CA(145) at 15.058 19.289 28.117 in (null):K-9999 (19) other bump:2.67841 Ang CE(127) at 13.4688 21.1722 28.2795 in (null):K-9999 (16) and N(144) at 13.919 18.664 27.455 in (null):K-9999 (19) other bump:3.10795 Ang CG(125) at 11.4134 20.9039 29.6286 in (null):K-9999 (16) and C(143) at 12.722 19.251 27.345 in (null):A-9999 (18) other bump:3.14009 Ang CD(126) at 12.8329 21.3929 29.6385 in (null):K-9999 (16) and C(143) at 12.722 19.251 27.345 in (null):A-9999 (18) other bump:2.26322 Ang CE(127) at 13.4688 21.1722 28.2795 in (null):K-9999 (16) and C(143) at 12.722 19.251 27.345 in (null):A-9999 (18) other bump:2.0787 Ang CG(125) at 11.4134 20.9039 29.6286 in (null):K-9999 (16) and O(142) at 12.418 20.317 27.906 in (null):A-9999 (18) other bump:2.08117 Ang CD(126) at 12.8329 21.3929 29.6385 in (null):K-9999 (16) and O(142) at 12.418 20.317 27.906 in (null):A-9999 (18) other bump:1.40537 Ang CE(127) at 13.4688 21.1722 28.2795 in (null):K-9999 (16) and O(142) at 12.418 20.317 27.906 in (null):A-9999 (18) neighbor-bump: 2.46562 Ang CG1(134) at 8.12876 17.535 26.746 in (null):I-9999 (17) and N(139) at 10.367 18.47 27.188 in (null):A-9999 (18) self-bump: 2.17653 Ang CB(133) at 8.11586 17.0129 28.1914 in (null):I-9999 (17) and C(138) at 10.152 17.773 28.308 in (null):I-9999 (17) self-bump: 2.28323 Ang CA(132) at 8.747 17.852 28.921 in (null):I-9999 (17) and CG1(134) at 8.12876 17.535 26.746 in (null):I-9999 (17) self-bump: 1.27859 Ang CA(132) at 8.747 17.852 28.921 in (null):I-9999 (17) and CB(133) at 8.11586 17.0129 28.1914 in (null):I-9999 (17) other bump:2.67307 Ang CD1(50) at 17.832 28.2648 38.6093 in (null):I-9999 (6) and CD1(94) at 15.3776 29.2951 38.3651 in (null):L-9999 (12) other bump:3.29985 Ang CD(40) at 14.6991 28.2291 46.5019 in (null):K-9999 (5) and CA(82) at 12.865 27.21 43.955 in (null):Q-9999 (11) other bump:2.82582 Ang CD(40) at 14.6991 28.2291 46.5019 in (null):K-9999 (5) and N(81) at 12.25 27.773 45.168 in (null):Q-9999 (11) other bump:2.69976 Ang CD(40) at 14.6991 28.2291 46.5019 in (null):K-9999 (5) and C(80) at 12.351 29.067 45.466 in (null):A-9999 (10) other bump:2.7958 Ang CE(41) at 14.2158 29.251 47.5408 in (null):K-9999 (5) and C(80) at 12.351 29.067 45.466 in (null):A-9999 (10) other bump:1.86856 Ang OD1(65) at 14.245 30.9525 43.9225 in (null):N-9999 (8) and O(79) at 13.011 29.838 44.775 in (null):A-9999 (10) other bump:2.69763 Ang CG(63) at 13.7258 31.9671 43.2806 in (null):N-9999 (8) and O(79) at 13.011 29.838 44.775 in (null):A-9999 (10) other bump:2.68405 Ang CE(41) at 14.2158 29.251 47.5408 in (null):K-9999 (5) and CA(77) at 11.669 29.565 46.754 in (null):A-9999 (10) other bump:2.58384 Ang CE(41) at 14.2158 29.251 47.5408 in (null):K-9999 (5) and N(76) at 12.232 30.857 47.139 in (null):A-9999 (10) other bump:1.96107 Ang CE(41) at 14.2158 29.251 47.5408 in (null):K-9999 (5) and C(75) at 13.309 30.948 47.92 in (null):I-9999 (9) other bump:2.59795 Ang NZ(42) at 14.9333 29.1517 48.8605 in (null):K-9999 (5) and C(75) at 13.309 30.948 47.92 in (null):I-9999 (9) other bump:2.68175 Ang CD(40) at 14.6991 28.2291 46.5019 in (null):K-9999 (5) and O(74) at 13.881 29.963 48.377 in (null):I-9999 (9) other bump:1.14811 Ang CE(41) at 14.2158 29.251 47.5408 in (null):K-9999 (5) and O(74) at 13.881 29.963 48.377 in (null):I-9999 (9) other bump:1.41393 Ang NZ(42) at 14.9333 29.1517 48.8605 in (null):K-9999 (5) and O(74) at 13.881 29.963 48.377 in (null):I-9999 (9) self-bump: 1.38672 Ang CA(69) at 13.825 32.37 48.228 in (null):I-9999 (9) and CB(70) at 13.1608 32.7486 49.3849 in (null):I-9999 (9) T0159 46 :TNGDGKADLTGCNPGWGCEGAINHQLAAYELTNTVTHNQGNYAAMMADTISRYKEGKPVFYY 1cl2A 46 :TRNRANGELFYGRRGTLTHFSLQQAMCELEGGAGCVLFPCGAAAVANSILAFIEQGDHVLMT Fragment has 48 clashes (null) has 48 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 64 residues other bump:2.94264 Ang CG2(435) at 0.845 -7.817 48.738 in (null):V-9999 (59) and OH(458) at 0.866534 -5.023 49.6612 in (null):Y-9999 (61) other bump:2.11232 Ang CG1(434) at -0.154 -6.584 50.653 in (null):V-9999 (59) and OH(458) at 0.866534 -5.023 49.6612 in (null):Y-9999 (61) other bump:1.67341 Ang CG1(434) at -0.154 -6.584 50.653 in (null):V-9999 (59) and CZ(457) at 0.0157418 -4.92157 50.7415 in (null):Y-9999 (61) other bump:2.96484 Ang CG1(434) at -0.154 -6.584 50.653 in (null):V-9999 (59) and CE2(456) at -0.205014 -3.70138 51.3445 in (null):Y-9999 (61) other bump:2.31862 Ang CB(433) at 0.004 -7.942 49.985 in (null):V-9999 (59) and CE1(455) at -0.605924 -6.06319 51.1991 in (null):Y-9999 (61) other bump:3.18341 Ang C(437) at -0.124 -9.021 52.273 in (null):V-9999 (59) and CE1(455) at -0.605924 -6.06319 51.1991 in (null):Y-9999 (61) other bump:0.879614 Ang CG1(434) at -0.154 -6.584 50.653 in (null):V-9999 (59) and CE1(455) at -0.605924 -6.06319 51.1991 in (null):Y-9999 (61) other bump:2.17714 Ang CG1(434) at -0.154 -6.584 50.653 in (null):V-9999 (59) and CD1(453) at -1.46362 -5.98192 52.2847 in (null):Y-9999 (61) neighbor-bump: 2.08464 Ang C(423) at 2.225 -12.971 47.352 in (null):K-9999 (57) and CD(428) at 3.21477 -13.9767 48.8865 in (null):P-9999 (58) other bump:0.670924 Ang CD1(361) at 1.01119 -4.20799 40.7983 in (null):I-9999 (50) and OH(390) at 1.14342 -3.57517 40.9777 in (null):Y-9999 (53) other bump:1.13442 Ang CG1(359) at 2.01719 -3.09289 40.4384 in (null):I-9999 (50) and OH(390) at 1.14342 -3.57517 40.9777 in (null):Y-9999 (53) other bump:2.6979 Ang CA(357) at 3.098 -2.845 42.688 in (null):I-9999 (50) and OH(390) at 1.14342 -3.57517 40.9777 in (null):Y-9999 (53) other bump:1.96184 Ang CB(358) at 2.28618 -2.09625 41.5741 in (null):I-9999 (50) and OH(390) at 1.14342 -3.57517 40.9777 in (null):Y-9999 (53) other bump:1.25045 Ang CD1(361) at 1.01119 -4.20799 40.7983 in (null):I-9999 (50) and CZ(389) at 1.72856 -4.53898 41.7675 in (null):Y-9999 (53) other bump:1.98522 Ang CG1(359) at 2.01719 -3.09289 40.4384 in (null):I-9999 (50) and CZ(389) at 1.72856 -4.53898 41.7675 in (null):Y-9999 (53) other bump:2.36478 Ang CA(357) at 3.098 -2.845 42.688 in (null):I-9999 (50) and CZ(389) at 1.72856 -4.53898 41.7675 in (null):Y-9999 (53) other bump:3.26929 Ang C(363) at 4.558 -2.976 42.257 in (null):I-9999 (50) and CZ(389) at 1.72856 -4.53898 41.7675 in (null):Y-9999 (53) other bump:2.51303 Ang CB(358) at 2.28618 -2.09625 41.5741 in (null):I-9999 (50) and CZ(389) at 1.72856 -4.53898 41.7675 in (null):Y-9999 (53) other bump:2.52916 Ang CD1(361) at 1.01119 -4.20799 40.7983 in (null):I-9999 (50) and CE2(388) at 2.3017 -4.16725 42.973 in (null):Y-9999 (53) other bump:2.76761 Ang CG1(359) at 2.01719 -3.09289 40.4384 in (null):I-9999 (50) and CE2(388) at 2.3017 -4.16725 42.973 in (null):Y-9999 (53) other bump:1.56962 Ang CA(357) at 3.098 -2.845 42.688 in (null):I-9999 (50) and CE2(388) at 2.3017 -4.16725 42.973 in (null):Y-9999 (53) other bump:2.65004 Ang C(363) at 4.558 -2.976 42.257 in (null):I-9999 (50) and CE2(388) at 2.3017 -4.16725 42.973 in (null):Y-9999 (53) other bump:2.27822 Ang N(356) at 2.89 -2.219 43.997 in (null):I-9999 (50) and CE2(388) at 2.3017 -4.16725 42.973 in (null):Y-9999 (53) other bump:2.49926 Ang CB(358) at 2.28618 -2.09625 41.5741 in (null):I-9999 (50) and CE2(388) at 2.3017 -4.16725 42.973 in (null):Y-9999 (53) other bump:2.84798 Ang C(355) at 3.437 -2.687 45.125 in (null):T-9999 (49) and CE2(388) at 2.3017 -4.16725 42.973 in (null):Y-9999 (53) other bump:1.89797 Ang CD1(361) at 1.01119 -4.20799 40.7983 in (null):I-9999 (50) and CE1(387) at 1.75616 -5.86234 41.3555 in (null):Y-9999 (53) other bump:2.92899 Ang CG1(359) at 2.01719 -3.09289 40.4384 in (null):I-9999 (50) and CE1(387) at 1.75616 -5.86234 41.3555 in (null):Y-9999 (53) other bump:2.53141 Ang CA(357) at 3.098 -2.845 42.688 in (null):I-9999 (50) and CD2(386) at 2.90651 -5.12613 43.7687 in (null):Y-9999 (53) other bump:3.10412 Ang C(363) at 4.558 -2.976 42.257 in (null):I-9999 (50) and CD2(386) at 2.90651 -5.12613 43.7687 in (null):Y-9999 (53) other bump:2.43712 Ang O(354) at 4.244 -3.624 45.145 in (null):T-9999 (49) and CD2(386) at 2.90651 -5.12613 43.7687 in (null):Y-9999 (53) other bump:2.84084 Ang C(355) at 3.437 -2.687 45.125 in (null):T-9999 (49) and CD2(386) at 2.90651 -5.12613 43.7687 in (null):Y-9999 (53) other bump:3.04103 Ang CG(272) at 1.38323 8.63281 42.9374 in (null):N-9999 (38) and N(315) at 0.551 6.755 45.18 in (null):A-9999 (44) other bump:3.0948 Ang CG(272) at 1.38323 8.63281 42.9374 in (null):N-9999 (38) and C(314) at 0.152 6.051 44.119 in (null):A-9999 (43) other bump:2.66756 Ang ND2(273) at 1.66655 7.44895 42.4256 in (null):N-9999 (38) and C(314) at 0.152 6.051 44.119 in (null):A-9999 (43) other bump:2.03508 Ang OD1(274) at 0.250095 9.09033 42.8503 in (null):N-9999 (38) and CB(312) at -0.893 7.49 42.327 in (null):A-9999 (43) other bump:2.61913 Ang CG(272) at 1.38323 8.63281 42.9374 in (null):N-9999 (38) and CB(312) at -0.893 7.49 42.327 in (null):A-9999 (43) other bump:2.56177 Ang ND2(273) at 1.66655 7.44895 42.4256 in (null):N-9999 (38) and CB(312) at -0.893 7.49 42.327 in (null):A-9999 (43) self-bump: 1.38544 Ang CA(291) at -1.436 9.516 47.829 in (null):N-9999 (41) and CB(292) at -1.54102 9.63218 49.2056 in (null):N-9999 (41) other bump:2.74 Ang CG(152) at 12.3468 14.1988 44.3728 in (null):N-9999 (23) and NE2(266) at 9.64548 14.6098 44.5764 in (null):H-9999 (37) other bump:1.72149 Ang OD1(154) at 11.2167 13.9444 44.8043 in (null):N-9999 (23) and NE2(266) at 9.64548 14.6098 44.5764 in (null):H-9999 (37) other bump:2.90598 Ang OD1(154) at 11.2167 13.9444 44.8043 in (null):N-9999 (23) and CE1(265) at 8.57989 15.1134 45.1581 in (null):H-9999 (37) other bump:2.29625 Ang OD1(154) at 11.2167 13.9444 44.8043 in (null):N-9999 (23) and CD2(263) at 9.25444 13.6748 43.6426 in (null):H-9999 (37) other bump:3.15492 Ang CD1(180) at 8.88579 14.5505 48.8886 in (null):L-9999 (26) and CG1(248) at 10.2806 11.8781 47.9578 in (null):V-9999 (35) other bump:2.24145 Ang CG(170) at 11.9247 19.9309 51.8548 in (null):Q-9999 (25) and CE1(200) at 12.4634 19.451 53.977 in (null):Y-9999 (29) other bump:2.10692 Ang O(174) at 13.257 17.012 52.892 in (null):Q-9999 (25) and CD1(198) at 12.2622 18.1301 54.375 in (null):Y-9999 (29) other bump:2.82587 Ang CD1(103) at 12.0292 22.7962 37.1416 in (null):W-9999 (16) and N(117) at 12.61 21.909 39.761 in (null):C-9999 (18) neighbor-bump: 2.49896 Ang C(41) at 20.822 12.758 39.623 in (null):K-9999 (6) and CB(44) at 20.4708 14.8482 40.9468 in (null):A-9999 (7) other bump:2.28861 Ang O(7) at 21.368 8.593 31.95 in (null):T-9999 (1) and OD1(25) at 20.052 7.9102 33.6935 in (null):D-9999 (4) T0159 108 :TWTP 1cl2A 131 :WFDP Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 6 residues T0159 112 :YWVSNELKPGKDVVWLQVPFSALPGDKNADTKL 1cl2A 138 :ADIVKHLQPNTKIVFLESPGSITMEVHDVPAIV Fragment has 45 clashes (null) has 45 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 35 residues other bump:2.28228 Ang CD2(136) at 2.683 -2.515 59.806 in (null):L-9999 (16) and NZ(254) at 4.54789 -3.82816 59.7249 in (null):K-9999 (32) other bump:2.91693 Ang CG1(113) at 3.779 -5.784 57.702 in (null):V-9999 (14) and NZ(254) at 4.54789 -3.82816 59.7249 in (null):K-9999 (32) other bump:2.8177 Ang CD1(135) at 4.637 -1.023 59.975 in (null):L-9999 (16) and NZ(254) at 4.54789 -3.82816 59.7249 in (null):K-9999 (32) other bump:1.79542 Ang CD2(136) at 2.683 -2.515 59.806 in (null):L-9999 (16) and CE(253) at 3.23505 -4.12327 60.3824 in (null):K-9999 (32) other bump:2.99239 Ang CG(134) at 3.447 -1.412 59.134 in (null):L-9999 (16) and CE(253) at 3.23505 -4.12327 60.3824 in (null):K-9999 (32) other bump:2.69901 Ang CD2(136) at 2.683 -2.515 59.806 in (null):L-9999 (16) and CD(252) at 3.39365 -4.06121 61.901 in (null):K-9999 (32) other bump:2.71856 Ang CD1(6) at 6.4261 -7.1688 69.7117 in (null):Y-9999 (1) and OG1(245) at 6.74382 -4.49899 70.1139 in (null):T-9999 (31) other bump:1.90193 Ang CE1(8) at 7.48384 -6.23129 69.8515 in (null):Y-9999 (1) and OG1(245) at 6.74382 -4.49899 70.1139 in (null):T-9999 (31) other bump:2.81728 Ang N(2) at 3.813 -8.171 68.256 in (null):Y-9999 (1) and CG2(244) at 5.95301 -6.55547 69.1205 in (null):T-9999 (31) other bump:3.21554 Ang CA(3) at 4.724 -9.261 67.892 in (null):Y-9999 (1) and CG2(244) at 5.95301 -6.55547 69.1205 in (null):T-9999 (31) other bump:2.11973 Ang CG(5) at 6.69054 -8.51267 69.465 in (null):Y-9999 (1) and CG2(244) at 5.95301 -6.55547 69.1205 in (null):T-9999 (31) other bump:0.974414 Ang CD1(6) at 6.4261 -7.1688 69.7117 in (null):Y-9999 (1) and CG2(244) at 5.95301 -6.55547 69.1205 in (null):T-9999 (31) other bump:1.72708 Ang CE1(8) at 7.48384 -6.23129 69.8515 in (null):Y-9999 (1) and CG2(244) at 5.95301 -6.55547 69.1205 in (null):T-9999 (31) other bump:2.91681 Ang CZ(10) at 8.80318 -6.66457 69.7308 in (null):Y-9999 (1) and CG2(244) at 5.95301 -6.55547 69.1205 in (null):T-9999 (31) other bump:2.23859 Ang CD1(6) at 6.4261 -7.1688 69.7117 in (null):Y-9999 (1) and CB(243) at 6.29255 -5.09934 68.8686 in (null):T-9999 (31) other bump:1.9148 Ang CE1(8) at 7.48384 -6.23129 69.8515 in (null):Y-9999 (1) and CB(243) at 6.29255 -5.09934 68.8686 in (null):T-9999 (31) other bump:3.03724 Ang CD1(6) at 6.4261 -7.1688 69.7117 in (null):Y-9999 (1) and CA(242) at 7.427 -4.96 67.883 in (null):T-9999 (31) other bump:2.344 Ang CE1(8) at 7.48384 -6.23129 69.8515 in (null):Y-9999 (1) and CA(242) at 7.427 -4.96 67.883 in (null):T-9999 (31) other bump:2.86597 Ang CZ(10) at 8.80318 -6.66457 69.7308 in (null):Y-9999 (1) and CA(242) at 7.427 -4.96 67.883 in (null):T-9999 (31) other bump:2.72235 Ang CG2(152) at 0.48824 2.12015 62.9041 in (null):V-9999 (18) and CG(214) at 0.0738699 -0.498591 63.5219 in (null):K-9999 (27) other bump:2.84156 Ang CG2(152) at 0.48824 2.12015 62.9041 in (null):V-9999 (18) and CB(213) at 1.12875 -0.10858 64.5464 in (null):K-9999 (27) other bump:1.98706 Ang CG1(151) at 0.315779 3.99671 64.5021 in (null):V-9999 (18) and OD1(207) at 0.681707 4.85429 66.2568 in (null):D-9999 (26) other bump:2.93386 Ang CG1(151) at 0.315779 3.99671 64.5021 in (null):V-9999 (18) and CG(206) at 0.358277 4.46686 67.3977 in (null):D-9999 (26) other bump:3.11989 Ang CG1(151) at 0.315779 3.99671 64.5021 in (null):V-9999 (18) and CA(204) at -1.722 3.183 66.72 in (null):D-9999 (26) neighbor-bump: 2.26835 Ang O(190) at -9.455 4.825 65.941 in (null):L-9999 (23) and CD(196) at -9.08552 6.68533 64.6968 in (null):P-9999 (24) neighbor-bump: 1.72638 Ang C(191) at -9.476 5.004 64.729 in (null):L-9999 (23) and CD(196) at -9.08552 6.68533 64.6968 in (null):P-9999 (24) self-bump: 2.10389 Ang CA(193) at -7.155 5.849 64.694 in (null):P-9999 (24) and CD(196) at -9.08552 6.68533 64.6968 in (null):P-9999 (24) self-bump: 2.20406 Ang N(192) at -8.397 5.384 64.043 in (null):P-9999 (24) and CG(195) at -8.29235 7.56933 63.776 in (null):P-9999 (24) other bump:1.07287 Ang O(56) at 0.764 -14.029 57.43 in (null):E-9999 (6) and NZ(92) at 1.26381 -14.6679 56.7278 in (null):K-9999 (11) other bump:1.95476 Ang C(57) at 1.107 -14.128 58.6 in (null):E-9999 (6) and NZ(92) at 1.26381 -14.6679 56.7278 in (null):K-9999 (11) other bump:2.55445 Ang CA(59) at 3.444 -14.276 58 in (null):L-9999 (7) and NZ(92) at 1.26381 -14.6679 56.7278 in (null):K-9999 (11) other bump:2.49499 Ang C(65) at 3.501 -15.621 57.286 in (null):L-9999 (7) and NZ(92) at 1.26381 -14.6679 56.7278 in (null):K-9999 (11) other bump:2.58077 Ang CB(68) at 2.78959 -16.6845 54.0544 in (null):K-9999 (8) and CE(91) at 2.49525 -14.9541 55.9463 in (null):K-9999 (11) other bump:2.79636 Ang CG(69) at 1.39164 -17.0789 54.5018 in (null):K-9999 (8) and CE(91) at 2.49525 -14.9541 55.9463 in (null):K-9999 (11) other bump:2.46055 Ang O(56) at 0.764 -14.029 57.43 in (null):E-9999 (6) and CE(91) at 2.49525 -14.9541 55.9463 in (null):K-9999 (11) other bump:3.1067 Ang C(57) at 1.107 -14.128 58.6 in (null):E-9999 (6) and CE(91) at 2.49525 -14.9541 55.9463 in (null):K-9999 (11) other bump:2.37037 Ang CA(67) at 3.824 -16.75 55.154 in (null):K-9999 (8) and CE(91) at 2.49525 -14.9541 55.9463 in (null):K-9999 (11) other bump:2.36167 Ang CA(59) at 3.444 -14.276 58 in (null):L-9999 (7) and CE(91) at 2.49525 -14.9541 55.9463 in (null):K-9999 (11) other bump:1.80305 Ang C(65) at 3.501 -15.621 57.286 in (null):L-9999 (7) and CE(91) at 2.49525 -14.9541 55.9463 in (null):K-9999 (11) other bump:1.38709 Ang N(66) at 3.74 -15.565 55.984 in (null):K-9999 (8) and CE(91) at 2.49525 -14.9541 55.9463 in (null):K-9999 (11) other bump:3.13895 Ang CA(67) at 3.824 -16.75 55.154 in (null):K-9999 (8) and CD(90) at 3.30528 -13.6957 55.6594 in (null):K-9999 (11) other bump:2.41547 Ang CA(59) at 3.444 -14.276 58 in (null):L-9999 (7) and CD(90) at 3.30528 -13.6957 55.6594 in (null):K-9999 (11) other bump:2.52802 Ang C(65) at 3.501 -15.621 57.286 in (null):L-9999 (7) and CD(90) at 3.30528 -13.6957 55.6594 in (null):K-9999 (11) other bump:1.94641 Ang N(66) at 3.74 -15.565 55.984 in (null):K-9999 (8) and CD(90) at 3.30528 -13.6957 55.6594 in (null):K-9999 (11) other bump:2.82309 Ang N(66) at 3.74 -15.565 55.984 in (null):K-9999 (8) and CG(89) at 3.40436 -13.431 54.1666 in (null):K-9999 (11) Number of specific fragments= 5 total=100 Number of alignments=27 # Reading fragments from alignment file # T0159 read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1cl2A/T0159-1cl2A-2track-protein-STR-global-adpstyle5.pw.a2m.gz # 1cl2A read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1cl2A/T0159-1cl2A-2track-protein-STR-global-adpstyle5.pw.a2m.gz # found chain 1cl2A in template set T0159 6 :EGVFVNGAAQ 1cl2A 6 :LDTQLVNAGR Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 12 residues other bump:1.94415 Ang O(46) at 13.337 26.835 54.151 in (null):N-9999 (6) and OE1(67) at 14.1518 27.0723 52.4018 in (null):Q-9999 (10) neighbor-bump: 2.59367 Ang C(56) at 14.888 22.178 51.588 in (null):A-9999 (8) and CB(59) at 14.1386 21.2638 49.2794 in (null):A-9999 (9) T0159 19 :IDKKTAD 1cl2A 16 :SKKYTLG Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 9 residues self-bump: 1.37849 Ang CA(49) at 18.708 33.837 43.856 in (null):D-9999 (7) and CB(50) at 19.0547 35.0067 43.2143 in (null):D-9999 (7) T0159 28 :KITNIAQ 1cl2A 23 :AVNSVIQ Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 9 residues self-bump: 1.38672 Ang CA(12) at 13.825 32.37 48.228 in (null):I-9999 (2) and CB(13) at 13.1608 32.7486 49.3849 in (null):I-9999 (2) T0159 38 :PKIAKLFD 1cl2A 30 :RASSLVFD Fragment has 14 clashes (null) has 14 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 10 residues other bump:2.95366 Ang CD(13) at 12.8329 21.3929 29.6385 in (null):K-9999 (2) and CG(34) at 14.3414 19.015 30.5296 in (null):K-9999 (5) other bump:2.46956 Ang CE(14) at 13.4688 21.1722 28.2795 in (null):K-9999 (2) and CA(32) at 15.058 19.289 28.117 in (null):K-9999 (5) other bump:2.39326 Ang NZ(15) at 14.87 21.6719 28.2358 in (null):K-9999 (2) and CA(32) at 15.058 19.289 28.117 in (null):K-9999 (5) other bump:2.67841 Ang CE(14) at 13.4688 21.1722 28.2795 in (null):K-9999 (2) and N(31) at 13.919 18.664 27.455 in (null):K-9999 (5) other bump:3.10795 Ang CG(12) at 11.4134 20.9039 29.6286 in (null):K-9999 (2) and C(30) at 12.722 19.251 27.345 in (null):A-9999 (4) other bump:3.14009 Ang CD(13) at 12.8329 21.3929 29.6385 in (null):K-9999 (2) and C(30) at 12.722 19.251 27.345 in (null):A-9999 (4) other bump:2.26322 Ang CE(14) at 13.4688 21.1722 28.2795 in (null):K-9999 (2) and C(30) at 12.722 19.251 27.345 in (null):A-9999 (4) other bump:2.0787 Ang CG(12) at 11.4134 20.9039 29.6286 in (null):K-9999 (2) and O(29) at 12.418 20.317 27.906 in (null):A-9999 (4) other bump:2.08117 Ang CD(13) at 12.8329 21.3929 29.6385 in (null):K-9999 (2) and O(29) at 12.418 20.317 27.906 in (null):A-9999 (4) other bump:1.40537 Ang CE(14) at 13.4688 21.1722 28.2795 in (null):K-9999 (2) and O(29) at 12.418 20.317 27.906 in (null):A-9999 (4) neighbor-bump: 2.46562 Ang CG1(21) at 8.12876 17.535 26.746 in (null):I-9999 (3) and N(26) at 10.367 18.47 27.188 in (null):A-9999 (4) self-bump: 2.17653 Ang CB(20) at 8.11586 17.0129 28.1914 in (null):I-9999 (3) and C(25) at 10.152 17.773 28.308 in (null):I-9999 (3) self-bump: 2.28323 Ang CA(19) at 8.747 17.852 28.921 in (null):I-9999 (3) and CG1(21) at 8.12876 17.535 26.746 in (null):I-9999 (3) self-bump: 1.27859 Ang CA(19) at 8.747 17.852 28.921 in (null):I-9999 (3) and CB(20) at 8.11586 17.0129 28.1914 in (null):I-9999 (3) T0159 46 :TNGDGKADLTGCNPGWGCEGAINHQLAAYELTNTVTHNQGNYAAMMADTISRYKEGKPVFYY 1cl2A 46 :TRNRANGELFYGRRGTLTHFSLQQAMCELEGGAGCVLFPCGAAAVANSILAFIEQGDHVLMT Fragment has 48 clashes (null) has 48 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 64 residues other bump:2.94264 Ang CG2(435) at 0.845 -7.817 48.738 in (null):V-9999 (59) and OH(458) at 0.866534 -5.023 49.6612 in (null):Y-9999 (61) other bump:2.11232 Ang CG1(434) at -0.154 -6.584 50.653 in (null):V-9999 (59) and OH(458) at 0.866534 -5.023 49.6612 in (null):Y-9999 (61) other bump:1.67341 Ang CG1(434) at -0.154 -6.584 50.653 in (null):V-9999 (59) and CZ(457) at 0.0157418 -4.92157 50.7415 in (null):Y-9999 (61) other bump:2.96484 Ang CG1(434) at -0.154 -6.584 50.653 in (null):V-9999 (59) and CE2(456) at -0.205014 -3.70138 51.3445 in (null):Y-9999 (61) other bump:2.31862 Ang CB(433) at 0.004 -7.942 49.985 in (null):V-9999 (59) and CE1(455) at -0.605924 -6.06319 51.1991 in (null):Y-9999 (61) other bump:3.18341 Ang C(437) at -0.124 -9.021 52.273 in (null):V-9999 (59) and CE1(455) at -0.605924 -6.06319 51.1991 in (null):Y-9999 (61) other bump:0.879614 Ang CG1(434) at -0.154 -6.584 50.653 in (null):V-9999 (59) and CE1(455) at -0.605924 -6.06319 51.1991 in (null):Y-9999 (61) other bump:2.17714 Ang CG1(434) at -0.154 -6.584 50.653 in (null):V-9999 (59) and CD1(453) at -1.46362 -5.98192 52.2847 in (null):Y-9999 (61) neighbor-bump: 2.08464 Ang C(423) at 2.225 -12.971 47.352 in (null):K-9999 (57) and CD(428) at 3.21477 -13.9767 48.8865 in (null):P-9999 (58) other bump:0.670924 Ang CD1(361) at 1.01119 -4.20799 40.7983 in (null):I-9999 (50) and OH(390) at 1.14342 -3.57517 40.9777 in (null):Y-9999 (53) other bump:1.13442 Ang CG1(359) at 2.01719 -3.09289 40.4384 in (null):I-9999 (50) and OH(390) at 1.14342 -3.57517 40.9777 in (null):Y-9999 (53) other bump:2.6979 Ang CA(357) at 3.098 -2.845 42.688 in (null):I-9999 (50) and OH(390) at 1.14342 -3.57517 40.9777 in (null):Y-9999 (53) other bump:1.96184 Ang CB(358) at 2.28618 -2.09625 41.5741 in (null):I-9999 (50) and OH(390) at 1.14342 -3.57517 40.9777 in (null):Y-9999 (53) other bump:1.25045 Ang CD1(361) at 1.01119 -4.20799 40.7983 in (null):I-9999 (50) and CZ(389) at 1.72856 -4.53898 41.7675 in (null):Y-9999 (53) other bump:1.98522 Ang CG1(359) at 2.01719 -3.09289 40.4384 in (null):I-9999 (50) and CZ(389) at 1.72856 -4.53898 41.7675 in (null):Y-9999 (53) other bump:2.36478 Ang CA(357) at 3.098 -2.845 42.688 in (null):I-9999 (50) and CZ(389) at 1.72856 -4.53898 41.7675 in (null):Y-9999 (53) other bump:3.26929 Ang C(363) at 4.558 -2.976 42.257 in (null):I-9999 (50) and CZ(389) at 1.72856 -4.53898 41.7675 in (null):Y-9999 (53) other bump:2.51303 Ang CB(358) at 2.28618 -2.09625 41.5741 in (null):I-9999 (50) and CZ(389) at 1.72856 -4.53898 41.7675 in (null):Y-9999 (53) other bump:2.52916 Ang CD1(361) at 1.01119 -4.20799 40.7983 in (null):I-9999 (50) and CE2(388) at 2.3017 -4.16725 42.973 in (null):Y-9999 (53) other bump:2.76761 Ang CG1(359) at 2.01719 -3.09289 40.4384 in (null):I-9999 (50) and CE2(388) at 2.3017 -4.16725 42.973 in (null):Y-9999 (53) other bump:1.56962 Ang CA(357) at 3.098 -2.845 42.688 in (null):I-9999 (50) and CE2(388) at 2.3017 -4.16725 42.973 in (null):Y-9999 (53) other bump:2.65004 Ang C(363) at 4.558 -2.976 42.257 in (null):I-9999 (50) and CE2(388) at 2.3017 -4.16725 42.973 in (null):Y-9999 (53) other bump:2.27822 Ang N(356) at 2.89 -2.219 43.997 in (null):I-9999 (50) and CE2(388) at 2.3017 -4.16725 42.973 in (null):Y-9999 (53) other bump:2.49926 Ang CB(358) at 2.28618 -2.09625 41.5741 in (null):I-9999 (50) and CE2(388) at 2.3017 -4.16725 42.973 in (null):Y-9999 (53) other bump:2.84798 Ang C(355) at 3.437 -2.687 45.125 in (null):T-9999 (49) and CE2(388) at 2.3017 -4.16725 42.973 in (null):Y-9999 (53) other bump:1.89797 Ang CD1(361) at 1.01119 -4.20799 40.7983 in (null):I-9999 (50) and CE1(387) at 1.75616 -5.86234 41.3555 in (null):Y-9999 (53) other bump:2.92899 Ang CG1(359) at 2.01719 -3.09289 40.4384 in (null):I-9999 (50) and CE1(387) at 1.75616 -5.86234 41.3555 in (null):Y-9999 (53) other bump:2.53141 Ang CA(357) at 3.098 -2.845 42.688 in (null):I-9999 (50) and CD2(386) at 2.90651 -5.12613 43.7687 in (null):Y-9999 (53) other bump:3.10412 Ang C(363) at 4.558 -2.976 42.257 in (null):I-9999 (50) and CD2(386) at 2.90651 -5.12613 43.7687 in (null):Y-9999 (53) other bump:2.43712 Ang O(354) at 4.244 -3.624 45.145 in (null):T-9999 (49) and CD2(386) at 2.90651 -5.12613 43.7687 in (null):Y-9999 (53) other bump:2.84084 Ang C(355) at 3.437 -2.687 45.125 in (null):T-9999 (49) and CD2(386) at 2.90651 -5.12613 43.7687 in (null):Y-9999 (53) other bump:3.04103 Ang CG(272) at 1.38323 8.63281 42.9374 in (null):N-9999 (38) and N(315) at 0.551 6.755 45.18 in (null):A-9999 (44) other bump:3.0948 Ang CG(272) at 1.38323 8.63281 42.9374 in (null):N-9999 (38) and C(314) at 0.152 6.051 44.119 in (null):A-9999 (43) other bump:2.66756 Ang ND2(273) at 1.66655 7.44895 42.4256 in (null):N-9999 (38) and C(314) at 0.152 6.051 44.119 in (null):A-9999 (43) other bump:2.03508 Ang OD1(274) at 0.250095 9.09033 42.8503 in (null):N-9999 (38) and CB(312) at -0.893 7.49 42.327 in (null):A-9999 (43) other bump:2.61913 Ang CG(272) at 1.38323 8.63281 42.9374 in (null):N-9999 (38) and CB(312) at -0.893 7.49 42.327 in (null):A-9999 (43) other bump:2.56177 Ang ND2(273) at 1.66655 7.44895 42.4256 in (null):N-9999 (38) and CB(312) at -0.893 7.49 42.327 in (null):A-9999 (43) self-bump: 1.38544 Ang CA(291) at -1.436 9.516 47.829 in (null):N-9999 (41) and CB(292) at -1.54102 9.63218 49.2056 in (null):N-9999 (41) other bump:2.74 Ang CG(152) at 12.3468 14.1988 44.3728 in (null):N-9999 (23) and NE2(266) at 9.64548 14.6098 44.5764 in (null):H-9999 (37) other bump:1.72149 Ang OD1(154) at 11.2167 13.9444 44.8043 in (null):N-9999 (23) and NE2(266) at 9.64548 14.6098 44.5764 in (null):H-9999 (37) other bump:2.90598 Ang OD1(154) at 11.2167 13.9444 44.8043 in (null):N-9999 (23) and CE1(265) at 8.57989 15.1134 45.1581 in (null):H-9999 (37) other bump:2.29625 Ang OD1(154) at 11.2167 13.9444 44.8043 in (null):N-9999 (23) and CD2(263) at 9.25444 13.6748 43.6426 in (null):H-9999 (37) other bump:3.15492 Ang CD1(180) at 8.88579 14.5505 48.8886 in (null):L-9999 (26) and CG1(248) at 10.2806 11.8781 47.9578 in (null):V-9999 (35) other bump:2.24145 Ang CG(170) at 11.9247 19.9309 51.8548 in (null):Q-9999 (25) and CE1(200) at 12.4634 19.451 53.977 in (null):Y-9999 (29) other bump:2.10692 Ang O(174) at 13.257 17.012 52.892 in (null):Q-9999 (25) and CD1(198) at 12.2622 18.1301 54.375 in (null):Y-9999 (29) other bump:2.82587 Ang CD1(103) at 12.0292 22.7962 37.1416 in (null):W-9999 (16) and N(117) at 12.61 21.909 39.761 in (null):C-9999 (18) neighbor-bump: 2.49896 Ang C(41) at 20.822 12.758 39.623 in (null):K-9999 (6) and CB(44) at 20.4708 14.8482 40.9468 in (null):A-9999 (7) other bump:2.28861 Ang O(7) at 21.368 8.593 31.95 in (null):T-9999 (1) and OD1(25) at 20.052 7.9102 33.6935 in (null):D-9999 (4) T0159 108 :TWTP 1cl2A 131 :WFDP Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 6 residues T0159 112 :YWVSNELKPGKDVVWLQVPFSALPGDKNADTKLP 1cl2A 138 :ADIVKHLQPNTKIVFLESPGSITMEVHDVPAIVA Fragment has 50 clashes (null) has 50 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 36 residues other bump:3.17899 Ang C(247) at 7.096 -5.656 66.559 in (null):T-9999 (31) and CD(269) at 10.0334 -5.11111 65.4723 in (null):P-9999 (34) other bump:1.61576 Ang O(239) at 9.661 -3.946 66.528 in (null):D-9999 (30) and CD(269) at 10.0334 -5.11111 65.4723 in (null):P-9999 (34) other bump:2.7466 Ang C(240) at 8.812 -3.161 66.972 in (null):D-9999 (30) and CD(269) at 10.0334 -5.11111 65.4723 in (null):P-9999 (34) other bump:2.06118 Ang O(239) at 9.661 -3.946 66.528 in (null):D-9999 (30) and CG(268) at 11.0928 -5.4286 66.5111 in (null):P-9999 (34) other bump:3.24908 Ang C(240) at 8.812 -3.161 66.972 in (null):D-9999 (30) and CG(268) at 11.0928 -5.4286 66.5111 in (null):P-9999 (34) other bump:2.28228 Ang CD2(136) at 2.683 -2.515 59.806 in (null):L-9999 (16) and NZ(254) at 4.54789 -3.82816 59.7249 in (null):K-9999 (32) other bump:2.91693 Ang CG1(113) at 3.779 -5.784 57.702 in (null):V-9999 (14) and NZ(254) at 4.54789 -3.82816 59.7249 in (null):K-9999 (32) other bump:2.8177 Ang CD1(135) at 4.637 -1.023 59.975 in (null):L-9999 (16) and NZ(254) at 4.54789 -3.82816 59.7249 in (null):K-9999 (32) other bump:1.79542 Ang CD2(136) at 2.683 -2.515 59.806 in (null):L-9999 (16) and CE(253) at 3.23505 -4.12327 60.3824 in (null):K-9999 (32) other bump:2.99239 Ang CG(134) at 3.447 -1.412 59.134 in (null):L-9999 (16) and CE(253) at 3.23505 -4.12327 60.3824 in (null):K-9999 (32) other bump:2.69901 Ang CD2(136) at 2.683 -2.515 59.806 in (null):L-9999 (16) and CD(252) at 3.39365 -4.06121 61.901 in (null):K-9999 (32) other bump:2.71856 Ang CD1(6) at 6.4261 -7.1688 69.7117 in (null):Y-9999 (1) and OG1(245) at 6.74382 -4.49899 70.1139 in (null):T-9999 (31) other bump:1.90193 Ang CE1(8) at 7.48384 -6.23129 69.8515 in (null):Y-9999 (1) and OG1(245) at 6.74382 -4.49899 70.1139 in (null):T-9999 (31) other bump:2.81728 Ang N(2) at 3.813 -8.171 68.256 in (null):Y-9999 (1) and CG2(244) at 5.95301 -6.55547 69.1205 in (null):T-9999 (31) other bump:3.21554 Ang CA(3) at 4.724 -9.261 67.892 in (null):Y-9999 (1) and CG2(244) at 5.95301 -6.55547 69.1205 in (null):T-9999 (31) other bump:2.11973 Ang CG(5) at 6.69054 -8.51267 69.465 in (null):Y-9999 (1) and CG2(244) at 5.95301 -6.55547 69.1205 in (null):T-9999 (31) other bump:0.974414 Ang CD1(6) at 6.4261 -7.1688 69.7117 in (null):Y-9999 (1) and CG2(244) at 5.95301 -6.55547 69.1205 in (null):T-9999 (31) other bump:1.72708 Ang CE1(8) at 7.48384 -6.23129 69.8515 in (null):Y-9999 (1) and CG2(244) at 5.95301 -6.55547 69.1205 in (null):T-9999 (31) other bump:2.91681 Ang CZ(10) at 8.80318 -6.66457 69.7308 in (null):Y-9999 (1) and CG2(244) at 5.95301 -6.55547 69.1205 in (null):T-9999 (31) other bump:2.23859 Ang CD1(6) at 6.4261 -7.1688 69.7117 in (null):Y-9999 (1) and CB(243) at 6.29255 -5.09934 68.8686 in (null):T-9999 (31) other bump:1.9148 Ang CE1(8) at 7.48384 -6.23129 69.8515 in (null):Y-9999 (1) and CB(243) at 6.29255 -5.09934 68.8686 in (null):T-9999 (31) other bump:3.03724 Ang CD1(6) at 6.4261 -7.1688 69.7117 in (null):Y-9999 (1) and CA(242) at 7.427 -4.96 67.883 in (null):T-9999 (31) other bump:2.344 Ang CE1(8) at 7.48384 -6.23129 69.8515 in (null):Y-9999 (1) and CA(242) at 7.427 -4.96 67.883 in (null):T-9999 (31) other bump:2.86597 Ang CZ(10) at 8.80318 -6.66457 69.7308 in (null):Y-9999 (1) and CA(242) at 7.427 -4.96 67.883 in (null):T-9999 (31) other bump:2.72235 Ang CG2(152) at 0.48824 2.12015 62.9041 in (null):V-9999 (18) and CG(214) at 0.0738699 -0.498591 63.5219 in (null):K-9999 (27) other bump:2.84156 Ang CG2(152) at 0.48824 2.12015 62.9041 in (null):V-9999 (18) and CB(213) at 1.12875 -0.10858 64.5464 in (null):K-9999 (27) other bump:1.98706 Ang CG1(151) at 0.315779 3.99671 64.5021 in (null):V-9999 (18) and OD1(207) at 0.681707 4.85429 66.2568 in (null):D-9999 (26) other bump:2.93386 Ang CG1(151) at 0.315779 3.99671 64.5021 in (null):V-9999 (18) and CG(206) at 0.358277 4.46686 67.3977 in (null):D-9999 (26) other bump:3.11989 Ang CG1(151) at 0.315779 3.99671 64.5021 in (null):V-9999 (18) and CA(204) at -1.722 3.183 66.72 in (null):D-9999 (26) neighbor-bump: 2.26835 Ang O(190) at -9.455 4.825 65.941 in (null):L-9999 (23) and CD(196) at -9.08552 6.68533 64.6968 in (null):P-9999 (24) neighbor-bump: 1.72638 Ang C(191) at -9.476 5.004 64.729 in (null):L-9999 (23) and CD(196) at -9.08552 6.68533 64.6968 in (null):P-9999 (24) self-bump: 2.10389 Ang CA(193) at -7.155 5.849 64.694 in (null):P-9999 (24) and CD(196) at -9.08552 6.68533 64.6968 in (null):P-9999 (24) self-bump: 2.20406 Ang N(192) at -8.397 5.384 64.043 in (null):P-9999 (24) and CG(195) at -8.29235 7.56933 63.776 in (null):P-9999 (24) other bump:1.07287 Ang O(56) at 0.764 -14.029 57.43 in (null):E-9999 (6) and NZ(92) at 1.26381 -14.6679 56.7278 in (null):K-9999 (11) other bump:1.95476 Ang C(57) at 1.107 -14.128 58.6 in (null):E-9999 (6) and NZ(92) at 1.26381 -14.6679 56.7278 in (null):K-9999 (11) other bump:2.55445 Ang CA(59) at 3.444 -14.276 58 in (null):L-9999 (7) and NZ(92) at 1.26381 -14.6679 56.7278 in (null):K-9999 (11) other bump:2.49499 Ang C(65) at 3.501 -15.621 57.286 in (null):L-9999 (7) and NZ(92) at 1.26381 -14.6679 56.7278 in (null):K-9999 (11) other bump:2.58077 Ang CB(68) at 2.78959 -16.6845 54.0544 in (null):K-9999 (8) and CE(91) at 2.49525 -14.9541 55.9463 in (null):K-9999 (11) other bump:2.79636 Ang CG(69) at 1.39164 -17.0789 54.5018 in (null):K-9999 (8) and CE(91) at 2.49525 -14.9541 55.9463 in (null):K-9999 (11) other bump:2.46055 Ang O(56) at 0.764 -14.029 57.43 in (null):E-9999 (6) and CE(91) at 2.49525 -14.9541 55.9463 in (null):K-9999 (11) other bump:3.1067 Ang C(57) at 1.107 -14.128 58.6 in (null):E-9999 (6) and CE(91) at 2.49525 -14.9541 55.9463 in (null):K-9999 (11) other bump:2.37037 Ang CA(67) at 3.824 -16.75 55.154 in (null):K-9999 (8) and CE(91) at 2.49525 -14.9541 55.9463 in (null):K-9999 (11) other bump:2.36167 Ang CA(59) at 3.444 -14.276 58 in (null):L-9999 (7) and CE(91) at 2.49525 -14.9541 55.9463 in (null):K-9999 (11) other bump:1.80305 Ang C(65) at 3.501 -15.621 57.286 in (null):L-9999 (7) and CE(91) at 2.49525 -14.9541 55.9463 in (null):K-9999 (11) other bump:1.38709 Ang N(66) at 3.74 -15.565 55.984 in (null):K-9999 (8) and CE(91) at 2.49525 -14.9541 55.9463 in (null):K-9999 (11) other bump:3.13895 Ang CA(67) at 3.824 -16.75 55.154 in (null):K-9999 (8) and CD(90) at 3.30528 -13.6957 55.6594 in (null):K-9999 (11) other bump:2.41547 Ang CA(59) at 3.444 -14.276 58 in (null):L-9999 (7) and CD(90) at 3.30528 -13.6957 55.6594 in (null):K-9999 (11) other bump:2.52802 Ang C(65) at 3.501 -15.621 57.286 in (null):L-9999 (7) and CD(90) at 3.30528 -13.6957 55.6594 in (null):K-9999 (11) other bump:1.94641 Ang N(66) at 3.74 -15.565 55.984 in (null):K-9999 (8) and CD(90) at 3.30528 -13.6957 55.6594 in (null):K-9999 (11) other bump:2.82309 Ang N(66) at 3.74 -15.565 55.984 in (null):K-9999 (8) and CG(89) at 3.40436 -13.431 54.1666 in (null):K-9999 (11) Number of specific fragments= 7 total=107 Number of alignments=28 # Reading fragments from alignment file # T0159 read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1qo7A/T0159-1qo7A-2track-protein-STR-global-adpstyle5.pw.a2m.gz # 1qo7A read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1qo7A/T0159-1qo7A-2track-protein-STR-global-adpstyle5.pw.a2m.gz # found chain 1qo7A in template set T0159 1 :KKFYRE 1qo7A 3 :KAFAKF Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 7 residues other bump:3.00138 Ang N(0) at 19.817 19.751 30.128 in (null):K-9999 (0) and CE2(36) at 21.2886 20.8382 32.5072 in (null):Y-9999 (3) other bump:3.14339 Ang CA(1) at 20.757 20.664 29.414 in (null):K-9999 (0) and CE2(36) at 21.2886 20.8382 32.5072 in (null):Y-9999 (3) other bump:2.81636 Ang CA(1) at 20.757 20.664 29.414 in (null):K-9999 (0) and CD2(34) at 22.1384 21.5815 31.6904 in (null):Y-9999 (3) T0159 7 :GVFVNGAAQGYLIDKKTAD 1qo7A 11 :SASISPNPFTVSIPDEQLD Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 21 residues other bump:2.94083 Ang CZ(74) at 25.6582 15.6909 48.4174 in (null):Y-9999 (11) and CD1(91) at 27.887 13.811 48.801 in (null):I-9999 (13) other bump:2.77507 Ang OH(75) at 25.8683 15.4603 49.7527 in (null):Y-9999 (11) and CD1(91) at 27.887 13.811 48.801 in (null):I-9999 (13) other bump:2.75385 Ang CE2(73) at 24.7524 14.8912 47.6987 in (null):Y-9999 (11) and CG1(89) at 26.545 13.099 48.775 in (null):I-9999 (13) other bump:2.76261 Ang CZ(74) at 25.6582 15.6909 48.4174 in (null):Y-9999 (11) and CG1(89) at 26.545 13.099 48.775 in (null):I-9999 (13) other bump:2.64379 Ang OH(75) at 25.8683 15.4603 49.7527 in (null):Y-9999 (11) and CG1(89) at 26.545 13.099 48.775 in (null):I-9999 (13) T0159 28 :KITNIAQLKD 1qo7A 30 :DLKTLVRLSK Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 12 residues other bump:2.47557 Ang O(40) at 25.533 9.434 65.645 in (null):I-9999 (5) and CG(67) at 25.7622 11.3445 67.2025 in (null):K-9999 (9) T0159 38 :PKIAKLFDTNGD 1qo7A 42 :PPTYESLQADGR Fragment has 20 clashes (null) has 20 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:2.43403 Ang CD(13) at 12.991 16.0323 79.3244 in (null):K-9999 (2) and CZ(56) at 13.9634 17.4229 81.0694 in (null):F-9999 (7) other bump:2.54247 Ang CE(14) at 11.8612 16.1945 80.3373 in (null):K-9999 (2) and CZ(56) at 13.9634 17.4229 81.0694 in (null):F-9999 (7) other bump:2.58466 Ang CG(12) at 14.0876 15.1335 79.8761 in (null):K-9999 (2) and CZ(56) at 13.9634 17.4229 81.0694 in (null):F-9999 (7) other bump:2.58851 Ang CA(10) at 16.263 16.468 80.362 in (null):K-9999 (2) and CZ(56) at 13.9634 17.4229 81.0694 in (null):F-9999 (7) other bump:1.81838 Ang CB(11) at 14.8837 15.8611 80.9274 in (null):K-9999 (2) and CZ(56) at 13.9634 17.4229 81.0694 in (null):F-9999 (7) other bump:2.69865 Ang C(17) at 16.635 17.467 81.448 in (null):K-9999 (2) and CZ(56) at 13.9634 17.4229 81.0694 in (null):F-9999 (7) other bump:2.79976 Ang N(18) at 16.431 18.743 81.153 in (null):I-9999 (3) and CZ(56) at 13.9634 17.4229 81.0694 in (null):F-9999 (7) other bump:1.61702 Ang CD(13) at 12.991 16.0323 79.3244 in (null):K-9999 (2) and CE2(55) at 13.2924 17.5014 79.9289 in (null):F-9999 (7) other bump:1.98071 Ang CE(14) at 11.8612 16.1945 80.3373 in (null):K-9999 (2) and CE2(55) at 13.2924 17.5014 79.9289 in (null):F-9999 (7) other bump:2.49841 Ang CG(12) at 14.0876 15.1335 79.8761 in (null):K-9999 (2) and CE2(55) at 13.2924 17.5014 79.9289 in (null):F-9999 (7) other bump:3.17491 Ang CA(10) at 16.263 16.468 80.362 in (null):K-9999 (2) and CE2(55) at 13.2924 17.5014 79.9289 in (null):F-9999 (7) other bump:2.49405 Ang CB(11) at 14.8837 15.8611 80.9274 in (null):K-9999 (2) and CE2(55) at 13.2924 17.5014 79.9289 in (null):F-9999 (7) other bump:2.95341 Ang CB(11) at 14.8837 15.8611 80.9274 in (null):K-9999 (2) and CE1(54) at 13.851 18.4247 81.9685 in (null):F-9999 (7) other bump:2.98974 Ang C(17) at 16.635 17.467 81.448 in (null):K-9999 (2) and CE1(54) at 13.851 18.4247 81.9685 in (null):F-9999 (7) other bump:2.72442 Ang N(18) at 16.431 18.743 81.153 in (null):I-9999 (3) and CE1(54) at 13.851 18.4247 81.9685 in (null):F-9999 (7) other bump:2.94721 Ang C(25) at 15.584 20.807 82.056 in (null):I-9999 (3) and CE1(54) at 13.851 18.4247 81.9685 in (null):F-9999 (7) other bump:2.67208 Ang CD(13) at 12.991 16.0323 79.3244 in (null):K-9999 (2) and CD2(53) at 12.4857 18.6419 79.597 in (null):F-9999 (7) other bump:2.63212 Ang CE(14) at 11.8612 16.1945 80.3373 in (null):K-9999 (2) and CD2(53) at 12.4857 18.6419 79.597 in (null):F-9999 (7) other bump:2.25004 Ang O(24) at 14.788 20.817 81.119 in (null):I-9999 (3) and CD1(52) at 13.0186 19.5408 81.6694 in (null):F-9999 (7) other bump:3.04354 Ang CG1(21) at 17.9912 21.1926 80.4202 in (null):I-9999 (3) and CG(43) at 17.7147 20.8738 77.4061 in (null):L-9999 (6) T0159 55 :TGCNPGWGC 1qo7A 54 :FGITSEWLT Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.34382 Ang OD1(24) at 12.1135 20.5622 71.1963 in (null):N-9999 (4) and CB(40) at 12.457 19.908 68.972 in (null):W-9999 (7) T0159 65 :GAINHQLAAYELT 1qo7A 63 :TMREKWLSEFDWR Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues T0159 78 :NTVT 1qo7A 84 :FPQF Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 6 residues T0159 82 :HNQG 1qo7A 90 :EIEG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 6 residues T0159 90 :MMADTISRYKEGKPVFYYTWTPYWVSN 1qo7A 97 :HFAALFSEREDAVPIALLHGWPGSFVE Fragment has 74 clashes (null) has 74 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 29 residues other bump:2.8357 Ang CH2(173) at 18.3983 32.6097 52.8077 in (null):W-9999 (20) and OD1(234) at 18.1596 31.4735 50.2205 in (null):N-9999 (27) other bump:3.03728 Ang CZ3(172) at 19.3471 33.4343 52.2132 in (null):W-9999 (20) and OD1(234) at 18.1596 31.4735 50.2205 in (null):N-9999 (27) other bump:2.91394 Ang CH2(173) at 18.3983 32.6097 52.8077 in (null):W-9999 (20) and ND2(233) at 17.316 30.0974 51.8036 in (null):N-9999 (27) other bump:3.04969 Ang CH2(173) at 18.3983 32.6097 52.8077 in (null):W-9999 (20) and CG(232) at 18.1042 30.3666 50.7626 in (null):N-9999 (27) other bump:2.35726 Ang NE1(210) at 20.6431 24.0658 50.0195 in (null):W-9999 (24) and OG(226) at 20.9666 23.1927 47.8539 in (null):S-9999 (26) other bump:2.48642 Ang CD1(206) at 21.803 24.6915 49.6529 in (null):W-9999 (24) and OG(226) at 20.9666 23.1927 47.8539 in (null):S-9999 (26) other bump:1.63113 Ang NE1(210) at 20.6431 24.0658 50.0195 in (null):W-9999 (24) and CB(225) at 20.1044 24.1393 48.4816 in (null):S-9999 (26) other bump:2.91942 Ang CE2(208) at 20.4696 24.1662 51.378 in (null):W-9999 (24) and CB(225) at 20.1044 24.1393 48.4816 in (null):S-9999 (26) other bump:2.1359 Ang CD1(206) at 21.803 24.6915 49.6529 in (null):W-9999 (24) and CB(225) at 20.1044 24.1393 48.4816 in (null):S-9999 (26) other bump:2.90861 Ang NE1(210) at 20.6431 24.0658 50.0195 in (null):W-9999 (24) and CA(224) at 19.956 25.402 47.529 in (null):S-9999 (26) other bump:2.903 Ang CD1(206) at 21.803 24.6915 49.6529 in (null):W-9999 (24) and CA(224) at 19.956 25.402 47.529 in (null):S-9999 (26) other bump:2.49311 Ang CD1(206) at 21.803 24.6915 49.6529 in (null):W-9999 (24) and N(223) at 21.278 26.019 47.609 in (null):S-9999 (26) other bump:2.99784 Ang CG2(158) at 22.8841 30.7268 48.8469 in (null):T-9999 (19) and C(215) at 23.021 27.788 49.423 in (null):W-9999 (24) other bump:2.51863 Ang CG2(158) at 22.8841 30.7268 48.8469 in (null):T-9999 (19) and O(214) at 21.983 28.447 49.425 in (null):W-9999 (24) neighbor-bump: 3.225 Ang C(201) at 23.212 27.93 53.059 in (null):Y-9999 (23) and CE3(209) at 21.7127 25.0812 53.2523 in (null):W-9999 (24) other bump:2.36374 Ang CE2(168) at 19.9039 32.3397 54.6307 in (null):W-9999 (20) and OH(199) at 17.9164 33.126 55.6401 in (null):Y-9999 (23) other bump:2.02994 Ang CZ2(171) at 18.6569 32.0629 54.0773 in (null):W-9999 (20) and OH(199) at 17.9164 33.126 55.6401 in (null):Y-9999 (23) other bump:2.91908 Ang CH2(173) at 18.3983 32.6097 52.8077 in (null):W-9999 (20) and OH(199) at 17.9164 33.126 55.6401 in (null):Y-9999 (23) other bump:2.40383 Ang CD2(167) at 20.8899 33.1443 54.0117 in (null):W-9999 (20) and CZ(198) at 18.9106 32.3421 55.1151 in (null):Y-9999 (23) other bump:1.10512 Ang CE2(168) at 19.9039 32.3397 54.6307 in (null):W-9999 (20) and CZ(198) at 18.9106 32.3421 55.1151 in (null):Y-9999 (23) other bump:1.10421 Ang CZ2(171) at 18.6569 32.0629 54.0773 in (null):W-9999 (20) and CZ(198) at 18.9106 32.3421 55.1151 in (null):Y-9999 (23) other bump:2.37868 Ang CH2(173) at 18.3983 32.6097 52.8077 in (null):W-9999 (20) and CZ(198) at 18.9106 32.3421 55.1151 in (null):Y-9999 (23) other bump:1.74546 Ang NE1(170) at 20.4505 31.9124 55.8158 in (null):W-9999 (20) and CZ(198) at 18.9106 32.3421 55.1151 in (null):Y-9999 (23) other bump:3.20614 Ang CE3(169) at 20.5943 33.7456 52.7752 in (null):W-9999 (20) and CZ(198) at 18.9106 32.3421 55.1151 in (null):Y-9999 (23) other bump:3.13118 Ang CZ3(172) at 19.3471 33.4343 52.2132 in (null):W-9999 (20) and CZ(198) at 18.9106 32.3421 55.1151 in (null):Y-9999 (23) other bump:1.58439 Ang CD2(167) at 20.8899 33.1443 54.0117 in (null):W-9999 (20) and CE2(197) at 20.2362 32.6625 55.3722 in (null):Y-9999 (23) other bump:0.874326 Ang CE2(168) at 19.9039 32.3397 54.6307 in (null):W-9999 (20) and CE2(197) at 20.2362 32.6625 55.3722 in (null):Y-9999 (23) other bump:2.12851 Ang CZ2(171) at 18.6569 32.0629 54.0773 in (null):W-9999 (20) and CE2(197) at 20.2362 32.6625 55.3722 in (null):Y-9999 (23) other bump:3.15555 Ang CH2(173) at 18.3983 32.6097 52.8077 in (null):W-9999 (20) and CE2(197) at 20.2362 32.6625 55.3722 in (null):Y-9999 (23) other bump:0.897385 Ang NE1(170) at 20.4505 31.9124 55.8158 in (null):W-9999 (20) and CE2(197) at 20.2362 32.6625 55.3722 in (null):Y-9999 (23) other bump:2.83647 Ang CE3(169) at 20.5943 33.7456 52.7752 in (null):W-9999 (20) and CE2(197) at 20.2362 32.6625 55.3722 in (null):Y-9999 (23) other bump:3.37128 Ang CZ3(172) at 19.3471 33.4343 52.2132 in (null):W-9999 (20) and CE2(197) at 20.2362 32.6625 55.3722 in (null):Y-9999 (23) other bump:1.92399 Ang CG(165) at 22.0101 33.2242 54.8829 in (null):W-9999 (20) and CE2(197) at 20.2362 32.6625 55.3722 in (null):Y-9999 (23) other bump:1.62066 Ang CD1(166) at 21.731 32.3795 55.9307 in (null):W-9999 (20) and CE2(197) at 20.2362 32.6625 55.3722 in (null):Y-9999 (23) other bump:1.72701 Ang CE2(168) at 19.9039 32.3397 54.6307 in (null):W-9999 (20) and CE1(196) at 18.591 31.2648 54.3096 in (null):Y-9999 (23) other bump:0.833834 Ang CZ2(171) at 18.6569 32.0629 54.0773 in (null):W-9999 (20) and CE1(196) at 18.591 31.2648 54.3096 in (null):Y-9999 (23) other bump:2.02525 Ang CH2(173) at 18.3983 32.6097 52.8077 in (null):W-9999 (20) and CE1(196) at 18.591 31.2648 54.3096 in (null):Y-9999 (23) other bump:2.47908 Ang NE1(170) at 20.4505 31.9124 55.8158 in (null):W-9999 (20) and CE1(196) at 18.591 31.2648 54.3096 in (null):Y-9999 (23) other bump:3.11019 Ang CZ3(172) at 19.3471 33.4343 52.2132 in (null):W-9999 (20) and CE1(196) at 18.591 31.2648 54.3096 in (null):Y-9999 (23) other bump:1.52128 Ang CD2(167) at 20.8899 33.1443 54.0117 in (null):W-9999 (20) and CD2(195) at 21.2455 31.8943 54.8026 in (null):Y-9999 (23) other bump:1.424 Ang CE2(168) at 19.9039 32.3397 54.6307 in (null):W-9999 (20) and CD2(195) at 21.2455 31.8943 54.8026 in (null):Y-9999 (23) other bump:2.6936 Ang CZ2(171) at 18.6569 32.0629 54.0773 in (null):W-9999 (20) and CD2(195) at 21.2455 31.8943 54.8026 in (null):Y-9999 (23) other bump:1.28802 Ang NE1(170) at 20.4505 31.9124 55.8158 in (null):W-9999 (20) and CD2(195) at 21.2455 31.8943 54.8026 in (null):Y-9999 (23) other bump:2.82164 Ang CE3(169) at 20.5943 33.7456 52.7752 in (null):W-9999 (20) and CD2(195) at 21.2455 31.8943 54.8026 in (null):Y-9999 (23) other bump:1.53615 Ang CG(165) at 22.0101 33.2242 54.8829 in (null):W-9999 (20) and CD2(195) at 21.2455 31.8943 54.8026 in (null):Y-9999 (23) other bump:1.32052 Ang CD1(166) at 21.731 32.3795 55.9307 in (null):W-9999 (20) and CD2(195) at 21.2455 31.8943 54.8026 in (null):Y-9999 (23) other bump:2.92413 Ang CB(164) at 23.3019 33.9626 54.5932 in (null):W-9999 (20) and CD2(195) at 21.2455 31.8943 54.8026 in (null):Y-9999 (23) other bump:2.9491 Ang CD2(167) at 20.8899 33.1443 54.0117 in (null):W-9999 (20) and CD1(194) at 19.5998 30.5052 53.7507 in (null):Y-9999 (23) other bump:2.05726 Ang CE2(168) at 19.9039 32.3397 54.6307 in (null):W-9999 (20) and CD1(194) at 19.5998 30.5052 53.7507 in (null):Y-9999 (23) other bump:1.84992 Ang CZ2(171) at 18.6569 32.0629 54.0773 in (null):W-9999 (20) and CD1(194) at 19.5998 30.5052 53.7507 in (null):Y-9999 (23) other bump:2.60038 Ang CH2(173) at 18.3983 32.6097 52.8077 in (null):W-9999 (20) and CD1(194) at 19.5998 30.5052 53.7507 in (null):Y-9999 (23) other bump:2.63977 Ang NE1(170) at 20.4505 31.9124 55.8158 in (null):W-9999 (20) and CD1(194) at 19.5998 30.5052 53.7507 in (null):Y-9999 (23) other bump:2.33652 Ang CD2(167) at 20.8899 33.1443 54.0117 in (null):W-9999 (20) and CG(193) at 20.9463 30.8086 53.9839 in (null):Y-9999 (23) other bump:1.96191 Ang CE2(168) at 19.9039 32.3397 54.6307 in (null):W-9999 (20) and CG(193) at 20.9463 30.8086 53.9839 in (null):Y-9999 (23) other bump:2.61214 Ang CZ2(171) at 18.6569 32.0629 54.0773 in (null):W-9999 (20) and CG(193) at 20.9463 30.8086 53.9839 in (null):Y-9999 (23) other bump:2.19543 Ang NE1(170) at 20.4505 31.9124 55.8158 in (null):W-9999 (20) and CG(193) at 20.9463 30.8086 53.9839 in (null):Y-9999 (23) other bump:3.19545 Ang CE3(169) at 20.5943 33.7456 52.7752 in (null):W-9999 (20) and CG(193) at 20.9463 30.8086 53.9839 in (null):Y-9999 (23) other bump:2.78841 Ang CG(165) at 22.0101 33.2242 54.8829 in (null):W-9999 (20) and CG(193) at 20.9463 30.8086 53.9839 in (null):Y-9999 (23) other bump:2.62175 Ang CD1(166) at 21.731 32.3795 55.9307 in (null):W-9999 (20) and CG(193) at 20.9463 30.8086 53.9839 in (null):Y-9999 (23) neighbor-bump: 2.97558 Ang CD1(166) at 21.731 32.3795 55.9307 in (null):W-9999 (20) and C(182) at 23.644 30.909 57.672 in (null):T-9999 (21) neighbor-bump: 2.62519 Ang CD1(166) at 21.731 32.3795 55.9307 in (null):W-9999 (20) and O(181) at 23.177 31.964 58.082 in (null):T-9999 (21) other bump:2.46409 Ang CB(122) at 25.5957 37.1965 41.5759 in (null):F-9999 (16) and OH(152) at 27.9332 36.9024 42.298 in (null):Y-9999 (18) other bump:2.06163 Ang CG(123) at 26.7185 36.8809 40.6323 in (null):F-9999 (16) and OH(152) at 27.9332 36.9024 42.298 in (null):Y-9999 (18) other bump:1.26437 Ang CD2(125) at 28.0364 37.0743 41.0496 in (null):F-9999 (16) and OH(152) at 27.9332 36.9024 42.298 in (null):Y-9999 (18) other bump:2.41749 Ang CE2(127) at 29.1147 36.8366 40.1899 in (null):F-9999 (16) and OH(152) at 27.9332 36.9024 42.298 in (null):Y-9999 (18) other bump:2.66855 Ang CB(122) at 25.5957 37.1965 41.5759 in (null):F-9999 (16) and CZ(151) at 27.3446 36.6871 43.5261 in (null):Y-9999 (18) other bump:2.96702 Ang CG(123) at 26.7185 36.8809 40.6323 in (null):F-9999 (16) and CZ(151) at 27.3446 36.6871 43.5261 in (null):Y-9999 (18) other bump:2.60028 Ang CD2(125) at 28.0364 37.0743 41.0496 in (null):F-9999 (16) and CZ(151) at 27.3446 36.6871 43.5261 in (null):Y-9999 (18) other bump:3.14836 Ang C(130) at 23.373 36.732 42.363 in (null):F-9999 (16) and CE1(149) at 26.1277 37.2796 43.7857 in (null):Y-9999 (18) other bump:2.27441 Ang CB(122) at 25.5957 37.1965 41.5759 in (null):F-9999 (16) and CE1(149) at 26.1277 37.2796 43.7857 in (null):Y-9999 (18) other bump:3.05446 Ang SD(14) at 28.7842 30.2275 38.4479 in (null):M-9999 (2) and OD2(28) at 25.8418 29.8831 37.7042 in (null):D-9999 (4) other bump:1.86888 Ang CE(15) at 27.2116 30.9079 38.4566 in (null):M-9999 (2) and OD2(28) at 25.8418 29.8831 37.7042 in (null):D-9999 (4) neighbor-bump: 2.30791 Ang O(21) at 24.104 28.82 39.453 in (null):A-9999 (3) and CG(26) at 24.6139 30.0808 37.5884 in (null):D-9999 (4) other bump:2.86115 Ang CE(15) at 27.2116 30.9079 38.4566 in (null):M-9999 (2) and CG(26) at 24.6139 30.0808 37.5884 in (null):D-9999 (4) T0159 117 :ELKPGK 1qo7A 134 :EYTPET Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 8 residues T0159 123 :DVVWLQVPFSALPGDKNAD 1qo7A 143 :HLVVPSLPGYTFSSGPPLD Fragment has 69 clashes (null) has 69 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 21 residues other bump:3.11103 Ang CG(113) at 40.4417 27.8377 50.371 in (null):D-9999 (15) and CA(128) at 42.894 28.793 52.03 in (null):N-9999 (17) other bump:2.79465 Ang OD1(114) at 41.1953 26.9466 50.7989 in (null):D-9999 (15) and CA(128) at 42.894 28.793 52.03 in (null):N-9999 (17) other bump:3.18201 Ang CB(112) at 38.9817 27.756 50.7193 in (null):D-9999 (15) and N(127) at 41.5 29.239 51.978 in (null):N-9999 (17) other bump:2.38034 Ang CG(113) at 40.4417 27.8377 50.371 in (null):D-9999 (15) and N(127) at 41.5 29.239 51.978 in (null):N-9999 (17) neighbor-bump: 2.34531 Ang CB(112) at 38.9817 27.756 50.7193 in (null):D-9999 (15) and C(126) at 40.491 28.445 52.377 in (null):K-9999 (16) other bump:2.79173 Ang CE2(76) at 38.0441 28.7561 53.6845 in (null):F-9999 (9) and C(126) at 40.491 28.445 52.377 in (null):K-9999 (16) other bump:3.1777 Ang CZ(77) at 38.0529 30.1393 53.5097 in (null):F-9999 (9) and C(126) at 40.491 28.445 52.377 in (null):K-9999 (16) neighbor-bump: 2.09652 Ang CG(113) at 40.4417 27.8377 50.371 in (null):D-9999 (15) and C(126) at 40.491 28.445 52.377 in (null):K-9999 (16) neighbor-bump: 2.28723 Ang OD1(114) at 41.1953 26.9466 50.7989 in (null):D-9999 (15) and C(126) at 40.491 28.445 52.377 in (null):K-9999 (16) neighbor-bump: 2.74612 Ang OD2(115) at 40.8433 28.789 49.6754 in (null):D-9999 (15) and C(126) at 40.491 28.445 52.377 in (null):K-9999 (16) neighbor-bump: 2.73746 Ang CB(112) at 38.9817 27.756 50.7193 in (null):D-9999 (15) and O(125) at 40.688 27.31 52.813 in (null):K-9999 (16) neighbor-bump: 2.51052 Ang CG(113) at 40.4417 27.8377 50.371 in (null):D-9999 (15) and O(125) at 40.688 27.31 52.813 in (null):K-9999 (16) neighbor-bump: 2.10852 Ang OD1(114) at 41.1953 26.9466 50.7989 in (null):D-9999 (15) and O(125) at 40.688 27.31 52.813 in (null):K-9999 (16) other bump:2.62013 Ang CE1(75) at 36.8473 30.8258 53.3739 in (null):F-9999 (9) and NZ(124) at 36.3478 33.0856 54.6022 in (null):K-9999 (16) other bump:2.64578 Ang CD1(73) at 35.6359 30.1188 53.4144 in (null):F-9999 (9) and CE(123) at 36.2987 32.667 53.1549 in (null):K-9999 (16) other bump:1.93368 Ang CE1(75) at 36.8473 30.8258 53.3739 in (null):F-9999 (9) and CE(123) at 36.2987 32.667 53.1549 in (null):K-9999 (16) other bump:2.68954 Ang CD1(73) at 35.6359 30.1188 53.4144 in (null):F-9999 (9) and CD(122) at 37.5483 31.8941 52.7629 in (null):K-9999 (16) other bump:1.4163 Ang CE1(75) at 36.8473 30.8258 53.3739 in (null):F-9999 (9) and CD(122) at 37.5483 31.8941 52.7629 in (null):K-9999 (16) other bump:1.97272 Ang CZ(77) at 38.0529 30.1393 53.5097 in (null):F-9999 (9) and CD(122) at 37.5483 31.8941 52.7629 in (null):K-9999 (16) other bump:3.02211 Ang CG(72) at 35.6164 28.7404 53.5876 in (null):F-9999 (9) and CG(121) at 37.8144 30.8063 53.7714 in (null):K-9999 (16) other bump:2.31216 Ang CD1(73) at 35.6359 30.1188 53.4144 in (null):F-9999 (9) and CG(121) at 37.8144 30.8063 53.7714 in (null):K-9999 (16) other bump:1.04577 Ang CE1(75) at 36.8473 30.8258 53.3739 in (null):F-9999 (9) and CG(121) at 37.8144 30.8063 53.7714 in (null):K-9999 (16) other bump:2.06483 Ang CE2(76) at 38.0441 28.7561 53.6845 in (null):F-9999 (9) and CG(121) at 37.8144 30.8063 53.7714 in (null):K-9999 (16) other bump:0.755145 Ang CZ(77) at 38.0529 30.1393 53.5097 in (null):F-9999 (9) and CG(121) at 37.8144 30.8063 53.7714 in (null):K-9999 (16) other bump:3.03231 Ang CD2(74) at 36.8281 28.0638 53.7219 in (null):F-9999 (9) and CB(120) at 39.106 30.0527 53.4974 in (null):K-9999 (16) other bump:2.39054 Ang CE1(75) at 36.8473 30.8258 53.3739 in (null):F-9999 (9) and CB(120) at 39.106 30.0527 53.4974 in (null):K-9999 (16) other bump:1.68635 Ang CE2(76) at 38.0441 28.7561 53.6845 in (null):F-9999 (9) and CB(120) at 39.106 30.0527 53.4974 in (null):K-9999 (16) other bump:1.05673 Ang CZ(77) at 38.0529 30.1393 53.5097 in (null):F-9999 (9) and CB(120) at 39.106 30.0527 53.4974 in (null):K-9999 (16) neighbor-bump: 2.00409 Ang CB(112) at 38.9817 27.756 50.7193 in (null):D-9999 (15) and CA(119) at 39.072 29.01 52.28 in (null):K-9999 (16) other bump:2.83007 Ang CD2(74) at 36.8281 28.0638 53.7219 in (null):F-9999 (9) and CA(119) at 39.072 29.01 52.28 in (null):K-9999 (16) other bump:1.75889 Ang CE2(76) at 38.0441 28.7561 53.6845 in (null):F-9999 (9) and CA(119) at 39.072 29.01 52.28 in (null):K-9999 (16) other bump:1.95599 Ang CZ(77) at 38.0529 30.1393 53.5097 in (null):F-9999 (9) and CA(119) at 39.072 29.01 52.28 in (null):K-9999 (16) neighbor-bump: 2.62581 Ang CG(113) at 40.4417 27.8377 50.371 in (null):D-9999 (15) and CA(119) at 39.072 29.01 52.28 in (null):K-9999 (16) other bump:2.75215 Ang CG(72) at 35.6164 28.7404 53.5876 in (null):F-9999 (9) and N(118) at 38.094 27.982 52.66 in (null):K-9999 (16) neighbor-bump: 2.14601 Ang CB(112) at 38.9817 27.756 50.7193 in (null):D-9999 (15) and N(118) at 38.094 27.982 52.66 in (null):K-9999 (16) other bump:1.6543 Ang CD2(74) at 36.8281 28.0638 53.7219 in (null):F-9999 (9) and N(118) at 38.094 27.982 52.66 in (null):K-9999 (16) other bump:1.28503 Ang CE2(76) at 38.0441 28.7561 53.6845 in (null):F-9999 (9) and N(118) at 38.094 27.982 52.66 in (null):K-9999 (16) other bump:2.31895 Ang CZ(77) at 38.0529 30.1393 53.5097 in (null):F-9999 (9) and N(118) at 38.094 27.982 52.66 in (null):K-9999 (16) other bump:3.28837 Ang CG(72) at 35.6164 28.7404 53.5876 in (null):F-9999 (9) and C(117) at 37.788 26.873 51.972 in (null):D-9999 (15) self-bump: 1.94265 Ang CB(112) at 38.9817 27.756 50.7193 in (null):D-9999 (15) and C(117) at 37.788 26.873 51.972 in (null):D-9999 (15) other bump:2.32408 Ang CD2(74) at 36.8281 28.0638 53.7219 in (null):F-9999 (9) and C(117) at 37.788 26.873 51.972 in (null):D-9999 (15) other bump:2.55818 Ang CE2(76) at 38.0441 28.7561 53.6845 in (null):F-9999 (9) and C(117) at 37.788 26.873 51.972 in (null):D-9999 (15) other bump:2.41398 Ang CD2(74) at 36.8281 28.0638 53.7219 in (null):F-9999 (9) and O(116) at 36.968 26.054 52.392 in (null):D-9999 (15) self-bump: 1.22814 Ang CA(111) at 38.511 26.623 50.664 in (null):D-9999 (15) and CB(112) at 38.9817 27.756 50.7193 in (null):D-9999 (15) other bump:2.99837 Ang CB(48) at 28.6348 27.0218 46.6787 in (null):Q-9999 (6) and CD(103) at 30.6766 24.935 47.3617 in (null):P-9999 (13) other bump:1.69164 Ang OE1(51) at 29.1614 24.1871 47.4425 in (null):Q-9999 (6) and CD(103) at 30.6766 24.935 47.3617 in (null):P-9999 (13) other bump:2.16159 Ang CG(49) at 29.3238 26.526 47.9195 in (null):Q-9999 (6) and CD(103) at 30.6766 24.935 47.3617 in (null):P-9999 (13) other bump:1.90044 Ang CD(50) at 29.0119 25.0813 48.2668 in (null):Q-9999 (6) and CD(103) at 30.6766 24.935 47.3617 in (null):P-9999 (13) other bump:2.10727 Ang O(84) at 30.435 25.194 49.439 in (null):S-9999 (10) and CD(103) at 30.6766 24.935 47.3617 in (null):P-9999 (13) other bump:2.54447 Ang CB(48) at 28.6348 27.0218 46.6787 in (null):Q-9999 (6) and CG(102) at 31.0577 26.2449 46.6616 in (null):P-9999 (13) other bump:2.16048 Ang CG(49) at 29.3238 26.526 47.9195 in (null):Q-9999 (6) and CG(102) at 31.0577 26.2449 46.6616 in (null):P-9999 (13) other bump:2.84881 Ang CD(50) at 29.0119 25.0813 48.2668 in (null):Q-9999 (6) and CG(102) at 31.0577 26.2449 46.6616 in (null):P-9999 (13) other bump:2.71924 Ang OE1(51) at 29.1614 24.1871 47.4425 in (null):Q-9999 (6) and CA(92) at 30.71 21.99 47.032 in (null):L-9999 (12) other bump:1.93946 Ang OE1(51) at 29.1614 24.1871 47.4425 in (null):Q-9999 (6) and N(91) at 29.821 22.475 48.071 in (null):L-9999 (12) other bump:2.73605 Ang CD(50) at 29.0119 25.0813 48.2668 in (null):Q-9999 (6) and N(91) at 29.821 22.475 48.071 in (null):L-9999 (12) other bump:2.81335 Ang OE1(51) at 29.1614 24.1871 47.4425 in (null):Q-9999 (6) and C(90) at 30.159 22.381 49.355 in (null):A-9999 (11) other bump:3.12921 Ang CD(50) at 29.0119 25.0813 48.2668 in (null):Q-9999 (6) and C(90) at 30.159 22.381 49.355 in (null):A-9999 (11) other bump:2.9176 Ang OE1(51) at 29.1614 24.1871 47.4425 in (null):Q-9999 (6) and CB(88) at 27.735 23.004 49.696 in (null):A-9999 (11) other bump:2.82639 Ang CD(50) at 29.0119 25.0813 48.2668 in (null):Q-9999 (6) and CB(88) at 27.735 23.004 49.696 in (null):A-9999 (11) other bump:2.04068 Ang NE2(52) at 28.5877 24.8478 49.5019 in (null):Q-9999 (6) and CB(88) at 27.735 23.004 49.696 in (null):A-9999 (11) other bump:3.07415 Ang CD(50) at 29.0119 25.0813 48.2668 in (null):Q-9999 (6) and CA(87) at 29.132 22.851 50.379 in (null):A-9999 (11) other bump:2.24787 Ang NE2(52) at 28.5877 24.8478 49.5019 in (null):Q-9999 (6) and CA(87) at 29.132 22.851 50.379 in (null):A-9999 (11) other bump:3.08623 Ang CD(50) at 29.0119 25.0813 48.2668 in (null):Q-9999 (6) and N(86) at 29.483 24.044 51.135 in (null):A-9999 (11) other bump:2.02849 Ang NE2(52) at 28.5877 24.8478 49.5019 in (null):Q-9999 (6) and N(86) at 29.483 24.044 51.135 in (null):A-9999 (11) other bump:3.15392 Ang CG(49) at 29.3238 26.526 47.9195 in (null):Q-9999 (6) and C(85) at 30.108 25.096 50.619 in (null):S-9999 (10) other bump:2.59514 Ang CD(50) at 29.0119 25.0813 48.2668 in (null):Q-9999 (6) and C(85) at 30.108 25.096 50.619 in (null):S-9999 (10) other bump:1.90288 Ang NE2(52) at 28.5877 24.8478 49.5019 in (null):Q-9999 (6) and C(85) at 30.108 25.096 50.619 in (null):S-9999 (10) other bump:2.30606 Ang CG(49) at 29.3238 26.526 47.9195 in (null):Q-9999 (6) and O(84) at 30.435 25.194 49.439 in (null):S-9999 (10) other bump:1.84719 Ang CD(50) at 29.0119 25.0813 48.2668 in (null):Q-9999 (6) and O(84) at 30.435 25.194 49.439 in (null):S-9999 (10) T0159 148 :ANYG 1qo7A 162 :KDFG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 5 residues Number of specific fragments= 12 total=119 Number of alignments=29 # Reading fragments from alignment file # T0159 read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1qo7A/T0159-1qo7A-2track-protein-STR-global-adpstyle1.pw.a2m.gz # 1qo7A read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1qo7A/T0159-1qo7A-2track-protein-STR-global-adpstyle1.pw.a2m.gz # found chain 1qo7A in template set T0159 1 :KKFYREGVFVNGAAQGYLIDKKTADQYKITNIAQLKD 1qo7A 3 :KAFAKFPSSASISPNPFTVSIPDEQLDDLKTLVRLSK Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 38 residues other bump:2.47557 Ang O(258) at 25.533 9.434 65.645 in (null):I-9999 (31) and CG(285) at 25.7622 11.3445 67.2025 in (null):K-9999 (35) other bump:2.11692 Ang CD(165) at 26.4378 11.6591 51.3807 in (null):K-9999 (20) and OE1(204) at 24.7042 11.1119 52.4654 in (null):Q-9999 (25) other bump:3.00138 Ang N(0) at 19.817 19.751 30.128 in (null):K-9999 (0) and CE2(36) at 21.2886 20.8382 32.5072 in (null):Y-9999 (3) other bump:3.14339 Ang CA(1) at 20.757 20.664 29.414 in (null):K-9999 (0) and CE2(36) at 21.2886 20.8382 32.5072 in (null):Y-9999 (3) other bump:2.81636 Ang CA(1) at 20.757 20.664 29.414 in (null):K-9999 (0) and CD2(34) at 22.1384 21.5815 31.6904 in (null):Y-9999 (3) T0159 38 :PKIAKLFDTNGDGK 1qo7A 42 :PPTYESLQADGRFG Fragment has 25 clashes (null) has 25 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 16 residues other bump:2.70589 Ang CD2(45) at 17.8511 21.2618 75.9386 in (null):L-9999 (6) and CE(103) at 19.0997 23.6421 76.2502 in (null):K-9999 (14) neighbor-bump: 2.76459 Ang C(97) at 17.391 27.779 74.821 in (null):G-9999 (13) and CG(101) at 18.126 25.1385 74.4595 in (null):K-9999 (14) neighbor-bump: 2.22702 Ang O(96) at 18.492 27.267 75.003 in (null):G-9999 (13) and CG(101) at 18.126 25.1385 74.4595 in (null):K-9999 (14) neighbor-bump: 2.55716 Ang C(97) at 17.391 27.779 74.821 in (null):G-9999 (13) and CB(100) at 18.4969 26.0376 73.3098 in (null):K-9999 (14) neighbor-bump: 2.09243 Ang O(96) at 18.492 27.267 75.003 in (null):G-9999 (13) and CB(100) at 18.4969 26.0376 73.3098 in (null):K-9999 (14) other bump:2.43403 Ang CD(13) at 12.991 16.0323 79.3244 in (null):K-9999 (2) and CZ(56) at 13.9634 17.4229 81.0694 in (null):F-9999 (7) other bump:2.54247 Ang CE(14) at 11.8612 16.1945 80.3373 in (null):K-9999 (2) and CZ(56) at 13.9634 17.4229 81.0694 in (null):F-9999 (7) other bump:2.58851 Ang CA(10) at 16.263 16.468 80.362 in (null):K-9999 (2) and CZ(56) at 13.9634 17.4229 81.0694 in (null):F-9999 (7) other bump:1.81838 Ang CB(11) at 14.8837 15.8611 80.9274 in (null):K-9999 (2) and CZ(56) at 13.9634 17.4229 81.0694 in (null):F-9999 (7) other bump:2.58466 Ang CG(12) at 14.0876 15.1335 79.8761 in (null):K-9999 (2) and CZ(56) at 13.9634 17.4229 81.0694 in (null):F-9999 (7) other bump:2.69865 Ang C(17) at 16.635 17.467 81.448 in (null):K-9999 (2) and CZ(56) at 13.9634 17.4229 81.0694 in (null):F-9999 (7) other bump:2.79976 Ang N(18) at 16.431 18.743 81.153 in (null):I-9999 (3) and CZ(56) at 13.9634 17.4229 81.0694 in (null):F-9999 (7) other bump:1.61702 Ang CD(13) at 12.991 16.0323 79.3244 in (null):K-9999 (2) and CE2(55) at 13.2924 17.5014 79.9289 in (null):F-9999 (7) other bump:1.98071 Ang CE(14) at 11.8612 16.1945 80.3373 in (null):K-9999 (2) and CE2(55) at 13.2924 17.5014 79.9289 in (null):F-9999 (7) other bump:3.17491 Ang CA(10) at 16.263 16.468 80.362 in (null):K-9999 (2) and CE2(55) at 13.2924 17.5014 79.9289 in (null):F-9999 (7) other bump:2.49405 Ang CB(11) at 14.8837 15.8611 80.9274 in (null):K-9999 (2) and CE2(55) at 13.2924 17.5014 79.9289 in (null):F-9999 (7) other bump:2.49841 Ang CG(12) at 14.0876 15.1335 79.8761 in (null):K-9999 (2) and CE2(55) at 13.2924 17.5014 79.9289 in (null):F-9999 (7) other bump:2.95341 Ang CB(11) at 14.8837 15.8611 80.9274 in (null):K-9999 (2) and CE1(54) at 13.851 18.4247 81.9685 in (null):F-9999 (7) other bump:2.98974 Ang C(17) at 16.635 17.467 81.448 in (null):K-9999 (2) and CE1(54) at 13.851 18.4247 81.9685 in (null):F-9999 (7) other bump:2.72442 Ang N(18) at 16.431 18.743 81.153 in (null):I-9999 (3) and CE1(54) at 13.851 18.4247 81.9685 in (null):F-9999 (7) other bump:2.94721 Ang C(25) at 15.584 20.807 82.056 in (null):I-9999 (3) and CE1(54) at 13.851 18.4247 81.9685 in (null):F-9999 (7) other bump:2.67208 Ang CD(13) at 12.991 16.0323 79.3244 in (null):K-9999 (2) and CD2(53) at 12.4857 18.6419 79.597 in (null):F-9999 (7) other bump:2.63212 Ang CE(14) at 11.8612 16.1945 80.3373 in (null):K-9999 (2) and CD2(53) at 12.4857 18.6419 79.597 in (null):F-9999 (7) other bump:2.25004 Ang O(24) at 14.788 20.817 81.119 in (null):I-9999 (3) and CD1(52) at 13.0186 19.5408 81.6694 in (null):F-9999 (7) other bump:3.04354 Ang CG1(21) at 17.9912 21.1926 80.4202 in (null):I-9999 (3) and CG(43) at 17.7147 20.8738 77.4061 in (null):L-9999 (6) T0159 52 :ADLTG 1qo7A 89 :TEIEG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 7 residues T0159 57 :CNPGWGCE 1qo7A 160 :LDKDFGLM Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 10 residues T0159 65 :GAINHQLAAYELTNTVTHNQGNYAAMMADTISRYKEGKPVFYYT 1qo7A 171 :RVVDQLMKDLGFGSGYIIQGGDIGSFVGRLLGVGFDACKAVHLN Fragment has 132 clashes (null) has 132 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 46 residues other bump:2.81285 Ang CB(208) at 25.3397 42.019 48.2977 in (null):A-9999 (28) and OH(340) at 25.4736 44.8277 48.2235 in (null):Y-9999 (43) other bump:2.37102 Ang CG(311) at 23.6407 45.1239 46.7488 in (null):F-9999 (41) and OH(340) at 25.4736 44.8277 48.2235 in (null):Y-9999 (43) other bump:2.13778 Ang CD1(312) at 24.3225 43.9112 46.6726 in (null):F-9999 (41) and OH(340) at 25.4736 44.8277 48.2235 in (null):Y-9999 (43) other bump:2.11548 Ang CE1(314) at 24.3953 43.061 47.7858 in (null):F-9999 (41) and OH(340) at 25.4736 44.8277 48.2235 in (null):Y-9999 (43) other bump:2.54408 Ang CD2(313) at 23.0253 45.4627 47.9495 in (null):F-9999 (41) and OH(340) at 25.4736 44.8277 48.2235 in (null):Y-9999 (43) other bump:2.52504 Ang CE2(315) at 23.0994 44.6188 49.0575 in (null):F-9999 (41) and OH(340) at 25.4736 44.8277 48.2235 in (null):Y-9999 (43) other bump:2.32729 Ang CZ(316) at 23.7823 43.416 48.9739 in (null):F-9999 (41) and OH(340) at 25.4736 44.8277 48.2235 in (null):Y-9999 (43) other bump:2.03963 Ang O(209) at 27.313 44.489 47.41 in (null):A-9999 (28) and OH(340) at 25.4736 44.8277 48.2235 in (null):Y-9999 (43) other bump:1.97859 Ang C(210) at 27.132 43.762 48.393 in (null):A-9999 (28) and OH(340) at 25.4736 44.8277 48.2235 in (null):Y-9999 (43) other bump:2.29217 Ang N(211) at 27.179 44.231 49.634 in (null):D-9999 (29) and OH(340) at 25.4736 44.8277 48.2235 in (null):Y-9999 (43) other bump:2.70407 Ang CA(212) at 27.465 45.643 49.861 in (null):D-9999 (29) and OH(340) at 25.4736 44.8277 48.2235 in (null):Y-9999 (43) other bump:2.89419 Ang CB(208) at 25.3397 42.019 48.2977 in (null):A-9999 (28) and CZ(339) at 24.2497 44.6463 48.8321 in (null):Y-9999 (43) other bump:2.22238 Ang CG(311) at 23.6407 45.1239 46.7488 in (null):F-9999 (41) and CZ(339) at 24.2497 44.6463 48.8321 in (null):Y-9999 (43) other bump:2.28234 Ang CD1(312) at 24.3225 43.9112 46.6726 in (null):F-9999 (41) and CZ(339) at 24.2497 44.6463 48.8321 in (null):Y-9999 (43) other bump:1.90495 Ang CE1(314) at 24.3953 43.061 47.7858 in (null):F-9999 (41) and CZ(339) at 24.2497 44.6463 48.8321 in (null):Y-9999 (43) other bump:1.71604 Ang CD2(313) at 23.0253 45.4627 47.9495 in (null):F-9999 (41) and CZ(339) at 24.2497 44.6463 48.8321 in (null):Y-9999 (43) other bump:1.17251 Ang CE2(315) at 23.0994 44.6188 49.0575 in (null):F-9999 (41) and CZ(339) at 24.2497 44.6463 48.8321 in (null):Y-9999 (43) other bump:1.32368 Ang CZ(316) at 23.7823 43.416 48.9739 in (null):F-9999 (41) and CZ(339) at 24.2497 44.6463 48.8321 in (null):Y-9999 (43) other bump:3.04671 Ang C(210) at 27.132 43.762 48.393 in (null):A-9999 (28) and CZ(339) at 24.2497 44.6463 48.8321 in (null):Y-9999 (43) other bump:2.68837 Ang O(188) at 25.747 42.941 51.877 in (null):A-9999 (25) and CE2(338) at 24.1253 43.7968 49.9111 in (null):Y-9999 (43) other bump:2.69047 Ang CB(208) at 25.3397 42.019 48.2977 in (null):A-9999 (28) and CE2(338) at 24.1253 43.7968 49.9111 in (null):Y-9999 (43) other bump:2.26516 Ang CE1(314) at 24.3953 43.061 47.7858 in (null):F-9999 (41) and CE2(338) at 24.1253 43.7968 49.9111 in (null):Y-9999 (43) other bump:2.79876 Ang CD2(313) at 23.0253 45.4627 47.9495 in (null):F-9999 (41) and CE2(338) at 24.1253 43.7968 49.9111 in (null):Y-9999 (43) other bump:1.5674 Ang CE2(315) at 23.0994 44.6188 49.0575 in (null):F-9999 (41) and CE2(338) at 24.1253 43.7968 49.9111 in (null):Y-9999 (43) other bump:1.06814 Ang CZ(316) at 23.7823 43.416 48.9739 in (null):F-9999 (41) and CE2(338) at 24.1253 43.7968 49.9111 in (null):Y-9999 (43) other bump:3.09688 Ang N(211) at 27.179 44.231 49.634 in (null):D-9999 (29) and CE2(338) at 24.1253 43.7968 49.9111 in (null):Y-9999 (43) other bump:2.89876 Ang CB(310) at 23.5991 46.0629 45.568 in (null):F-9999 (41) and CE1(337) at 23.1612 45.3326 48.3388 in (null):Y-9999 (43) other bump:1.67382 Ang CG(311) at 23.6407 45.1239 46.7488 in (null):F-9999 (41) and CE1(337) at 23.1612 45.3326 48.3388 in (null):Y-9999 (43) other bump:2.47901 Ang CD1(312) at 24.3225 43.9112 46.6726 in (null):F-9999 (41) and CE1(337) at 23.1612 45.3326 48.3388 in (null):Y-9999 (43) other bump:2.64367 Ang CE1(314) at 24.3953 43.061 47.7858 in (null):F-9999 (41) and CE1(337) at 23.1612 45.3326 48.3388 in (null):Y-9999 (43) other bump:0.432446 Ang CD2(313) at 23.0253 45.4627 47.9495 in (null):F-9999 (41) and CE1(337) at 23.1612 45.3326 48.3388 in (null):Y-9999 (43) other bump:1.01477 Ang CE2(315) at 23.0994 44.6188 49.0575 in (null):F-9999 (41) and CE1(337) at 23.1612 45.3326 48.3388 in (null):Y-9999 (43) other bump:2.11247 Ang CZ(316) at 23.7823 43.416 48.9739 in (null):F-9999 (41) and CE1(337) at 23.1612 45.3326 48.3388 in (null):Y-9999 (43) other bump:1.76662 Ang CE2(315) at 23.0994 44.6188 49.0575 in (null):F-9999 (41) and CD2(336) at 22.8778 43.6338 50.5072 in (null):Y-9999 (43) other bump:1.79345 Ang CZ(316) at 23.7823 43.416 48.9739 in (null):F-9999 (41) and CD2(336) at 22.8778 43.6338 50.5072 in (null):Y-9999 (43) other bump:1.51009 Ang CD2(313) at 23.0253 45.4627 47.9495 in (null):F-9999 (41) and CD1(335) at 21.9223 45.1625 48.9362 in (null):Y-9999 (43) other bump:1.30229 Ang CE2(315) at 23.0994 44.6188 49.0575 in (null):F-9999 (41) and CD1(335) at 21.9223 45.1625 48.9362 in (null):Y-9999 (43) other bump:2.55178 Ang CZ(316) at 23.7823 43.416 48.9739 in (null):F-9999 (41) and CD1(335) at 21.9223 45.1625 48.9362 in (null):Y-9999 (43) other bump:2.68388 Ang CD2(313) at 23.0253 45.4627 47.9495 in (null):F-9999 (41) and CG(334) at 21.7707 44.3165 50.0268 in (null):Y-9999 (43) other bump:1.67223 Ang CE2(315) at 23.0994 44.6188 49.0575 in (null):F-9999 (41) and CG(334) at 21.7707 44.3165 50.0268 in (null):Y-9999 (43) other bump:2.79718 Ang ND2(143) at 18.121 39.8251 46.4068 in (null):N-9999 (19) and CD1(323) at 16.7134 42.2376 46.5566 in (null):Y-9999 (42) other bump:2.19873 Ang CB(208) at 25.3397 42.019 48.2977 in (null):A-9999 (28) and CZ(316) at 23.7823 43.416 48.9739 in (null):F-9999 (41) other bump:2.44124 Ang CD2(133) at 25.1795 41.2297 46.3748 in (null):H-9999 (18) and CE1(314) at 24.3953 43.061 47.7858 in (null):F-9999 (41) other bump:1.49657 Ang CB(208) at 25.3397 42.019 48.2977 in (null):A-9999 (28) and CE1(314) at 24.3953 43.061 47.7858 in (null):F-9999 (41) other bump:2.60341 Ang CA(207) at 26.84 42.28 48.223 in (null):A-9999 (28) and CE1(314) at 24.3953 43.061 47.7858 in (null):F-9999 (41) other bump:2.88957 Ang C(210) at 27.132 43.762 48.393 in (null):A-9999 (28) and CE1(314) at 24.3953 43.061 47.7858 in (null):F-9999 (41) other bump:2.83085 Ang CD2(133) at 25.1795 41.2297 46.3748 in (null):H-9999 (18) and CD1(312) at 24.3225 43.9112 46.6726 in (null):F-9999 (41) other bump:2.69373 Ang CB(208) at 25.3397 42.019 48.2977 in (null):A-9999 (28) and CD1(312) at 24.3225 43.9112 46.6726 in (null):F-9999 (41) other bump:2.54713 Ang OG(237) at 26.0451 46.7712 45.5114 in (null):S-9999 (32) and CB(310) at 23.5991 46.0629 45.568 in (null):F-9999 (41) other bump:2.96429 Ang CG2(111) at 27.9037 47.0441 33.5837 in (null):T-9999 (15) and CD(298) at 27.356 48.569 36.066 in (null):P-9999 (39) other bump:2.79953 Ang CB(110) at 26.9593 45.8981 33.9272 in (null):T-9999 (15) and CG(297) at 26.268 47.509 36.11 in (null):P-9999 (39) other bump:3.04529 Ang CG2(111) at 27.9037 47.0441 33.5837 in (null):T-9999 (15) and CG(297) at 26.268 47.509 36.11 in (null):P-9999 (39) other bump:2.41413 Ang CG1(229) at 30.5032 41.9779 45.4992 in (null):I-9999 (31) and NZ(291) at 30.3839 40.894 43.3454 in (null):K-9999 (38) other bump:2.09739 Ang CD1(231) at 29.651 40.7301 45.3037 in (null):I-9999 (31) and NZ(291) at 30.3839 40.894 43.3454 in (null):K-9999 (38) other bump:2.62164 Ang CG2(230) at 29.5605 43.3712 43.5865 in (null):I-9999 (31) and NZ(291) at 30.3839 40.894 43.3454 in (null):K-9999 (38) other bump:2.94823 Ang CG1(229) at 30.5032 41.9779 45.4992 in (null):I-9999 (31) and CE(290) at 30.7901 42.0934 42.5673 in (null):K-9999 (38) other bump:2.04535 Ang CG2(230) at 29.5605 43.3712 43.5865 in (null):I-9999 (31) and CE(290) at 30.7901 42.0934 42.5673 in (null):K-9999 (38) other bump:3.179 Ang CG1(229) at 30.5032 41.9779 45.4992 in (null):I-9999 (31) and CD(289) at 29.7706 43.2216 42.6668 in (null):K-9999 (38) other bump:0.955145 Ang CG2(230) at 29.5605 43.3712 43.5865 in (null):I-9999 (31) and CD(289) at 29.7706 43.2216 42.6668 in (null):K-9999 (38) other bump:3.29105 Ang CA(227) at 30.549 44.511 45.593 in (null):I-9999 (31) and CD(289) at 29.7706 43.2216 42.6668 in (null):K-9999 (38) other bump:2.41342 Ang CB(228) at 29.76 43.2694 45.0798 in (null):I-9999 (31) and CD(289) at 29.7706 43.2216 42.6668 in (null):K-9999 (38) other bump:2.31793 Ang CG2(230) at 29.5605 43.3712 43.5865 in (null):I-9999 (31) and CG(288) at 29.1775 43.5518 41.3075 in (null):K-9999 (38) other bump:2.80133 Ang C(1) at 34.408 39.485 45.797 in (null):G-9999 (0) and NZ(269) at 35.8518 41.7311 44.9497 in (null):K-9999 (35) other bump:2.53899 Ang CA(3) at 36.621 39.314 44.838 in (null):G-9999 (1) and NZ(269) at 35.8518 41.7311 44.9497 in (null):K-9999 (35) neighbor-bump: 2.42398 Ang CD(244) at 32.4771 50.4721 50.5477 in (null):R-9999 (33) and OH(260) at 34.6928 51.0564 51.3381 in (null):Y-9999 (34) neighbor-bump: 1.15695 Ang NE(245) at 33.6072 51.2612 50.9945 in (null):R-9999 (33) and OH(260) at 34.6928 51.0564 51.3381 in (null):Y-9999 (34) neighbor-bump: 0.448942 Ang CZ(246) at 34.8694 50.8474 50.9822 in (null):R-9999 (33) and OH(260) at 34.6928 51.0564 51.3381 in (null):Y-9999 (34) neighbor-bump: 1.71198 Ang NH1(247) at 35.1829 49.6172 50.551 in (null):R-9999 (33) and OH(260) at 34.6928 51.0564 51.3381 in (null):Y-9999 (34) neighbor-bump: 1.30609 Ang NH2(248) at 35.8424 51.6751 51.3771 in (null):R-9999 (33) and OH(260) at 34.6928 51.0564 51.3381 in (null):Y-9999 (34) neighbor-bump: 2.75716 Ang CG(243) at 32.3165 50.5384 49.0057 in (null):R-9999 (33) and CZ(259) at 34.8009 50.3181 50.1809 in (null):Y-9999 (34) neighbor-bump: 2.35763 Ang CD(244) at 32.4771 50.4721 50.5477 in (null):R-9999 (33) and CZ(259) at 34.8009 50.3181 50.1809 in (null):Y-9999 (34) neighbor-bump: 1.72518 Ang NE(245) at 33.6072 51.2612 50.9945 in (null):R-9999 (33) and CZ(259) at 34.8009 50.3181 50.1809 in (null):Y-9999 (34) neighbor-bump: 0.962726 Ang CZ(246) at 34.8694 50.8474 50.9822 in (null):R-9999 (33) and CZ(259) at 34.8009 50.3181 50.1809 in (null):Y-9999 (34) neighbor-bump: 0.879848 Ang NH1(247) at 35.1829 49.6172 50.551 in (null):R-9999 (33) and CZ(259) at 34.8009 50.3181 50.1809 in (null):Y-9999 (34) neighbor-bump: 2.08739 Ang NH2(248) at 35.8424 51.6751 51.3771 in (null):R-9999 (33) and CZ(259) at 34.8009 50.3181 50.1809 in (null):Y-9999 (34) neighbor-bump: 1.97315 Ang CZ(246) at 34.8694 50.8474 50.9822 in (null):R-9999 (33) and CE2(258) at 35.8117 50.5934 49.2672 in (null):Y-9999 (34) neighbor-bump: 1.73105 Ang NH1(247) at 35.1829 49.6172 50.551 in (null):R-9999 (33) and CE2(258) at 35.8117 50.5934 49.2672 in (null):Y-9999 (34) neighbor-bump: 2.37123 Ang NH2(248) at 35.8424 51.6751 51.3771 in (null):R-9999 (33) and CE2(258) at 35.8117 50.5934 49.2672 in (null):Y-9999 (34) neighbor-bump: 2.98245 Ang CB(242) at 31.2925 49.5618 48.4747 in (null):R-9999 (33) and CE1(257) at 33.8828 49.3071 49.931 in (null):Y-9999 (34) neighbor-bump: 2.1967 Ang CG(243) at 32.3165 50.5384 49.0057 in (null):R-9999 (33) and CE1(257) at 33.8828 49.3071 49.931 in (null):Y-9999 (34) neighbor-bump: 1.92703 Ang CD(244) at 32.4771 50.4721 50.5477 in (null):R-9999 (33) and CE1(257) at 33.8828 49.3071 49.931 in (null):Y-9999 (34) neighbor-bump: 2.24172 Ang NE(245) at 33.6072 51.2612 50.9945 in (null):R-9999 (33) and CE1(257) at 33.8828 49.3071 49.931 in (null):Y-9999 (34) neighbor-bump: 2.10968 Ang CZ(246) at 34.8694 50.8474 50.9822 in (null):R-9999 (33) and CE1(257) at 33.8828 49.3071 49.931 in (null):Y-9999 (34) neighbor-bump: 1.47334 Ang NH1(247) at 35.1829 49.6172 50.551 in (null):R-9999 (33) and CE1(257) at 33.8828 49.3071 49.931 in (null):Y-9999 (34) neighbor-bump: 2.57552 Ang NH1(247) at 35.1829 49.6172 50.551 in (null):R-9999 (33) and CD2(256) at 35.9022 49.8439 48.0884 in (null):Y-9999 (34) neighbor-bump: 2.8812 Ang CB(242) at 31.2925 49.5618 48.4747 in (null):R-9999 (33) and CD1(255) at 33.981 48.5645 48.7552 in (null):Y-9999 (34) neighbor-bump: 2.59415 Ang CG(243) at 32.3165 50.5384 49.0057 in (null):R-9999 (33) and CD1(255) at 33.981 48.5645 48.7552 in (null):Y-9999 (34) neighbor-bump: 3.01891 Ang CD(244) at 32.4771 50.4721 50.5477 in (null):R-9999 (33) and CD1(255) at 33.981 48.5645 48.7552 in (null):Y-9999 (34) neighbor-bump: 2.40362 Ang NH1(247) at 35.1829 49.6172 50.551 in (null):R-9999 (33) and CD1(255) at 33.981 48.5645 48.7552 in (null):Y-9999 (34) other bump:2.08468 Ang CD2(133) at 25.1795 41.2297 46.3748 in (null):H-9999 (18) and CB(208) at 25.3397 42.019 48.2977 in (null):A-9999 (28) other bump:2.30912 Ang NE2(136) at 25.289 40.0552 47.084 in (null):H-9999 (18) and CB(208) at 25.3397 42.019 48.2977 in (null):A-9999 (28) other bump:3.0686 Ang CB(149) at 23.4485 39.7054 48.9957 in (null):Q-9999 (20) and CB(208) at 25.3397 42.019 48.2977 in (null):A-9999 (28) other bump:2.73266 Ang CG(150) at 24.3735 39.509 47.8142 in (null):Q-9999 (20) and CB(208) at 25.3397 42.019 48.2977 in (null):A-9999 (28) other bump:1.8026 Ang CD(151) at 25.6734 40.2788 47.9664 in (null):Q-9999 (20) and CB(208) at 25.3397 42.019 48.2977 in (null):A-9999 (28) other bump:1.68361 Ang NE2(153) at 25.9659 40.7263 49.1759 in (null):Q-9999 (20) and CB(208) at 25.3397 42.019 48.2977 in (null):A-9999 (28) other bump:2.26647 Ang OE1(152) at 26.3933 40.4902 46.9978 in (null):Q-9999 (20) and CB(208) at 25.3397 42.019 48.2977 in (null):A-9999 (28) other bump:2.6974 Ang CD2(133) at 25.1795 41.2297 46.3748 in (null):H-9999 (18) and CA(207) at 26.84 42.28 48.223 in (null):A-9999 (28) other bump:2.94152 Ang NE2(136) at 25.289 40.0552 47.084 in (null):H-9999 (18) and CA(207) at 26.84 42.28 48.223 in (null):A-9999 (28) other bump:2.33062 Ang CD(151) at 25.6734 40.2788 47.9664 in (null):Q-9999 (20) and CA(207) at 26.84 42.28 48.223 in (null):A-9999 (28) other bump:2.02143 Ang NE2(153) at 25.9659 40.7263 49.1759 in (null):Q-9999 (20) and CA(207) at 26.84 42.28 48.223 in (null):A-9999 (28) other bump:2.21451 Ang OE1(152) at 26.3933 40.4902 46.9978 in (null):Q-9999 (20) and CA(207) at 26.84 42.28 48.223 in (null):A-9999 (28) other bump:2.52278 Ang CD(151) at 25.6734 40.2788 47.9664 in (null):Q-9999 (20) and N(206) at 27.522 41.46 49.212 in (null):A-9999 (28) other bump:1.7208 Ang NE2(153) at 25.9659 40.7263 49.1759 in (null):Q-9999 (20) and N(206) at 27.522 41.46 49.212 in (null):A-9999 (28) other bump:1.66288 Ang CD1(16) at 30.0362 36.5839 46.4283 in (null):I-9999 (3) and CE(203) at 28.7809 37.1657 47.3508 in (null):M-9999 (27) other bump:1.82805 Ang CD1(16) at 30.0362 36.5839 46.4283 in (null):I-9999 (3) and SD(202) at 30.3929 37.2058 48.1099 in (null):M-9999 (27) other bump:3.1101 Ang CG1(14) at 30.8471 35.9864 45.2851 in (null):I-9999 (3) and SD(202) at 30.3929 37.2058 48.1099 in (null):M-9999 (27) other bump:2.83105 Ang CB(149) at 23.4485 39.7054 48.9957 in (null):Q-9999 (20) and C(184) at 25.294 39.002 51.024 in (null):A-9999 (24) other bump:2.61533 Ang NE2(153) at 25.9659 40.7263 49.1759 in (null):Q-9999 (20) and C(184) at 25.294 39.002 51.024 in (null):A-9999 (24) other bump:2.42942 Ang CB(149) at 23.4485 39.7054 48.9957 in (null):Q-9999 (20) and O(183) at 25.645 39.631 50.031 in (null):A-9999 (24) other bump:2.55844 Ang CG(150) at 24.3735 39.509 47.8142 in (null):Q-9999 (20) and O(183) at 25.645 39.631 50.031 in (null):A-9999 (24) other bump:2.16407 Ang CD(151) at 25.6734 40.2788 47.9664 in (null):Q-9999 (20) and O(183) at 25.645 39.631 50.031 in (null):A-9999 (24) other bump:1.4261 Ang NE2(153) at 25.9659 40.7263 49.1759 in (null):Q-9999 (20) and O(183) at 25.645 39.631 50.031 in (null):A-9999 (24) other bump:2.2988 Ang NE2(136) at 25.289 40.0552 47.084 in (null):H-9999 (18) and NE2(153) at 25.9659 40.7263 49.1759 in (null):Q-9999 (20) other bump:1.55186 Ang CD2(133) at 25.1795 41.2297 46.3748 in (null):H-9999 (18) and OE1(152) at 26.3933 40.4902 46.9978 in (null):Q-9999 (20) other bump:1.9967 Ang CE1(135) at 25.2574 39.0081 46.2906 in (null):H-9999 (18) and OE1(152) at 26.3933 40.4902 46.9978 in (null):Q-9999 (20) other bump:1.18996 Ang NE2(136) at 25.289 40.0552 47.084 in (null):H-9999 (18) and OE1(152) at 26.3933 40.4902 46.9978 in (null):Q-9999 (20) other bump:3.02372 Ang CG(132) at 25.067 40.8725 45.0641 in (null):H-9999 (18) and CD(151) at 25.6734 40.2788 47.9664 in (null):Q-9999 (20) other bump:1.9186 Ang CD2(133) at 25.1795 41.2297 46.3748 in (null):H-9999 (18) and CD(151) at 25.6734 40.2788 47.9664 in (null):Q-9999 (20) other bump:2.14374 Ang CE1(135) at 25.2574 39.0081 46.2906 in (null):H-9999 (18) and CD(151) at 25.6734 40.2788 47.9664 in (null):Q-9999 (20) other bump:0.988024 Ang NE2(136) at 25.289 40.0552 47.084 in (null):H-9999 (18) and CD(151) at 25.6734 40.2788 47.9664 in (null):Q-9999 (20) other bump:2.38382 Ang CD2(133) at 25.1795 41.2297 46.3748 in (null):H-9999 (18) and CG(150) at 24.3735 39.509 47.8142 in (null):Q-9999 (20) other bump:1.83126 Ang CE1(135) at 25.2574 39.0081 46.2906 in (null):H-9999 (18) and CG(150) at 24.3735 39.509 47.8142 in (null):Q-9999 (20) other bump:1.2922 Ang NE2(136) at 25.289 40.0552 47.084 in (null):H-9999 (18) and CG(150) at 24.3735 39.509 47.8142 in (null):Q-9999 (20) other bump:2.67664 Ang NE2(136) at 25.289 40.0552 47.084 in (null):H-9999 (18) and CB(149) at 23.4485 39.7054 48.9957 in (null):Q-9999 (20) neighbor-bump: 1.75282 Ang O(106) at 28.397 46.25 32.101 in (null):N-9999 (14) and CG2(111) at 27.9037 47.0441 33.5837 in (null):T-9999 (15) neighbor-bump: 2.57224 Ang C(107) at 28.977 45.163 32.196 in (null):N-9999 (14) and CG2(111) at 27.9037 47.0441 33.5837 in (null):T-9999 (15) self-bump: 2.13543 Ang CB(102) at 29.0771 44.8147 30.0915 in (null):N-9999 (14) and C(107) at 28.977 45.163 32.196 in (null):N-9999 (14) other bump:3.04796 Ang CG(40) at 31.3708 32.6312 39.1512 in (null):Q-9999 (6) and CZ(72) at 30.7862 30.8265 36.7655 in (null):Y-9999 (10) other bump:2.24723 Ang CG(40) at 31.3708 32.6312 39.1512 in (null):Q-9999 (6) and CE1(70) at 31.2405 32.123 36.9661 in (null):Y-9999 (10) other bump:3.1629 Ang C(45) at 32.297 35.05 37.532 in (null):Q-9999 (6) and CE1(70) at 31.2405 32.123 36.9661 in (null):Y-9999 (10) other bump:1.94459 Ang O(44) at 32.179 34.559 36.406 in (null):Q-9999 (6) and CD1(68) at 30.938 33.1101 36.0291 in (null):Y-9999 (10) other bump:2.80512 Ang C(45) at 32.297 35.05 37.532 in (null):Q-9999 (6) and CD1(68) at 30.938 33.1101 36.0291 in (null):Y-9999 (10) T0159 124 :VVWLQVP 1qo7A 215 :LCAMRAP Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 9 residues other bump:2.56283 Ang CG1(5) at 20.7649 41.1927 57.0197 in (null):V-9999 (1) and NE1(24) at 21.2179 40.7924 59.5102 in (null):W-9999 (3) other bump:2.56428 Ang CG1(5) at 20.7649 41.1927 57.0197 in (null):V-9999 (1) and CD1(20) at 22.007 41.8599 59.1615 in (null):W-9999 (3) T0159 132 :SALPGDKNADTKLPNG 1qo7A 222 :PEGPSIESLSAAEKEG Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 18 residues other bump:2.65725 Ang OD1(66) at 6.74625 52.5822 62.5658 in (null):D-9999 (10) and CG(89) at 9.01394 52.0013 61.3084 in (null):L-9999 (13) neighbor-bump: 2.56235 Ang CB(15) at 20.5129 59.2416 60.7157 in (null):L-9999 (3) and CD(25) at 18.034 59.328 60.073 in (null):P-9999 (4) self-bump: 1.35472 Ang CA(3) at 25.068 58.965 63.084 in (null):S-9999 (1) and CB(4) at 26.3672 59.2261 62.8027 in (null):S-9999 (1) Number of specific fragments= 7 total=126 Number of alignments=30 # Reading fragments from alignment file # T0159 read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1f2vA/T0159-1f2vA-2track-protein-STR-global-adpstyle5.pw.a2m.gz # 1f2vA read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1f2vA/T0159-1f2vA-2track-protein-STR-global-adpstyle5.pw.a2m.gz # found chain 1f2vA in template set T0159 12 :GAAQ 1f2vA 3 :EYDY Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 6 residues T0159 18 :LID 1f2vA 7 :IRD Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 5 residues T0159 21 :KKTADQYKIT 1f2vA 22 :RAEADLSRFS Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 12 residues neighbor-bump: 2.52449 Ang CG2(74) at 35.8801 11.9352 16.6579 in (null):I-9999 (9) and O(83) at 33.734 12.287 17.94 in (null):T-9999 (10) T0159 32 :IAQLKDPKIAKLF 1f2vA 42 :VHACGSVEATRQF Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues other bump:2.63925 Ang CG2(69) at 41.2621 12.1203 5.94943 in (null):I-9999 (9) and CZ(103) at 41.671 13.315 8.267 in (null):F-9999 (13) other bump:3.07346 Ang CG1(68) at 43.8106 12.0223 5.85187 in (null):I-9999 (9) and CE2(102) at 42.939 12.954 8.648 in (null):F-9999 (13) T0159 45 :DTN 1f2vA 57 :SPD Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 5 residues T0159 51 :KADLTGCNPGWGCEGAINHQLA 1f2vA 70 :AGAPILCDAEMVAHGVTRARLP Fragment has 15 clashes (null) has 15 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 24 residues other bump:2.91613 Ang CB(112) at 34.9558 29.7519 6.59616 in (null):I-9999 (17) and NE2(142) at 34.4083 27.8739 8.75885 in (null):Q-9999 (20) other bump:2.61024 Ang CG2(114) at 33.698 30.534 6.10976 in (null):I-9999 (17) and NE2(133) at 31.1481 30.7649 6.61736 in (null):H-9999 (19) other bump:1.74583 Ang CG2(114) at 33.698 30.534 6.10976 in (null):I-9999 (17) and CE1(132) at 32.1636 31.3613 6.01459 in (null):H-9999 (19) other bump:2.49296 Ang CG2(114) at 33.698 30.534 6.10976 in (null):I-9999 (17) and ND1(131) at 32.3091 32.5617 6.52711 in (null):H-9999 (19) self-bump: 1.39931 Ang CA(119) at 36.081 33.85 9.048 in (null):N-9999 (18) and CB(120) at 36.6753 35.1168 9.03905 in (null):N-9999 (18) other bump:2.79476 Ang CE3(75) at 46.1937 28.757 -0.580086 in (null):W-9999 (11) and OE1(97) at 45.0821 31.2879 -0.168215 in (null):E-9999 (14) other bump:2.6885 Ang CZ3(78) at 45.8617 29.2836 -1.78159 in (null):W-9999 (11) and OE1(97) at 45.0821 31.2879 -0.168215 in (null):E-9999 (14) neighbor-bump: 2.83999 Ang CB(51) at 53.4214 27.2867 9.60229 in (null):N-9999 (8) and CD(61) at 51.4089 27.2424 7.59889 in (null):P-9999 (9) neighbor-bump: 2.13951 Ang CG(52) at 52.7509 26.1468 8.85447 in (null):N-9999 (8) and CD(61) at 51.4089 27.2424 7.59889 in (null):P-9999 (9) neighbor-bump: 1.07065 Ang OD1(54) at 51.9279 26.382 7.96863 in (null):N-9999 (8) and CD(61) at 51.4089 27.2424 7.59889 in (null):P-9999 (9) neighbor-bump: 2.07623 Ang C(56) at 52.507 28.919 8.141 in (null):N-9999 (8) and CD(61) at 51.4089 27.2424 7.59889 in (null):P-9999 (9) neighbor-bump: 2.79584 Ang CG(52) at 52.7509 26.1468 8.85447 in (null):N-9999 (8) and CG(60) at 51.9842 26.803 6.24711 in (null):P-9999 (9) neighbor-bump: 1.77315 Ang OD1(54) at 51.9279 26.382 7.96863 in (null):N-9999 (8) and CG(60) at 51.9842 26.803 6.24711 in (null):P-9999 (9) neighbor-bump: 1.89396 Ang O(9) at 38.883 35.02 24.228 in (null):K-9999 (1) and CB(13) at 39.0776 36.0668 22.6617 in (null):A-9999 (2) neighbor-bump: 2.34782 Ang C(10) at 38.581 33.98 23.616 in (null):K-9999 (1) and CB(13) at 39.0776 36.0668 22.6617 in (null):A-9999 (2) T0159 76 :LTNTVT 1f2vA 92 :AGNEVI Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 8 residues T0159 82 :HNQGNYAAMMADT 1f2vA 100 :LRDPRTPALAAEI Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues other bump:3.24661 Ang CD1(45) at 60.3114 33.7575 5.75721 in (null):Y-9999 (6) and SD(75) at 62.5034 31.3691 5.93336 in (null):M-9999 (10) other bump:3.34126 Ang CE1(47) at 60.2024 33.301 4.47152 in (null):Y-9999 (6) and SD(75) at 62.5034 31.3691 5.93336 in (null):M-9999 (10) other bump:2.82005 Ang O(10) at 56.867 34.487 5.504 in (null):H-9999 (1) and CE2(48) at 59.0156 35.2244 3.83299 in (null):Y-9999 (6) other bump:2.61252 Ang O(10) at 56.867 34.487 5.504 in (null):H-9999 (1) and CD2(46) at 59.1389 35.7245 5.14043 in (null):Y-9999 (6) T0159 97 :RYKEGKPVFYYTWTPYWVSNELK 1f2vA 125 :SERLAGSVVAIGNAPTALFFLLE Fragment has 102 clashes (null) has 102 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 25 residues other bump:2.21032 Ang OH(102) at 53.492 26.1228 16.6169 in (null):Y-9999 (11) and OE2(193) at 53.0598 25.2098 18.5829 in (null):E-9999 (21) other bump:2.24201 Ang CD2(75) at 51.7122 25.0454 15.7348 in (null):F-9999 (9) and OE1(192) at 53.807 24.9783 16.5309 in (null):E-9999 (21) other bump:2.12709 Ang CE2(77) at 52.68 24.8938 14.7289 in (null):F-9999 (9) and OE1(192) at 53.807 24.9783 16.5309 in (null):E-9999 (21) other bump:2.23278 Ang CE1(99) at 53.8215 25.4328 14.3449 in (null):Y-9999 (11) and OE1(192) at 53.807 24.9783 16.5309 in (null):E-9999 (21) other bump:1.99187 Ang CE2(100) at 52.0517 24.5529 15.691 in (null):Y-9999 (11) and OE1(192) at 53.807 24.9783 16.5309 in (null):E-9999 (21) other bump:1.25035 Ang CZ(101) at 53.1482 25.364 15.5406 in (null):Y-9999 (11) and OE1(192) at 53.807 24.9783 16.5309 in (null):E-9999 (21) other bump:3.18941 Ang CH2(163) at 52.3225 26.5531 14.1882 in (null):W-9999 (17) and OE1(192) at 53.807 24.9783 16.5309 in (null):E-9999 (21) other bump:1.19013 Ang OH(102) at 53.492 26.1228 16.6169 in (null):Y-9999 (11) and OE1(192) at 53.807 24.9783 16.5309 in (null):E-9999 (21) other bump:2.90101 Ang CE2(100) at 52.0517 24.5529 15.691 in (null):Y-9999 (11) and CD(191) at 53.9888 25.1984 17.7519 in (null):E-9999 (21) other bump:2.37138 Ang CZ(101) at 53.1482 25.364 15.5406 in (null):Y-9999 (11) and CD(191) at 53.9888 25.1984 17.7519 in (null):E-9999 (21) other bump:1.54573 Ang OH(102) at 53.492 26.1228 16.6169 in (null):Y-9999 (11) and CD(191) at 53.9888 25.1984 17.7519 in (null):E-9999 (21) other bump:2.59805 Ang OH(102) at 53.492 26.1228 16.6169 in (null):Y-9999 (11) and CG(190) at 55.3915 25.4661 18.2633 in (null):E-9999 (21) other bump:2.15635 Ang CG(73) at 51.1486 26.3027 15.9796 in (null):F-9999 (9) and CH2(163) at 52.3225 26.5531 14.1882 in (null):W-9999 (17) other bump:2.2445 Ang CD2(75) at 51.7122 25.0454 15.7348 in (null):F-9999 (9) and CH2(163) at 52.3225 26.5531 14.1882 in (null):W-9999 (17) other bump:1.78144 Ang CE2(77) at 52.68 24.8938 14.7289 in (null):F-9999 (9) and CH2(163) at 52.3225 26.5531 14.1882 in (null):W-9999 (17) other bump:0.969385 Ang CZ(78) at 53.0847 25.999 13.9608 in (null):F-9999 (9) and CH2(163) at 52.3225 26.5531 14.1882 in (null):W-9999 (17) other bump:2.82052 Ang CG(96) at 52.2555 23.8439 13.4065 in (null):Y-9999 (11) and CH2(163) at 52.3225 26.5531 14.1882 in (null):W-9999 (17) other bump:2.3477 Ang CD1(97) at 53.3703 24.6658 13.2652 in (null):Y-9999 (11) and CH2(163) at 52.3225 26.5531 14.1882 in (null):W-9999 (17) other bump:2.87083 Ang CD2(98) at 51.6185 23.8054 14.6311 in (null):Y-9999 (11) and CH2(163) at 52.3225 26.5531 14.1882 in (null):W-9999 (17) other bump:1.87801 Ang CE1(99) at 53.8215 25.4328 14.3449 in (null):Y-9999 (11) and CH2(163) at 52.3225 26.5531 14.1882 in (null):W-9999 (17) other bump:2.51654 Ang CE2(100) at 52.0517 24.5529 15.691 in (null):Y-9999 (11) and CH2(163) at 52.3225 26.5531 14.1882 in (null):W-9999 (17) other bump:1.9812 Ang CZ(101) at 53.1482 25.364 15.5406 in (null):Y-9999 (11) and CH2(163) at 52.3225 26.5531 14.1882 in (null):W-9999 (17) other bump:2.72981 Ang OH(102) at 53.492 26.1228 16.6169 in (null):Y-9999 (11) and CH2(163) at 52.3225 26.5531 14.1882 in (null):W-9999 (17) other bump:1.53385 Ang CD1(74) at 51.5594 27.3869 15.2251 in (null):F-9999 (9) and CH2(163) at 52.3225 26.5531 14.1882 in (null):W-9999 (17) other bump:0.734537 Ang CE1(76) at 52.5253 27.2588 14.2078 in (null):F-9999 (9) and CH2(163) at 52.3225 26.5531 14.1882 in (null):W-9999 (17) other bump:3.05023 Ang CA(94) at 50.841 23.997 11.302 in (null):Y-9999 (11) and CZ3(162) at 52.571 25.4497 13.3515 in (null):W-9999 (17) other bump:3.10768 Ang CG(73) at 51.1486 26.3027 15.9796 in (null):F-9999 (9) and CZ3(162) at 52.571 25.4497 13.3515 in (null):W-9999 (17) other bump:2.76535 Ang CB(95) at 51.7183 23.0542 12.2645 in (null):Y-9999 (11) and CZ3(162) at 52.571 25.4497 13.3515 in (null):W-9999 (17) other bump:2.56537 Ang CD2(75) at 51.7122 25.0454 15.7348 in (null):F-9999 (9) and CZ3(162) at 52.571 25.4497 13.3515 in (null):W-9999 (17) other bump:1.48933 Ang CE2(77) at 52.68 24.8938 14.7289 in (null):F-9999 (9) and CZ3(162) at 52.571 25.4497 13.3515 in (null):W-9999 (17) other bump:0.967878 Ang CZ(78) at 53.0847 25.999 13.9608 in (null):F-9999 (9) and CZ3(162) at 52.571 25.4497 13.3515 in (null):W-9999 (17) other bump:1.63742 Ang CG(96) at 52.2555 23.8439 13.4065 in (null):Y-9999 (11) and CZ3(162) at 52.571 25.4497 13.3515 in (null):W-9999 (17) other bump:1.12284 Ang CD1(97) at 53.3703 24.6658 13.2652 in (null):Y-9999 (11) and CZ3(162) at 52.571 25.4497 13.3515 in (null):W-9999 (17) other bump:2.29091 Ang CD2(98) at 51.6185 23.8054 14.6311 in (null):Y-9999 (11) and CZ3(162) at 52.571 25.4497 13.3515 in (null):W-9999 (17) other bump:1.59712 Ang CE1(99) at 53.8215 25.4328 14.3449 in (null):Y-9999 (11) and CZ3(162) at 52.571 25.4497 13.3515 in (null):W-9999 (17) other bump:2.55879 Ang CE2(100) at 52.0517 24.5529 15.691 in (null):Y-9999 (11) and CZ3(162) at 52.571 25.4497 13.3515 in (null):W-9999 (17) other bump:2.26555 Ang CZ(101) at 53.1482 25.364 15.5406 in (null):Y-9999 (11) and CZ3(162) at 52.571 25.4497 13.3515 in (null):W-9999 (17) other bump:2.87861 Ang CD1(74) at 51.5594 27.3869 15.2251 in (null):F-9999 (9) and CZ3(162) at 52.571 25.4497 13.3515 in (null):W-9999 (17) other bump:2.00207 Ang CE1(76) at 52.5253 27.2588 14.2078 in (null):F-9999 (9) and CZ3(162) at 52.571 25.4497 13.3515 in (null):W-9999 (17) other bump:2.97466 Ang CG(73) at 51.1486 26.3027 15.9796 in (null):F-9999 (9) and CZ2(161) at 53.2015 27.6052 14.2655 in (null):W-9999 (17) other bump:2.79966 Ang CE2(77) at 52.68 24.8938 14.7289 in (null):F-9999 (9) and CZ2(161) at 53.2015 27.6052 14.2655 in (null):W-9999 (17) other bump:1.63896 Ang CZ(78) at 53.0847 25.999 13.9608 in (null):F-9999 (9) and CZ2(161) at 53.2015 27.6052 14.2655 in (null):W-9999 (17) other bump:2.26055 Ang CE1(99) at 53.8215 25.4328 14.3449 in (null):Y-9999 (11) and CZ2(161) at 53.2015 27.6052 14.2655 in (null):W-9999 (17) other bump:2.5791 Ang CZ(101) at 53.1482 25.364 15.5406 in (null):Y-9999 (11) and CZ2(161) at 53.2015 27.6052 14.2655 in (null):W-9999 (17) other bump:2.79481 Ang OH(102) at 53.492 26.1228 16.6169 in (null):Y-9999 (11) and CZ2(161) at 53.2015 27.6052 14.2655 in (null):W-9999 (17) other bump:1.91437 Ang CD1(74) at 51.5594 27.3869 15.2251 in (null):F-9999 (9) and CZ2(161) at 53.2015 27.6052 14.2655 in (null):W-9999 (17) other bump:0.761899 Ang CE1(76) at 52.5253 27.2588 14.2078 in (null):F-9999 (9) and CZ2(161) at 53.2015 27.6052 14.2655 in (null):W-9999 (17) other bump:3.08969 Ang CB(95) at 51.7183 23.0542 12.2645 in (null):Y-9999 (11) and CE3(159) at 53.7226 25.3856 12.5704 in (null):W-9999 (17) other bump:2.44708 Ang CE2(77) at 52.68 24.8938 14.7289 in (null):F-9999 (9) and CE3(159) at 53.7226 25.3856 12.5704 in (null):W-9999 (17) other bump:1.64813 Ang CZ(78) at 53.0847 25.999 13.9608 in (null):F-9999 (9) and CE3(159) at 53.7226 25.3856 12.5704 in (null):W-9999 (17) other bump:2.28655 Ang CG(96) at 52.2555 23.8439 13.4065 in (null):Y-9999 (11) and CE3(159) at 53.7226 25.3856 12.5704 in (null):W-9999 (17) other bump:1.06068 Ang CD1(97) at 53.3703 24.6658 13.2652 in (null):Y-9999 (11) and CE3(159) at 53.7226 25.3856 12.5704 in (null):W-9999 (17) other bump:1.77791 Ang CE1(99) at 53.8215 25.4328 14.3449 in (null):Y-9999 (11) and CE3(159) at 53.7226 25.3856 12.5704 in (null):W-9999 (17) other bump:3.02536 Ang CZ(101) at 53.1482 25.364 15.5406 in (null):Y-9999 (11) and CE3(159) at 53.7226 25.3856 12.5704 in (null):W-9999 (17) other bump:2.76107 Ang CE1(76) at 52.5253 27.2588 14.2078 in (null):F-9999 (9) and CE3(159) at 53.7226 25.3856 12.5704 in (null):W-9999 (17) other bump:2.05658 Ang CZ(78) at 53.0847 25.999 13.9608 in (null):F-9999 (9) and CE2(158) at 54.3579 27.5412 13.4811 in (null):W-9999 (17) other bump:2.3408 Ang CE1(99) at 53.8215 25.4328 14.3449 in (null):Y-9999 (11) and CE2(158) at 54.3579 27.5412 13.4811 in (null):W-9999 (17) other bump:1.99157 Ang CE1(76) at 52.5253 27.2588 14.2078 in (null):F-9999 (9) and CE2(158) at 54.3579 27.5412 13.4811 in (null):W-9999 (17) other bump:2.09456 Ang CZ(78) at 53.0847 25.999 13.9608 in (null):F-9999 (9) and CD2(157) at 54.6387 26.4441 12.6288 in (null):W-9999 (17) other bump:2.27508 Ang CD1(97) at 53.3703 24.6658 13.2652 in (null):Y-9999 (11) and CD2(157) at 54.6387 26.4441 12.6288 in (null):W-9999 (17) other bump:2.15304 Ang CE1(99) at 53.8215 25.4328 14.3449 in (null):Y-9999 (11) and CD2(157) at 54.6387 26.4441 12.6288 in (null):W-9999 (17) other bump:1.93205 Ang CD2(86) at 46.4022 25.5632 9.76221 in (null):Y-9999 (10) and OG1(109) at 47.3507 24.2313 8.73299 in (null):T-9999 (12) other bump:1.48771 Ang CE2(88) at 45.9518 24.7376 8.73792 in (null):Y-9999 (10) and OG1(109) at 47.3507 24.2313 8.73299 in (null):T-9999 (12) other bump:2.17153 Ang CZ(89) at 45.3142 23.5479 9.05144 in (null):Y-9999 (10) and OG1(109) at 47.3507 24.2313 8.73299 in (null):T-9999 (12) other bump:3.00081 Ang CE2(88) at 45.9518 24.7376 8.73792 in (null):Y-9999 (10) and CG2(108) at 47.4319 23.5397 6.41862 in (null):T-9999 (12) other bump:2.65484 Ang CE2(88) at 45.9518 24.7376 8.73792 in (null):Y-9999 (10) and CB(107) at 48.2438 24.0235 7.60429 in (null):T-9999 (12) other bump:2.43517 Ang CG(73) at 51.1486 26.3027 15.9796 in (null):F-9999 (9) and OH(102) at 53.492 26.1228 16.6169 in (null):Y-9999 (11) other bump:2.25975 Ang CD2(75) at 51.7122 25.0454 15.7348 in (null):F-9999 (9) and OH(102) at 53.492 26.1228 16.6169 in (null):Y-9999 (11) other bump:2.39461 Ang CE2(77) at 52.68 24.8938 14.7289 in (null):F-9999 (9) and OH(102) at 53.492 26.1228 16.6169 in (null):Y-9999 (11) other bump:2.69005 Ang CZ(78) at 53.0847 25.999 13.9608 in (null):F-9999 (9) and OH(102) at 53.492 26.1228 16.6169 in (null):Y-9999 (11) other bump:2.69624 Ang CD1(74) at 51.5594 27.3869 15.2251 in (null):F-9999 (9) and OH(102) at 53.492 26.1228 16.6169 in (null):Y-9999 (11) other bump:2.2522 Ang CG(73) at 51.1486 26.3027 15.9796 in (null):F-9999 (9) and CZ(101) at 53.1482 25.364 15.5406 in (null):Y-9999 (11) other bump:1.48369 Ang CD2(75) at 51.7122 25.0454 15.7348 in (null):F-9999 (9) and CZ(101) at 53.1482 25.364 15.5406 in (null):Y-9999 (11) other bump:1.0484 Ang CE2(77) at 52.68 24.8938 14.7289 in (null):F-9999 (9) and CZ(101) at 53.1482 25.364 15.5406 in (null):Y-9999 (11) other bump:1.70392 Ang CZ(78) at 53.0847 25.999 13.9608 in (null):F-9999 (9) and CZ(101) at 53.1482 25.364 15.5406 in (null):Y-9999 (11) other bump:2.59151 Ang CD1(74) at 51.5594 27.3869 15.2251 in (null):F-9999 (9) and CZ(101) at 53.1482 25.364 15.5406 in (null):Y-9999 (11) other bump:2.39896 Ang CE1(76) at 52.5253 27.2588 14.2078 in (null):F-9999 (9) and CZ(101) at 53.1482 25.364 15.5406 in (null):Y-9999 (11) other bump:1.99018 Ang CG(73) at 51.1486 26.3027 15.9796 in (null):F-9999 (9) and CE2(100) at 52.0517 24.5529 15.691 in (null):Y-9999 (11) other bump:3.04205 Ang CB(72) at 50.0763 26.459 17.0021 in (null):F-9999 (9) and CE2(100) at 52.0517 24.5529 15.691 in (null):Y-9999 (11) other bump:0.5998 Ang CD2(75) at 51.7122 25.0454 15.7348 in (null):F-9999 (9) and CE2(100) at 52.0517 24.5529 15.691 in (null):Y-9999 (11) other bump:1.1986 Ang CE2(77) at 52.68 24.8938 14.7289 in (null):F-9999 (9) and CE2(100) at 52.0517 24.5529 15.691 in (null):Y-9999 (11) other bump:2.48039 Ang CZ(78) at 53.0847 25.999 13.9608 in (null):F-9999 (9) and CE2(100) at 52.0517 24.5529 15.691 in (null):Y-9999 (11) other bump:2.55562 Ang CD2(75) at 51.7122 25.0454 15.7348 in (null):F-9999 (9) and CE1(99) at 53.8215 25.4328 14.3449 in (null):Y-9999 (11) other bump:1.3195 Ang CE2(77) at 52.68 24.8938 14.7289 in (null):F-9999 (9) and CE1(99) at 53.8215 25.4328 14.3449 in (null):Y-9999 (11) other bump:1.00555 Ang CZ(78) at 53.0847 25.999 13.9608 in (null):F-9999 (9) and CE1(99) at 53.8215 25.4328 14.3449 in (null):Y-9999 (11) other bump:2.24354 Ang CE1(76) at 52.5253 27.2588 14.2078 in (null):F-9999 (9) and CE1(99) at 53.8215 25.4328 14.3449 in (null):Y-9999 (11) other bump:2.87677 Ang CG(73) at 51.1486 26.3027 15.9796 in (null):F-9999 (9) and CD2(98) at 51.6185 23.8054 14.6311 in (null):Y-9999 (11) other bump:1.6627 Ang CD2(75) at 51.7122 25.0454 15.7348 in (null):F-9999 (9) and CD2(98) at 51.6185 23.8054 14.6311 in (null):Y-9999 (11) other bump:1.52346 Ang CE2(77) at 52.68 24.8938 14.7289 in (null):F-9999 (9) and CD2(98) at 51.6185 23.8054 14.6311 in (null):Y-9999 (11) other bump:2.72232 Ang CZ(78) at 53.0847 25.999 13.9608 in (null):F-9999 (9) and CD2(98) at 51.6185 23.8054 14.6311 in (null):Y-9999 (11) other bump:1.6343 Ang CE2(77) at 52.68 24.8938 14.7289 in (null):F-9999 (9) and CD1(97) at 53.3703 24.6658 13.2652 in (null):Y-9999 (11) other bump:1.53062 Ang CZ(78) at 53.0847 25.999 13.9608 in (null):F-9999 (9) and CD1(97) at 53.3703 24.6658 13.2652 in (null):Y-9999 (11) other bump:2.88551 Ang CE1(76) at 52.5253 27.2588 14.2078 in (null):F-9999 (9) and CD1(97) at 53.3703 24.6658 13.2652 in (null):Y-9999 (11) other bump:2.67577 Ang CD2(75) at 51.7122 25.0454 15.7348 in (null):F-9999 (9) and CG(96) at 52.2555 23.8439 13.4065 in (null):Y-9999 (11) other bump:1.74105 Ang CE2(77) at 52.68 24.8938 14.7289 in (null):F-9999 (9) and CG(96) at 52.2555 23.8439 13.4065 in (null):Y-9999 (11) other bump:1.68511 Ang O(41) at 50.59 30.793 22.184 in (null):E-9999 (4) and CD(60) at 48.9221 30.6481 22.3752 in (null):P-9999 (7) neighbor-bump: 2.47084 Ang N(47) at 48.617 30.724 24.826 in (null):K-9999 (6) and CD(60) at 48.9221 30.6481 22.3752 in (null):P-9999 (7) other bump:2.64307 Ang C(42) at 51.318 31.764 22.382 in (null):E-9999 (4) and CD(60) at 48.9221 30.6481 22.3752 in (null):P-9999 (7) other bump:2.48307 Ang C(46) at 49.149 31.889 24.514 in (null):G-9999 (5) and CD(60) at 48.9221 30.6481 22.3752 in (null):P-9999 (7) other bump:3.2325 Ang CA(44) at 50.668 32.036 24.715 in (null):G-9999 (5) and CD(60) at 48.9221 30.6481 22.3752 in (null):P-9999 (7) other bump:1.8133 Ang O(41) at 50.59 30.793 22.184 in (null):E-9999 (4) and CG(59) at 49.3376 30.4291 20.9242 in (null):P-9999 (7) other bump:2.79806 Ang C(42) at 51.318 31.764 22.382 in (null):E-9999 (4) and CG(59) at 49.3376 30.4291 20.9242 in (null):P-9999 (7) T0159 120 :PGKDVVWLQVPFSALPGDKNADTKLPNGANYG 1f2vA 153 :APKPAAILGMPVGFVGAAESKDALAENSYGVP Fragment has 68 clashes (null) has 68 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 33 residues other bump:1.68686 Ang CG(16) at 53.628 25.766 27.313 in (null):K-9999 (3) and OH(233) at 52.2511 26.6791 27.6536 in (null):Y-9999 (31) other bump:2.25064 Ang CD(17) at 53.194 24.767 28.375 in (null):K-9999 (3) and OH(233) at 52.2511 26.6791 27.6536 in (null):Y-9999 (31) other bump:2.58324 Ang N(13) at 53.382 28.614 26.369 in (null):K-9999 (3) and OH(233) at 52.2511 26.6791 27.6536 in (null):Y-9999 (31) other bump:2.18219 Ang CA(14) at 52.654 27.555 25.696 in (null):K-9999 (3) and OH(233) at 52.2511 26.6791 27.6536 in (null):Y-9999 (31) other bump:0.978753 Ang CB(15) at 52.39 26.447 26.713 in (null):K-9999 (3) and OH(233) at 52.2511 26.6791 27.6536 in (null):Y-9999 (31) other bump:2.98936 Ang C(21) at 51.336 27.93 25.011 in (null):K-9999 (3) and CZ(232) at 51.7854 25.6445 26.8847 in (null):Y-9999 (31) other bump:1.89566 Ang CG(16) at 53.628 25.766 27.313 in (null):K-9999 (3) and CZ(232) at 51.7854 25.6445 26.8847 in (null):Y-9999 (31) other bump:2.23052 Ang CD(17) at 53.194 24.767 28.375 in (null):K-9999 (3) and CZ(232) at 51.7854 25.6445 26.8847 in (null):Y-9999 (31) other bump:2.41198 Ang CA(14) at 52.654 27.555 25.696 in (null):K-9999 (3) and CZ(232) at 51.7854 25.6445 26.8847 in (null):Y-9999 (31) other bump:1.01936 Ang CB(15) at 52.39 26.447 26.713 in (null):K-9999 (3) and CZ(232) at 51.7854 25.6445 26.8847 in (null):Y-9999 (31) other bump:1.7392 Ang CG(16) at 53.628 25.766 27.313 in (null):K-9999 (3) and CE2(231) at 52.6841 24.8896 26.1443 in (null):Y-9999 (31) other bump:2.29151 Ang CD(17) at 53.194 24.767 28.375 in (null):K-9999 (3) and CE2(231) at 52.6841 24.8896 26.1443 in (null):Y-9999 (31) other bump:2.70302 Ang CA(14) at 52.654 27.555 25.696 in (null):K-9999 (3) and CE2(231) at 52.6841 24.8896 26.1443 in (null):Y-9999 (31) other bump:1.68389 Ang CB(15) at 52.39 26.447 26.713 in (null):K-9999 (3) and CE2(231) at 52.6841 24.8896 26.1443 in (null):Y-9999 (31) other bump:2.23398 Ang CB(15) at 52.39 26.447 26.713 in (null):K-9999 (3) and CE1(230) at 50.4292 25.3823 26.824 in (null):Y-9999 (31) other bump:2.93154 Ang CB(15) at 52.39 26.447 26.713 in (null):K-9999 (3) and CD2(229) at 52.2072 23.8691 25.3291 in (null):Y-9999 (31) other bump:2.291 Ang O(28) at 49.17 25.928 24.54 in (null):D-9999 (4) and CD1(228) at 49.9646 24.3647 26.0142 in (null):Y-9999 (31) other bump:2.44142 Ang NE2(72) at 51.0545 17.3072 17.7356 in (null):Q-9999 (9) and NZ(181) at 50.0568 19.1453 18.9952 in (null):K-9999 (24) other bump:2.61143 Ang CD(70) at 51.9223 18.2396 17.4079 in (null):Q-9999 (9) and NZ(181) at 50.0568 19.1453 18.9952 in (null):K-9999 (24) other bump:2.47497 Ang NE2(72) at 51.0545 17.3072 17.7356 in (null):Q-9999 (9) and CE(180) at 51.0125 19.7635 18.036 in (null):K-9999 (24) other bump:1.95041 Ang CG(69) at 51.5361 19.1405 16.2635 in (null):Q-9999 (9) and CE(180) at 51.0125 19.7635 18.036 in (null):K-9999 (24) other bump:1.88267 Ang CD(70) at 51.9223 18.2396 17.4079 in (null):Q-9999 (9) and CE(180) at 51.0125 19.7635 18.036 in (null):K-9999 (24) other bump:2.40432 Ang OE1(71) at 52.9851 18.3894 18.0006 in (null):Q-9999 (9) and CE(180) at 51.0125 19.7635 18.036 in (null):K-9999 (24) other bump:1.73671 Ang NE2(72) at 51.0545 17.3072 17.7356 in (null):Q-9999 (9) and CD(179) at 51.9778 18.748 17.4396 in (null):K-9999 (24) other bump:2.592 Ang CB(68) at 50.665 18.4457 15.2251 in (null):Q-9999 (9) and CD(179) at 51.9778 18.748 17.4396 in (null):K-9999 (24) other bump:1.31615 Ang CG(69) at 51.5361 19.1405 16.2635 in (null):Q-9999 (9) and CD(179) at 51.9778 18.748 17.4396 in (null):K-9999 (24) other bump:0.512463 Ang CD(70) at 51.9223 18.2396 17.4079 in (null):Q-9999 (9) and CD(179) at 51.9778 18.748 17.4396 in (null):K-9999 (24) other bump:1.20752 Ang OE1(71) at 52.9851 18.3894 18.0006 in (null):Q-9999 (9) and CD(179) at 51.9778 18.748 17.4396 in (null):K-9999 (24) other bump:2.1182 Ang NE2(72) at 51.0545 17.3072 17.7356 in (null):Q-9999 (9) and CG(178) at 52.8533 18.1122 18.5122 in (null):K-9999 (24) other bump:2.80158 Ang CG(69) at 51.5361 19.1405 16.2635 in (null):Q-9999 (9) and CG(178) at 52.8533 18.1122 18.5122 in (null):K-9999 (24) other bump:1.44995 Ang CD(70) at 51.9223 18.2396 17.4079 in (null):Q-9999 (9) and CG(178) at 52.8533 18.1122 18.5122 in (null):K-9999 (24) other bump:0.5966 Ang OE1(71) at 52.9851 18.3894 18.0006 in (null):Q-9999 (9) and CG(178) at 52.8533 18.1122 18.5122 in (null):K-9999 (24) other bump:2.28438 Ang CD(70) at 51.9223 18.2396 17.4079 in (null):Q-9999 (9) and CB(177) at 53.9028 17.2053 17.8835 in (null):K-9999 (24) other bump:1.50259 Ang OE1(71) at 52.9851 18.3894 18.0006 in (null):Q-9999 (9) and CB(177) at 53.9028 17.2053 17.8835 in (null):K-9999 (24) other bump:2.75369 Ang OE1(71) at 52.9851 18.3894 18.0006 in (null):Q-9999 (9) and CA(176) at 54.862 16.574 18.875 in (null):K-9999 (24) neighbor-bump: 1.75114 Ang O(117) at 60.22 17.243 6.247 in (null):L-9999 (15) and CD(123) at 61.2019 15.7935 6.21119 in (null):P-9999 (16) neighbor-bump: 1.55275 Ang CA(112) at 60.702 15.392 4.797 in (null):L-9999 (15) and CD(123) at 61.2019 15.7935 6.21119 in (null):P-9999 (16) neighbor-bump: 2.09954 Ang CB(113) at 61.9756 15.3353 4.31395 in (null):L-9999 (15) and CD(123) at 61.2019 15.7935 6.21119 in (null):P-9999 (16) neighbor-bump: 0.808638 Ang C(118) at 60.435 16.043 6.152 in (null):L-9999 (15) and CD(123) at 61.2019 15.7935 6.21119 in (null):P-9999 (16) self-bump: 1.36808 Ang N(119) at 60.425 15.251 7.198 in (null):P-9999 (16) and CD(123) at 61.2019 15.7935 6.21119 in (null):P-9999 (16) neighbor-bump: 1.87031 Ang O(117) at 60.22 17.243 6.247 in (null):L-9999 (15) and CG(122) at 61.9014 16.8934 6.98786 in (null):P-9999 (16) neighbor-bump: 2.9142 Ang CA(112) at 60.702 15.392 4.797 in (null):L-9999 (15) and CG(122) at 61.9014 16.8934 6.98786 in (null):P-9999 (16) neighbor-bump: 3.09565 Ang CB(113) at 61.9756 15.3353 4.31395 in (null):L-9999 (15) and CG(122) at 61.9014 16.8934 6.98786 in (null):P-9999 (16) neighbor-bump: 1.88999 Ang C(118) at 60.435 16.043 6.152 in (null):L-9999 (15) and CG(122) at 61.9014 16.8934 6.98786 in (null):P-9999 (16) self-bump: 2.2184 Ang N(119) at 60.425 15.251 7.198 in (null):P-9999 (16) and CG(122) at 61.9014 16.8934 6.98786 in (null):P-9999 (16) neighbor-bump: 1.92371 Ang O(117) at 60.22 17.243 6.247 in (null):L-9999 (15) and CB(121) at 60.9117 17.2841 8.04159 in (null):P-9999 (16) neighbor-bump: 2.31043 Ang C(118) at 60.435 16.043 6.152 in (null):L-9999 (15) and CB(121) at 60.9117 17.2841 8.04159 in (null):P-9999 (16) self-bump: 1.36328 Ang CA(112) at 60.702 15.392 4.797 in (null):L-9999 (15) and CB(113) at 61.9756 15.3353 4.31395 in (null):L-9999 (15) neighbor-bump: 2.60195 Ang C(99) at 53.505 17.39 4.442 in (null):F-9999 (12) and CB(102) at 56.0896 17.2087 4.20349 in (null):S-9999 (13) neighbor-bump: 2.20059 Ang O(98) at 54.238 18.362 4.493 in (null):F-9999 (12) and CB(102) at 56.0896 17.2087 4.20349 in (null):S-9999 (13) neighbor-bump: 2.88076 Ang C(74) at 49.995 18.749 12.703 in (null):Q-9999 (9) and CG2(79) at 47.4915 17.7495 11.6871 in (null):V-9999 (10) other bump:2.91084 Ang CG(25) at 50.9524 27.7971 20.7019 in (null):D-9999 (4) and CH2(55) at 52.9546 27.2678 18.6564 in (null):W-9999 (7) other bump:1.83214 Ang OD2(27) at 51.4985 27.1765 19.7645 in (null):D-9999 (4) and CH2(55) at 52.9546 27.2678 18.6564 in (null):W-9999 (7) other bump:2.63256 Ang OD2(27) at 51.4985 27.1765 19.7645 in (null):D-9999 (4) and CZ3(54) at 52.7205 26.4224 17.558 in (null):W-9999 (7) other bump:2.96809 Ang CB(24) at 50.0375 27.0141 21.6161 in (null):D-9999 (4) and CZ2(53) at 52.4602 26.9762 19.9018 in (null):W-9999 (7) other bump:1.89399 Ang CG(25) at 50.9524 27.7971 20.7019 in (null):D-9999 (4) and CZ2(53) at 52.4602 26.9762 19.9018 in (null):W-9999 (7) other bump:2.63853 Ang OD1(26) at 51.1093 29.0114 20.8993 in (null):D-9999 (4) and CZ2(53) at 52.4602 26.9762 19.9018 in (null):W-9999 (7) other bump:0.991911 Ang OD2(27) at 51.4985 27.1765 19.7645 in (null):D-9999 (4) and CZ2(53) at 52.4602 26.9762 19.9018 in (null):W-9999 (7) other bump:2.09531 Ang CB(24) at 50.0375 27.0141 21.6161 in (null):D-9999 (4) and NE1(52) at 51.1052 25.2727 21.1496 in (null):W-9999 (7) other bump:2.56835 Ang CG(25) at 50.9524 27.7971 20.7019 in (null):D-9999 (4) and NE1(52) at 51.1052 25.2727 21.1496 in (null):W-9999 (7) other bump:2.38703 Ang OD2(27) at 51.4985 27.1765 19.7645 in (null):D-9999 (4) and NE1(52) at 51.1052 25.2727 21.1496 in (null):W-9999 (7) other bump:3.23018 Ang CA(23) at 49.876 27.605 23.016 in (null):D-9999 (4) and NE1(52) at 51.1052 25.2727 21.1496 in (null):W-9999 (7) other bump:2.86262 Ang OD2(27) at 51.4985 27.1765 19.7645 in (null):D-9999 (4) and CE3(51) at 51.9733 25.2539 17.6975 in (null):W-9999 (7) other bump:2.59527 Ang CB(24) at 50.0375 27.0141 21.6161 in (null):D-9999 (4) and CE2(50) at 51.7112 25.8053 20.0435 in (null):W-9999 (7) other bump:2.23074 Ang CG(25) at 50.9524 27.7971 20.7019 in (null):D-9999 (4) and CE2(50) at 51.7112 25.8053 20.0435 in (null):W-9999 (7) other bump:1.4154 Ang OD2(27) at 51.4985 27.1765 19.7645 in (null):D-9999 (4) and CE2(50) at 51.7112 25.8053 20.0435 in (null):W-9999 (7) other bump:2.38254 Ang OD2(27) at 51.4985 27.1765 19.7645 in (null):D-9999 (4) and CD2(49) at 51.4575 24.9338 18.9613 in (null):W-9999 (7) other bump:3.0581 Ang CB(24) at 50.0375 27.0141 21.6161 in (null):D-9999 (4) and CD1(48) at 50.4823 24.1021 20.7952 in (null):W-9999 (7) Number of specific fragments= 10 total=136 Number of alignments=31 # Reading fragments from alignment file # T0159 read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1f2vA/T0159-1f2vA-2track-protein-STR-global-adpstyle1.pw.a2m.gz # 1f2vA read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1f2vA/T0159-1f2vA-2track-protein-STR-global-adpstyle1.pw.a2m.gz # found chain 1f2vA in template set T0159 12 :GAAQ 1f2vA 3 :EYDY Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 6 residues T0159 19 :IDKKTADQ 1f2vA 30 :FSEEEADL Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 10 residues other bump:2.97292 Ang CG2(6) at 35.7107 11.8517 16.5575 in (null):I-9999 (1) and CA(44) at 34.214 13.297 14.434 in (null):A-9999 (6) other bump:2.3769 Ang CG2(6) at 35.7107 11.8517 16.5575 in (null):I-9999 (1) and N(43) at 34.728 13.841 15.705 in (null):A-9999 (6) other bump:2.84691 Ang CG2(6) at 35.7107 11.8517 16.5575 in (null):I-9999 (1) and C(42) at 35.833 14.579 15.75 in (null):T-9999 (5) neighbor-bump: 2.45118 Ang CG2(6) at 35.7107 11.8517 16.5575 in (null):I-9999 (1) and O(16) at 33.734 12.287 17.94 in (null):D-9999 (2) T0159 28 :KITNIAQLKDPKIAKLF 1f2vA 38 :AVRMVHACGSVEATRQF Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 19 residues other bump:2.63925 Ang CG2(101) at 41.2621 12.1203 5.94943 in (null):I-9999 (13) and CZ(135) at 41.671 13.315 8.267 in (null):F-9999 (17) other bump:3.07346 Ang CG1(100) at 43.8106 12.0223 5.85187 in (null):I-9999 (13) and CE2(134) at 42.939 12.954 8.648 in (null):F-9999 (17) T0159 45 :DTN 1f2vA 57 :SPD Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 5 residues T0159 49 :DGKADLTGCNPGWGCEGAINHQLAA 1f2vA 68 :LKAGAPILCDAEMVAHGVTRARLPA Fragment has 15 clashes (null) has 15 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 27 residues other bump:2.91613 Ang CB(124) at 34.9558 29.7519 6.59616 in (null):I-9999 (19) and NE2(154) at 34.4083 27.8739 8.75885 in (null):Q-9999 (22) other bump:2.61024 Ang CG2(126) at 33.698 30.534 6.10976 in (null):I-9999 (19) and NE2(145) at 31.1481 30.7649 6.61736 in (null):H-9999 (21) other bump:1.74583 Ang CG2(126) at 33.698 30.534 6.10976 in (null):I-9999 (19) and CE1(144) at 32.1636 31.3613 6.01459 in (null):H-9999 (21) other bump:2.49296 Ang CG2(126) at 33.698 30.534 6.10976 in (null):I-9999 (19) and ND1(143) at 32.3091 32.5617 6.52711 in (null):H-9999 (21) self-bump: 1.39931 Ang CA(131) at 36.081 33.85 9.048 in (null):N-9999 (20) and CB(132) at 36.6753 35.1168 9.03905 in (null):N-9999 (20) other bump:2.79476 Ang CE3(87) at 46.1937 28.757 -0.580086 in (null):W-9999 (13) and OE1(109) at 45.0821 31.2879 -0.168215 in (null):E-9999 (16) other bump:2.6885 Ang CZ3(90) at 45.8617 29.2836 -1.78159 in (null):W-9999 (13) and OE1(109) at 45.0821 31.2879 -0.168215 in (null):E-9999 (16) neighbor-bump: 2.83999 Ang CB(63) at 53.4214 27.2867 9.60229 in (null):N-9999 (10) and CD(73) at 51.4089 27.2424 7.59889 in (null):P-9999 (11) neighbor-bump: 2.13951 Ang CG(64) at 52.7509 26.1468 8.85447 in (null):N-9999 (10) and CD(73) at 51.4089 27.2424 7.59889 in (null):P-9999 (11) neighbor-bump: 1.07065 Ang OD1(66) at 51.9279 26.382 7.96863 in (null):N-9999 (10) and CD(73) at 51.4089 27.2424 7.59889 in (null):P-9999 (11) neighbor-bump: 2.07623 Ang C(68) at 52.507 28.919 8.141 in (null):N-9999 (10) and CD(73) at 51.4089 27.2424 7.59889 in (null):P-9999 (11) neighbor-bump: 2.79584 Ang CG(64) at 52.7509 26.1468 8.85447 in (null):N-9999 (10) and CG(72) at 51.9842 26.803 6.24711 in (null):P-9999 (11) neighbor-bump: 1.77315 Ang OD1(66) at 51.9279 26.382 7.96863 in (null):N-9999 (10) and CG(72) at 51.9842 26.803 6.24711 in (null):P-9999 (11) neighbor-bump: 1.89396 Ang O(21) at 38.883 35.02 24.228 in (null):K-9999 (3) and CB(25) at 39.0777 36.0668 22.6617 in (null):A-9999 (4) neighbor-bump: 2.34782 Ang C(22) at 38.581 33.98 23.616 in (null):K-9999 (3) and CB(25) at 39.0777 36.0668 22.6617 in (null):A-9999 (4) T0159 75 :ELTNTVTHNQGNYAAMMADTIS 1f2vA 93 :GNEVICTLRDPRTPALAAEIGN Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 24 residues other bump:2.41377 Ang CE(129) at 63.1839 29.7289 5.71473 in (null):M-9999 (17) and CA(167) at 63.497 27.742 7.049 in (null):G-9999 (23) other bump:3.24661 Ang CD1(98) at 60.3114 33.7575 5.75721 in (null):Y-9999 (13) and SD(128) at 62.5034 31.3691 5.93336 in (null):M-9999 (17) other bump:3.34126 Ang CE1(100) at 60.2024 33.301 4.47152 in (null):Y-9999 (13) and SD(128) at 62.5034 31.3691 5.93336 in (null):M-9999 (17) other bump:2.82005 Ang O(63) at 56.867 34.487 5.504 in (null):H-9999 (8) and CE2(101) at 59.0156 35.2244 3.83299 in (null):Y-9999 (13) other bump:2.61252 Ang O(63) at 56.867 34.487 5.504 in (null):H-9999 (8) and CD2(99) at 59.1389 35.7245 5.14043 in (null):Y-9999 (13) T0159 97 :RYKEGKPVFYYTWTPYWVSNELK 1f2vA 125 :SERLAGSVVAIGNAPTALFFLLE Fragment has 102 clashes (null) has 102 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 25 residues other bump:2.21032 Ang OH(102) at 53.492 26.1228 16.6169 in (null):Y-9999 (11) and OE2(193) at 53.0598 25.2098 18.5829 in (null):E-9999 (21) other bump:2.24201 Ang CD2(75) at 51.7122 25.0454 15.7348 in (null):F-9999 (9) and OE1(192) at 53.807 24.9783 16.5309 in (null):E-9999 (21) other bump:2.12709 Ang CE2(77) at 52.68 24.8938 14.7289 in (null):F-9999 (9) and OE1(192) at 53.807 24.9783 16.5309 in (null):E-9999 (21) other bump:2.23278 Ang CE1(99) at 53.8215 25.4328 14.3449 in (null):Y-9999 (11) and OE1(192) at 53.807 24.9783 16.5309 in (null):E-9999 (21) other bump:1.99187 Ang CE2(100) at 52.0517 24.5529 15.691 in (null):Y-9999 (11) and OE1(192) at 53.807 24.9783 16.5309 in (null):E-9999 (21) other bump:1.25035 Ang CZ(101) at 53.1482 25.364 15.5406 in (null):Y-9999 (11) and OE1(192) at 53.807 24.9783 16.5309 in (null):E-9999 (21) other bump:3.18941 Ang CH2(163) at 52.3225 26.5531 14.1882 in (null):W-9999 (17) and OE1(192) at 53.807 24.9783 16.5309 in (null):E-9999 (21) other bump:1.19013 Ang OH(102) at 53.492 26.1228 16.6169 in (null):Y-9999 (11) and OE1(192) at 53.807 24.9783 16.5309 in (null):E-9999 (21) other bump:2.90101 Ang CE2(100) at 52.0517 24.5529 15.691 in (null):Y-9999 (11) and CD(191) at 53.9888 25.1984 17.7519 in (null):E-9999 (21) other bump:2.37138 Ang CZ(101) at 53.1482 25.364 15.5406 in (null):Y-9999 (11) and CD(191) at 53.9888 25.1984 17.7519 in (null):E-9999 (21) other bump:1.54573 Ang OH(102) at 53.492 26.1228 16.6169 in (null):Y-9999 (11) and CD(191) at 53.9888 25.1984 17.7519 in (null):E-9999 (21) other bump:2.59805 Ang OH(102) at 53.492 26.1228 16.6169 in (null):Y-9999 (11) and CG(190) at 55.3915 25.4661 18.2633 in (null):E-9999 (21) other bump:2.15635 Ang CG(73) at 51.1486 26.3027 15.9796 in (null):F-9999 (9) and CH2(163) at 52.3225 26.5531 14.1882 in (null):W-9999 (17) other bump:2.2445 Ang CD2(75) at 51.7122 25.0454 15.7348 in (null):F-9999 (9) and CH2(163) at 52.3225 26.5531 14.1882 in (null):W-9999 (17) other bump:1.78144 Ang CE2(77) at 52.68 24.8938 14.7289 in (null):F-9999 (9) and CH2(163) at 52.3225 26.5531 14.1882 in (null):W-9999 (17) other bump:0.969385 Ang CZ(78) at 53.0847 25.999 13.9608 in (null):F-9999 (9) and CH2(163) at 52.3225 26.5531 14.1882 in (null):W-9999 (17) other bump:2.82052 Ang CG(96) at 52.2555 23.8439 13.4065 in (null):Y-9999 (11) and CH2(163) at 52.3225 26.5531 14.1882 in (null):W-9999 (17) other bump:2.3477 Ang CD1(97) at 53.3703 24.6658 13.2652 in (null):Y-9999 (11) and CH2(163) at 52.3225 26.5531 14.1882 in (null):W-9999 (17) other bump:2.87083 Ang CD2(98) at 51.6185 23.8054 14.6311 in (null):Y-9999 (11) and CH2(163) at 52.3225 26.5531 14.1882 in (null):W-9999 (17) other bump:1.87801 Ang CE1(99) at 53.8215 25.4328 14.3449 in (null):Y-9999 (11) and CH2(163) at 52.3225 26.5531 14.1882 in (null):W-9999 (17) other bump:2.51654 Ang CE2(100) at 52.0517 24.5529 15.691 in (null):Y-9999 (11) and CH2(163) at 52.3225 26.5531 14.1882 in (null):W-9999 (17) other bump:1.9812 Ang CZ(101) at 53.1482 25.364 15.5406 in (null):Y-9999 (11) and CH2(163) at 52.3225 26.5531 14.1882 in (null):W-9999 (17) other bump:2.72981 Ang OH(102) at 53.492 26.1228 16.6169 in (null):Y-9999 (11) and CH2(163) at 52.3225 26.5531 14.1882 in (null):W-9999 (17) other bump:1.53385 Ang CD1(74) at 51.5594 27.3869 15.2251 in (null):F-9999 (9) and CH2(163) at 52.3225 26.5531 14.1882 in (null):W-9999 (17) other bump:0.734537 Ang CE1(76) at 52.5253 27.2588 14.2078 in (null):F-9999 (9) and CH2(163) at 52.3225 26.5531 14.1882 in (null):W-9999 (17) other bump:3.05023 Ang CA(94) at 50.841 23.997 11.302 in (null):Y-9999 (11) and CZ3(162) at 52.571 25.4497 13.3515 in (null):W-9999 (17) other bump:3.10768 Ang CG(73) at 51.1486 26.3027 15.9796 in (null):F-9999 (9) and CZ3(162) at 52.571 25.4497 13.3515 in (null):W-9999 (17) other bump:2.76535 Ang CB(95) at 51.7183 23.0542 12.2645 in (null):Y-9999 (11) and CZ3(162) at 52.571 25.4497 13.3515 in (null):W-9999 (17) other bump:2.56537 Ang CD2(75) at 51.7122 25.0454 15.7348 in (null):F-9999 (9) and CZ3(162) at 52.571 25.4497 13.3515 in (null):W-9999 (17) other bump:1.48933 Ang CE2(77) at 52.68 24.8938 14.7289 in (null):F-9999 (9) and CZ3(162) at 52.571 25.4497 13.3515 in (null):W-9999 (17) other bump:0.967878 Ang CZ(78) at 53.0847 25.999 13.9608 in (null):F-9999 (9) and CZ3(162) at 52.571 25.4497 13.3515 in (null):W-9999 (17) other bump:1.63742 Ang CG(96) at 52.2555 23.8439 13.4065 in (null):Y-9999 (11) and CZ3(162) at 52.571 25.4497 13.3515 in (null):W-9999 (17) other bump:1.12284 Ang CD1(97) at 53.3703 24.6658 13.2652 in (null):Y-9999 (11) and CZ3(162) at 52.571 25.4497 13.3515 in (null):W-9999 (17) other bump:2.29091 Ang CD2(98) at 51.6185 23.8054 14.6311 in (null):Y-9999 (11) and CZ3(162) at 52.571 25.4497 13.3515 in (null):W-9999 (17) other bump:1.59712 Ang CE1(99) at 53.8215 25.4328 14.3449 in (null):Y-9999 (11) and CZ3(162) at 52.571 25.4497 13.3515 in (null):W-9999 (17) other bump:2.55879 Ang CE2(100) at 52.0517 24.5529 15.691 in (null):Y-9999 (11) and CZ3(162) at 52.571 25.4497 13.3515 in (null):W-9999 (17) other bump:2.26555 Ang CZ(101) at 53.1482 25.364 15.5406 in (null):Y-9999 (11) and CZ3(162) at 52.571 25.4497 13.3515 in (null):W-9999 (17) other bump:2.87861 Ang CD1(74) at 51.5594 27.3869 15.2251 in (null):F-9999 (9) and CZ3(162) at 52.571 25.4497 13.3515 in (null):W-9999 (17) other bump:2.00207 Ang CE1(76) at 52.5253 27.2588 14.2078 in (null):F-9999 (9) and CZ3(162) at 52.571 25.4497 13.3515 in (null):W-9999 (17) other bump:2.97466 Ang CG(73) at 51.1486 26.3027 15.9796 in (null):F-9999 (9) and CZ2(161) at 53.2015 27.6052 14.2655 in (null):W-9999 (17) other bump:2.79966 Ang CE2(77) at 52.68 24.8938 14.7289 in (null):F-9999 (9) and CZ2(161) at 53.2015 27.6052 14.2655 in (null):W-9999 (17) other bump:1.63896 Ang CZ(78) at 53.0847 25.999 13.9608 in (null):F-9999 (9) and CZ2(161) at 53.2015 27.6052 14.2655 in (null):W-9999 (17) other bump:2.26055 Ang CE1(99) at 53.8215 25.4328 14.3449 in (null):Y-9999 (11) and CZ2(161) at 53.2015 27.6052 14.2655 in (null):W-9999 (17) other bump:2.5791 Ang CZ(101) at 53.1482 25.364 15.5406 in (null):Y-9999 (11) and CZ2(161) at 53.2015 27.6052 14.2655 in (null):W-9999 (17) other bump:2.79481 Ang OH(102) at 53.492 26.1228 16.6169 in (null):Y-9999 (11) and CZ2(161) at 53.2015 27.6052 14.2655 in (null):W-9999 (17) other bump:1.91437 Ang CD1(74) at 51.5594 27.3869 15.2251 in (null):F-9999 (9) and CZ2(161) at 53.2015 27.6052 14.2655 in (null):W-9999 (17) other bump:0.761899 Ang CE1(76) at 52.5253 27.2588 14.2078 in (null):F-9999 (9) and CZ2(161) at 53.2015 27.6052 14.2655 in (null):W-9999 (17) other bump:3.08969 Ang CB(95) at 51.7183 23.0542 12.2645 in (null):Y-9999 (11) and CE3(159) at 53.7226 25.3856 12.5704 in (null):W-9999 (17) other bump:2.44708 Ang CE2(77) at 52.68 24.8938 14.7289 in (null):F-9999 (9) and CE3(159) at 53.7226 25.3856 12.5704 in (null):W-9999 (17) other bump:1.64813 Ang CZ(78) at 53.0847 25.999 13.9608 in (null):F-9999 (9) and CE3(159) at 53.7226 25.3856 12.5704 in (null):W-9999 (17) other bump:2.28655 Ang CG(96) at 52.2555 23.8439 13.4065 in (null):Y-9999 (11) and CE3(159) at 53.7226 25.3856 12.5704 in (null):W-9999 (17) other bump:1.06068 Ang CD1(97) at 53.3703 24.6658 13.2652 in (null):Y-9999 (11) and CE3(159) at 53.7226 25.3856 12.5704 in (null):W-9999 (17) other bump:1.77791 Ang CE1(99) at 53.8215 25.4328 14.3449 in (null):Y-9999 (11) and CE3(159) at 53.7226 25.3856 12.5704 in (null):W-9999 (17) other bump:3.02536 Ang CZ(101) at 53.1482 25.364 15.5406 in (null):Y-9999 (11) and CE3(159) at 53.7226 25.3856 12.5704 in (null):W-9999 (17) other bump:2.76107 Ang CE1(76) at 52.5253 27.2588 14.2078 in (null):F-9999 (9) and CE3(159) at 53.7226 25.3856 12.5704 in (null):W-9999 (17) other bump:2.05658 Ang CZ(78) at 53.0847 25.999 13.9608 in (null):F-9999 (9) and CE2(158) at 54.3579 27.5412 13.4811 in (null):W-9999 (17) other bump:2.3408 Ang CE1(99) at 53.8215 25.4328 14.3449 in (null):Y-9999 (11) and CE2(158) at 54.3579 27.5412 13.4811 in (null):W-9999 (17) other bump:1.99157 Ang CE1(76) at 52.5253 27.2588 14.2078 in (null):F-9999 (9) and CE2(158) at 54.3579 27.5412 13.4811 in (null):W-9999 (17) other bump:2.09456 Ang CZ(78) at 53.0847 25.999 13.9608 in (null):F-9999 (9) and CD2(157) at 54.6387 26.4441 12.6288 in (null):W-9999 (17) other bump:2.27508 Ang CD1(97) at 53.3703 24.6658 13.2652 in (null):Y-9999 (11) and CD2(157) at 54.6387 26.4441 12.6288 in (null):W-9999 (17) other bump:2.15304 Ang CE1(99) at 53.8215 25.4328 14.3449 in (null):Y-9999 (11) and CD2(157) at 54.6387 26.4441 12.6288 in (null):W-9999 (17) other bump:1.93205 Ang CD2(86) at 46.4022 25.5632 9.76221 in (null):Y-9999 (10) and OG1(109) at 47.3507 24.2313 8.73299 in (null):T-9999 (12) other bump:1.48771 Ang CE2(88) at 45.9518 24.7376 8.73792 in (null):Y-9999 (10) and OG1(109) at 47.3507 24.2313 8.73299 in (null):T-9999 (12) other bump:2.17153 Ang CZ(89) at 45.3142 23.5479 9.05144 in (null):Y-9999 (10) and OG1(109) at 47.3507 24.2313 8.73299 in (null):T-9999 (12) other bump:3.00081 Ang CE2(88) at 45.9518 24.7376 8.73792 in (null):Y-9999 (10) and CG2(108) at 47.4319 23.5397 6.41862 in (null):T-9999 (12) other bump:2.65484 Ang CE2(88) at 45.9518 24.7376 8.73792 in (null):Y-9999 (10) and CB(107) at 48.2438 24.0235 7.60429 in (null):T-9999 (12) other bump:2.43517 Ang CG(73) at 51.1486 26.3027 15.9796 in (null):F-9999 (9) and OH(102) at 53.492 26.1228 16.6169 in (null):Y-9999 (11) other bump:2.25975 Ang CD2(75) at 51.7122 25.0454 15.7348 in (null):F-9999 (9) and OH(102) at 53.492 26.1228 16.6169 in (null):Y-9999 (11) other bump:2.39461 Ang CE2(77) at 52.68 24.8938 14.7289 in (null):F-9999 (9) and OH(102) at 53.492 26.1228 16.6169 in (null):Y-9999 (11) other bump:2.69005 Ang CZ(78) at 53.0847 25.999 13.9608 in (null):F-9999 (9) and OH(102) at 53.492 26.1228 16.6169 in (null):Y-9999 (11) other bump:2.69624 Ang CD1(74) at 51.5594 27.3869 15.2251 in (null):F-9999 (9) and OH(102) at 53.492 26.1228 16.6169 in (null):Y-9999 (11) other bump:2.2522 Ang CG(73) at 51.1486 26.3027 15.9796 in (null):F-9999 (9) and CZ(101) at 53.1482 25.364 15.5406 in (null):Y-9999 (11) other bump:1.48369 Ang CD2(75) at 51.7122 25.0454 15.7348 in (null):F-9999 (9) and CZ(101) at 53.1482 25.364 15.5406 in (null):Y-9999 (11) other bump:1.0484 Ang CE2(77) at 52.68 24.8938 14.7289 in (null):F-9999 (9) and CZ(101) at 53.1482 25.364 15.5406 in (null):Y-9999 (11) other bump:1.70392 Ang CZ(78) at 53.0847 25.999 13.9608 in (null):F-9999 (9) and CZ(101) at 53.1482 25.364 15.5406 in (null):Y-9999 (11) other bump:2.59151 Ang CD1(74) at 51.5594 27.3869 15.2251 in (null):F-9999 (9) and CZ(101) at 53.1482 25.364 15.5406 in (null):Y-9999 (11) other bump:2.39896 Ang CE1(76) at 52.5253 27.2588 14.2078 in (null):F-9999 (9) and CZ(101) at 53.1482 25.364 15.5406 in (null):Y-9999 (11) other bump:1.99018 Ang CG(73) at 51.1486 26.3027 15.9796 in (null):F-9999 (9) and CE2(100) at 52.0517 24.5529 15.691 in (null):Y-9999 (11) other bump:3.04205 Ang CB(72) at 50.0763 26.459 17.0021 in (null):F-9999 (9) and CE2(100) at 52.0517 24.5529 15.691 in (null):Y-9999 (11) other bump:0.5998 Ang CD2(75) at 51.7122 25.0454 15.7348 in (null):F-9999 (9) and CE2(100) at 52.0517 24.5529 15.691 in (null):Y-9999 (11) other bump:1.1986 Ang CE2(77) at 52.68 24.8938 14.7289 in (null):F-9999 (9) and CE2(100) at 52.0517 24.5529 15.691 in (null):Y-9999 (11) other bump:2.48039 Ang CZ(78) at 53.0847 25.999 13.9608 in (null):F-9999 (9) and CE2(100) at 52.0517 24.5529 15.691 in (null):Y-9999 (11) other bump:2.55562 Ang CD2(75) at 51.7122 25.0454 15.7348 in (null):F-9999 (9) and CE1(99) at 53.8215 25.4328 14.3449 in (null):Y-9999 (11) other bump:1.3195 Ang CE2(77) at 52.68 24.8938 14.7289 in (null):F-9999 (9) and CE1(99) at 53.8215 25.4328 14.3449 in (null):Y-9999 (11) other bump:1.00555 Ang CZ(78) at 53.0847 25.999 13.9608 in (null):F-9999 (9) and CE1(99) at 53.8215 25.4328 14.3449 in (null):Y-9999 (11) other bump:2.24354 Ang CE1(76) at 52.5253 27.2588 14.2078 in (null):F-9999 (9) and CE1(99) at 53.8215 25.4328 14.3449 in (null):Y-9999 (11) other bump:2.87677 Ang CG(73) at 51.1486 26.3027 15.9796 in (null):F-9999 (9) and CD2(98) at 51.6185 23.8054 14.6311 in (null):Y-9999 (11) other bump:1.6627 Ang CD2(75) at 51.7122 25.0454 15.7348 in (null):F-9999 (9) and CD2(98) at 51.6185 23.8054 14.6311 in (null):Y-9999 (11) other bump:1.52346 Ang CE2(77) at 52.68 24.8938 14.7289 in (null):F-9999 (9) and CD2(98) at 51.6185 23.8054 14.6311 in (null):Y-9999 (11) other bump:2.72232 Ang CZ(78) at 53.0847 25.999 13.9608 in (null):F-9999 (9) and CD2(98) at 51.6185 23.8054 14.6311 in (null):Y-9999 (11) other bump:1.6343 Ang CE2(77) at 52.68 24.8938 14.7289 in (null):F-9999 (9) and CD1(97) at 53.3703 24.6658 13.2652 in (null):Y-9999 (11) other bump:1.53062 Ang CZ(78) at 53.0847 25.999 13.9608 in (null):F-9999 (9) and CD1(97) at 53.3703 24.6658 13.2652 in (null):Y-9999 (11) other bump:2.88551 Ang CE1(76) at 52.5253 27.2588 14.2078 in (null):F-9999 (9) and CD1(97) at 53.3703 24.6658 13.2652 in (null):Y-9999 (11) other bump:2.67577 Ang CD2(75) at 51.7122 25.0454 15.7348 in (null):F-9999 (9) and CG(96) at 52.2555 23.8439 13.4065 in (null):Y-9999 (11) other bump:1.74105 Ang CE2(77) at 52.68 24.8938 14.7289 in (null):F-9999 (9) and CG(96) at 52.2555 23.8439 13.4065 in (null):Y-9999 (11) other bump:1.68511 Ang O(41) at 50.59 30.793 22.184 in (null):E-9999 (4) and CD(60) at 48.9221 30.6481 22.3752 in (null):P-9999 (7) neighbor-bump: 2.47084 Ang N(47) at 48.617 30.724 24.826 in (null):K-9999 (6) and CD(60) at 48.9221 30.6481 22.3752 in (null):P-9999 (7) other bump:2.64307 Ang C(42) at 51.318 31.764 22.382 in (null):E-9999 (4) and CD(60) at 48.9221 30.6481 22.3752 in (null):P-9999 (7) other bump:2.48307 Ang C(46) at 49.149 31.889 24.514 in (null):G-9999 (5) and CD(60) at 48.9221 30.6481 22.3752 in (null):P-9999 (7) other bump:3.2325 Ang CA(44) at 50.668 32.036 24.715 in (null):G-9999 (5) and CD(60) at 48.9221 30.6481 22.3752 in (null):P-9999 (7) other bump:1.8133 Ang O(41) at 50.59 30.793 22.184 in (null):E-9999 (4) and CG(59) at 49.3376 30.4291 20.9242 in (null):P-9999 (7) other bump:2.79806 Ang C(42) at 51.318 31.764 22.382 in (null):E-9999 (4) and CG(59) at 49.3376 30.4291 20.9242 in (null):P-9999 (7) T0159 120 :PGKDVVWLQVPFSALPGDKNADTKLPNGANYG 1f2vA 153 :APKPAAILGMPVGFVGAAESKDALAENSYGVP Fragment has 68 clashes (null) has 68 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 33 residues other bump:1.68686 Ang CG(16) at 53.628 25.766 27.313 in (null):K-9999 (3) and OH(233) at 52.2511 26.6791 27.6536 in (null):Y-9999 (31) other bump:2.25064 Ang CD(17) at 53.194 24.767 28.375 in (null):K-9999 (3) and OH(233) at 52.2511 26.6791 27.6536 in (null):Y-9999 (31) other bump:2.58324 Ang N(13) at 53.382 28.614 26.369 in (null):K-9999 (3) and OH(233) at 52.2511 26.6791 27.6536 in (null):Y-9999 (31) other bump:2.18219 Ang CA(14) at 52.654 27.555 25.696 in (null):K-9999 (3) and OH(233) at 52.2511 26.6791 27.6536 in (null):Y-9999 (31) other bump:0.978753 Ang CB(15) at 52.39 26.447 26.713 in (null):K-9999 (3) and OH(233) at 52.2511 26.6791 27.6536 in (null):Y-9999 (31) other bump:2.98936 Ang C(21) at 51.336 27.93 25.011 in (null):K-9999 (3) and CZ(232) at 51.7854 25.6445 26.8847 in (null):Y-9999 (31) other bump:1.89566 Ang CG(16) at 53.628 25.766 27.313 in (null):K-9999 (3) and CZ(232) at 51.7854 25.6445 26.8847 in (null):Y-9999 (31) other bump:2.23052 Ang CD(17) at 53.194 24.767 28.375 in (null):K-9999 (3) and CZ(232) at 51.7854 25.6445 26.8847 in (null):Y-9999 (31) other bump:2.41198 Ang CA(14) at 52.654 27.555 25.696 in (null):K-9999 (3) and CZ(232) at 51.7854 25.6445 26.8847 in (null):Y-9999 (31) other bump:1.01936 Ang CB(15) at 52.39 26.447 26.713 in (null):K-9999 (3) and CZ(232) at 51.7854 25.6445 26.8847 in (null):Y-9999 (31) other bump:1.7392 Ang CG(16) at 53.628 25.766 27.313 in (null):K-9999 (3) and CE2(231) at 52.6841 24.8896 26.1443 in (null):Y-9999 (31) other bump:2.29151 Ang CD(17) at 53.194 24.767 28.375 in (null):K-9999 (3) and CE2(231) at 52.6841 24.8896 26.1443 in (null):Y-9999 (31) other bump:2.70302 Ang CA(14) at 52.654 27.555 25.696 in (null):K-9999 (3) and CE2(231) at 52.6841 24.8896 26.1443 in (null):Y-9999 (31) other bump:1.68389 Ang CB(15) at 52.39 26.447 26.713 in (null):K-9999 (3) and CE2(231) at 52.6841 24.8896 26.1443 in (null):Y-9999 (31) other bump:2.23398 Ang CB(15) at 52.39 26.447 26.713 in (null):K-9999 (3) and CE1(230) at 50.4292 25.3823 26.824 in (null):Y-9999 (31) other bump:2.93154 Ang CB(15) at 52.39 26.447 26.713 in (null):K-9999 (3) and CD2(229) at 52.2072 23.8691 25.3291 in (null):Y-9999 (31) other bump:2.291 Ang O(28) at 49.17 25.928 24.54 in (null):D-9999 (4) and CD1(228) at 49.9646 24.3647 26.0142 in (null):Y-9999 (31) other bump:2.44142 Ang NE2(72) at 51.0545 17.3072 17.7356 in (null):Q-9999 (9) and NZ(181) at 50.0568 19.1453 18.9952 in (null):K-9999 (24) other bump:2.61143 Ang CD(70) at 51.9223 18.2396 17.4079 in (null):Q-9999 (9) and NZ(181) at 50.0568 19.1453 18.9952 in (null):K-9999 (24) other bump:2.47497 Ang NE2(72) at 51.0545 17.3072 17.7356 in (null):Q-9999 (9) and CE(180) at 51.0125 19.7635 18.036 in (null):K-9999 (24) other bump:1.95041 Ang CG(69) at 51.5361 19.1405 16.2635 in (null):Q-9999 (9) and CE(180) at 51.0125 19.7635 18.036 in (null):K-9999 (24) other bump:1.88267 Ang CD(70) at 51.9223 18.2396 17.4079 in (null):Q-9999 (9) and CE(180) at 51.0125 19.7635 18.036 in (null):K-9999 (24) other bump:2.40432 Ang OE1(71) at 52.9851 18.3894 18.0006 in (null):Q-9999 (9) and CE(180) at 51.0125 19.7635 18.036 in (null):K-9999 (24) other bump:1.73671 Ang NE2(72) at 51.0545 17.3072 17.7356 in (null):Q-9999 (9) and CD(179) at 51.9778 18.748 17.4396 in (null):K-9999 (24) other bump:2.592 Ang CB(68) at 50.665 18.4457 15.2251 in (null):Q-9999 (9) and CD(179) at 51.9778 18.748 17.4396 in (null):K-9999 (24) other bump:1.31615 Ang CG(69) at 51.5361 19.1405 16.2635 in (null):Q-9999 (9) and CD(179) at 51.9778 18.748 17.4396 in (null):K-9999 (24) other bump:0.512463 Ang CD(70) at 51.9223 18.2396 17.4079 in (null):Q-9999 (9) and CD(179) at 51.9778 18.748 17.4396 in (null):K-9999 (24) other bump:1.20752 Ang OE1(71) at 52.9851 18.3894 18.0006 in (null):Q-9999 (9) and CD(179) at 51.9778 18.748 17.4396 in (null):K-9999 (24) other bump:2.1182 Ang NE2(72) at 51.0545 17.3072 17.7356 in (null):Q-9999 (9) and CG(178) at 52.8533 18.1122 18.5122 in (null):K-9999 (24) other bump:2.80158 Ang CG(69) at 51.5361 19.1405 16.2635 in (null):Q-9999 (9) and CG(178) at 52.8533 18.1122 18.5122 in (null):K-9999 (24) other bump:1.44995 Ang CD(70) at 51.9223 18.2396 17.4079 in (null):Q-9999 (9) and CG(178) at 52.8533 18.1122 18.5122 in (null):K-9999 (24) other bump:0.5966 Ang OE1(71) at 52.9851 18.3894 18.0006 in (null):Q-9999 (9) and CG(178) at 52.8533 18.1122 18.5122 in (null):K-9999 (24) other bump:2.28438 Ang CD(70) at 51.9223 18.2396 17.4079 in (null):Q-9999 (9) and CB(177) at 53.9028 17.2053 17.8835 in (null):K-9999 (24) other bump:1.50259 Ang OE1(71) at 52.9851 18.3894 18.0006 in (null):Q-9999 (9) and CB(177) at 53.9028 17.2053 17.8835 in (null):K-9999 (24) other bump:2.75369 Ang OE1(71) at 52.9851 18.3894 18.0006 in (null):Q-9999 (9) and CA(176) at 54.862 16.574 18.875 in (null):K-9999 (24) neighbor-bump: 1.75114 Ang O(117) at 60.22 17.243 6.247 in (null):L-9999 (15) and CD(123) at 61.2019 15.7935 6.21119 in (null):P-9999 (16) neighbor-bump: 1.55275 Ang CA(112) at 60.702 15.392 4.797 in (null):L-9999 (15) and CD(123) at 61.2019 15.7935 6.21119 in (null):P-9999 (16) neighbor-bump: 2.09954 Ang CB(113) at 61.9756 15.3353 4.31395 in (null):L-9999 (15) and CD(123) at 61.2019 15.7935 6.21119 in (null):P-9999 (16) neighbor-bump: 0.808638 Ang C(118) at 60.435 16.043 6.152 in (null):L-9999 (15) and CD(123) at 61.2019 15.7935 6.21119 in (null):P-9999 (16) self-bump: 1.36808 Ang N(119) at 60.425 15.251 7.198 in (null):P-9999 (16) and CD(123) at 61.2019 15.7935 6.21119 in (null):P-9999 (16) neighbor-bump: 1.87031 Ang O(117) at 60.22 17.243 6.247 in (null):L-9999 (15) and CG(122) at 61.9014 16.8934 6.98786 in (null):P-9999 (16) neighbor-bump: 2.9142 Ang CA(112) at 60.702 15.392 4.797 in (null):L-9999 (15) and CG(122) at 61.9014 16.8934 6.98786 in (null):P-9999 (16) neighbor-bump: 3.09565 Ang CB(113) at 61.9756 15.3353 4.31395 in (null):L-9999 (15) and CG(122) at 61.9014 16.8934 6.98786 in (null):P-9999 (16) neighbor-bump: 1.88999 Ang C(118) at 60.435 16.043 6.152 in (null):L-9999 (15) and CG(122) at 61.9014 16.8934 6.98786 in (null):P-9999 (16) self-bump: 2.2184 Ang N(119) at 60.425 15.251 7.198 in (null):P-9999 (16) and CG(122) at 61.9014 16.8934 6.98786 in (null):P-9999 (16) neighbor-bump: 1.92371 Ang O(117) at 60.22 17.243 6.247 in (null):L-9999 (15) and CB(121) at 60.9117 17.2841 8.04159 in (null):P-9999 (16) neighbor-bump: 2.31043 Ang C(118) at 60.435 16.043 6.152 in (null):L-9999 (15) and CB(121) at 60.9117 17.2841 8.04159 in (null):P-9999 (16) self-bump: 1.36328 Ang CA(112) at 60.702 15.392 4.797 in (null):L-9999 (15) and CB(113) at 61.9756 15.3353 4.31395 in (null):L-9999 (15) neighbor-bump: 2.60195 Ang C(99) at 53.505 17.39 4.442 in (null):F-9999 (12) and CB(102) at 56.0896 17.2087 4.20349 in (null):S-9999 (13) neighbor-bump: 2.20059 Ang O(98) at 54.238 18.362 4.493 in (null):F-9999 (12) and CB(102) at 56.0896 17.2087 4.20349 in (null):S-9999 (13) neighbor-bump: 2.88076 Ang C(74) at 49.995 18.749 12.703 in (null):Q-9999 (9) and CG2(79) at 47.4915 17.7495 11.6871 in (null):V-9999 (10) other bump:2.91084 Ang CG(25) at 50.9524 27.7971 20.7019 in (null):D-9999 (4) and CH2(55) at 52.9546 27.2678 18.6564 in (null):W-9999 (7) other bump:1.83214 Ang OD2(27) at 51.4985 27.1765 19.7645 in (null):D-9999 (4) and CH2(55) at 52.9546 27.2678 18.6564 in (null):W-9999 (7) other bump:2.63256 Ang OD2(27) at 51.4985 27.1765 19.7645 in (null):D-9999 (4) and CZ3(54) at 52.7205 26.4224 17.558 in (null):W-9999 (7) other bump:2.96809 Ang CB(24) at 50.0375 27.0141 21.6161 in (null):D-9999 (4) and CZ2(53) at 52.4602 26.9762 19.9018 in (null):W-9999 (7) other bump:1.89399 Ang CG(25) at 50.9524 27.7971 20.7019 in (null):D-9999 (4) and CZ2(53) at 52.4602 26.9762 19.9018 in (null):W-9999 (7) other bump:2.63853 Ang OD1(26) at 51.1093 29.0114 20.8993 in (null):D-9999 (4) and CZ2(53) at 52.4602 26.9762 19.9018 in (null):W-9999 (7) other bump:0.991911 Ang OD2(27) at 51.4985 27.1765 19.7645 in (null):D-9999 (4) and CZ2(53) at 52.4602 26.9762 19.9018 in (null):W-9999 (7) other bump:2.09531 Ang CB(24) at 50.0375 27.0141 21.6161 in (null):D-9999 (4) and NE1(52) at 51.1052 25.2727 21.1496 in (null):W-9999 (7) other bump:2.56835 Ang CG(25) at 50.9524 27.7971 20.7019 in (null):D-9999 (4) and NE1(52) at 51.1052 25.2727 21.1496 in (null):W-9999 (7) other bump:2.38703 Ang OD2(27) at 51.4985 27.1765 19.7645 in (null):D-9999 (4) and NE1(52) at 51.1052 25.2727 21.1496 in (null):W-9999 (7) other bump:3.23018 Ang CA(23) at 49.876 27.605 23.016 in (null):D-9999 (4) and NE1(52) at 51.1052 25.2727 21.1496 in (null):W-9999 (7) other bump:2.86262 Ang OD2(27) at 51.4985 27.1765 19.7645 in (null):D-9999 (4) and CE3(51) at 51.9733 25.2539 17.6975 in (null):W-9999 (7) other bump:2.59527 Ang CB(24) at 50.0375 27.0141 21.6161 in (null):D-9999 (4) and CE2(50) at 51.7112 25.8053 20.0435 in (null):W-9999 (7) other bump:2.23074 Ang CG(25) at 50.9524 27.7971 20.7019 in (null):D-9999 (4) and CE2(50) at 51.7112 25.8053 20.0435 in (null):W-9999 (7) other bump:1.4154 Ang OD2(27) at 51.4985 27.1765 19.7645 in (null):D-9999 (4) and CE2(50) at 51.7112 25.8053 20.0435 in (null):W-9999 (7) other bump:2.38254 Ang OD2(27) at 51.4985 27.1765 19.7645 in (null):D-9999 (4) and CD2(49) at 51.4575 24.9338 18.9613 in (null):W-9999 (7) other bump:3.0581 Ang CB(24) at 50.0375 27.0141 21.6161 in (null):D-9999 (4) and CD1(48) at 50.4823 24.1021 20.7952 in (null):W-9999 (7) Number of specific fragments= 8 total=144 Number of alignments=32 # Reading fragments from alignment file # T0159 read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1b16A/1b16A-T0159-fssp-global-adpstyle1.pw.a2m.gz # 1b16A read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1b16A/1b16A-T0159-fssp-global-adpstyle1.pw.a2m.gz # found chain 1b16A in template set T0159 1 :KKFYREGVFV 1b16A 6 :KNVIFVAALG Fragment has 8 clashes (null) has 8 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.40283 Ang CG1(86) at 9.1031 -10.2939 -2.16121 in (null):V-9999 (9) and N(90) at 8.302 -10.928 -4.336 in (null):G-9999 (10) other bump:2.30928 Ang O(50) at 19.589 -12.657 -1.758 in (null):R-9999 (4) and CG2(69) at 18.439 -12.1332 -3.69087 in (null):V-9999 (7) other bump:2.86417 Ang C(51) at 19.982 -11.572 -1.344 in (null):R-9999 (4) and CG2(69) at 18.439 -12.1332 -3.69087 in (null):V-9999 (7) other bump:2.63388 Ang CB(43) at 20.115 -10.1181 -3.43064 in (null):R-9999 (4) and CG2(69) at 18.439 -12.1332 -3.69087 in (null):V-9999 (7) other bump:2.86759 Ang CG(44) at 18.8263 -9.3443 -3.14755 in (null):R-9999 (4) and CG2(69) at 18.439 -12.1332 -3.69087 in (null):V-9999 (7) other bump:3.18296 Ang CD(45) at 17.9966 -9.06361 -4.4072 in (null):R-9999 (4) and CG2(69) at 18.439 -12.1332 -3.69087 in (null):V-9999 (7) other bump:3.14403 Ang CA(42) at 20.788 -10.632 -2.237 in (null):R-9999 (4) and CG2(69) at 18.439 -12.1332 -3.69087 in (null):V-9999 (7) other bump:2.70638 Ang CE2(25) at 21.626 -8.31864 -4.77357 in (null):F-9999 (2) and CB(43) at 20.115 -10.1181 -3.43064 in (null):R-9999 (4) T0159 11 :NGAAQGYLID 1b16A 28 :RNLKNFVILD Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 12 residues other bump:2.95574 Ang CD2(42) at 25.1448 -15.9408 -1.47149 in (null):Y-9999 (7) and CD1(62) at 22.927 -16.7664 0.299537 in (null):I-9999 (9) other bump:2.28729 Ang CE2(44) at 25.0474 -16.9642 -0.535091 in (null):Y-9999 (7) and CD1(62) at 22.927 -16.7664 0.299537 in (null):I-9999 (9) other bump:2.99197 Ang CZ(45) at 25.1874 -18.2801 -0.946073 in (null):Y-9999 (7) and CD1(62) at 22.927 -16.7664 0.299537 in (null):I-9999 (9) T0159 21 :KKTADQYKITN 1b16A 56 :NITFHTYDVTV Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 13 residues other bump:2.27813 Ang O(68) at 18.047 -17.012 8.934 in (null):K-9999 (8) and OD1(90) at 18.9809 -18.9943 9.55705 in (null):N-9999 (11) T0159 32 :IAQLKDPKIAK 1b16A 69 :AESKKLLKKIF Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 13 residues other bump:1.55918 Ang O(22) at 26.934 -15.865 7.849 in (null):Q-9999 (3) and CD(53) at 27.4507 -16.2523 6.42982 in (null):P-9999 (7) other bump:2.789 Ang C(23) at 26.546 -15.849 9.037 in (null):Q-9999 (3) and CD(53) at 27.4507 -16.2523 6.42982 in (null):P-9999 (7) other bump:2.06952 Ang O(22) at 26.934 -15.865 7.849 in (null):Q-9999 (3) and CG(52) at 27.3507 -14.765 6.14624 in (null):P-9999 (7) other bump:3.19044 Ang C(23) at 26.546 -15.849 9.037 in (null):Q-9999 (3) and CG(52) at 27.3507 -14.765 6.14624 in (null):P-9999 (7) T0159 43 :LFDTNGDGKADLT 1b16A 103 :TIAINFTGLVNTT Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues T0159 56 :GCNPGW 1b16A 117 :AILDFW Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 8 residues other bump:1.8685 Ang O(4) at 29.883 -10.745 9.228 in (null):G-9999 (1) and CD(24) at 31.0177 -9.46215 9.97506 in (null):P-9999 (4) other bump:2.59368 Ang C(5) at 28.705 -10.338 9.193 in (null):G-9999 (1) and CD(24) at 31.0177 -9.46215 9.97506 in (null):P-9999 (4) neighbor-bump: 2.66563 Ang N(12) at 30.042 -7.581 8.358 in (null):N-9999 (3) and CD(24) at 31.0177 -9.46215 9.97506 in (null):P-9999 (4) other bump:2.2484 Ang O(4) at 29.883 -10.745 9.228 in (null):G-9999 (1) and CG(23) at 31.4892 -10.6464 10.7982 in (null):P-9999 (4) other bump:3.22858 Ang C(5) at 28.705 -10.338 9.193 in (null):G-9999 (1) and CG(23) at 31.4892 -10.6464 10.7982 in (null):P-9999 (4) T0159 62 :GCEGAINHQ 1b16A 130 :GGIIANICS Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.23471 Ang CG(49) at 12.6918 1.66342 2.6586 in (null):H-9999 (8) and N(56) at 11.058 0.717 3.854 in (null):Q-9999 (9) neighbor-bump: 2.64821 Ang ND1(51) at 12.0148 2.87097 2.6465 in (null):H-9999 (8) and N(56) at 11.058 0.717 3.854 in (null):Q-9999 (9) neighbor-bump: 2.27242 Ang CB(48) at 13.2947 1.11421 3.91183 in (null):H-9999 (8) and N(56) at 11.058 0.717 3.854 in (null):Q-9999 (9) T0159 71 :LAAYELTNTVT 1b16A 156 :AAVVSFTNSLA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 13 residues T0159 83 :NQGNYAAMMADTISRYKEGKPVFYYT 1b16A 213 :TSEQCGQNFVKAIEANKNGAIWKLDL Fragment has 23 clashes (null) has 23 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues neighbor-bump: 2.82645 Ang CD1(198) at 4.22736 7.46911 -4.43213 in (null):Y-9999 (25) and OG1(210) at 2.60493 6.50581 -6.53654 in (null):T-9999 (26) other bump:2.60471 Ang CZ(179) at 6.5121 6.93908 -1.99951 in (null):F-9999 (23) and CD2(199) at 4.24323 5.84595 -2.66419 in (null):Y-9999 (25) other bump:2.73069 Ang CE2(178) at 7.09969 7.90891 -2.82989 in (null):F-9999 (23) and CG(197) at 4.90257 6.52968 -3.68256 in (null):Y-9999 (25) other bump:2.1423 Ang CZ(179) at 6.5121 6.93908 -1.99951 in (null):F-9999 (23) and CB(196) at 6.3779 6.22872 -4.01615 in (null):Y-9999 (25) other bump:3.14627 Ang CD2(176) at 8.47088 8.19321 -2.72803 in (null):F-9999 (23) and CB(196) at 6.3779 6.22872 -4.01615 in (null):Y-9999 (25) other bump:2.17973 Ang CE2(178) at 7.09969 7.90891 -2.82989 in (null):F-9999 (23) and CB(196) at 6.3779 6.22872 -4.01615 in (null):Y-9999 (25) other bump:2.52593 Ang CG1(167) at 15.3173 5.3987 -3.9232 in (null):V-9999 (22) and OH(191) at 16.4262 5.01621 -6.16025 in (null):Y-9999 (24) other bump:2.30188 Ang CB(84) at 18.0899 3.44233 -5.92844 in (null):T-9999 (12) and OH(191) at 16.4262 5.01621 -6.16025 in (null):Y-9999 (24) other bump:2.19035 Ang CG1(167) at 15.3173 5.3987 -3.9232 in (null):V-9999 (22) and CZ(190) at 15.1224 4.56054 -5.93744 in (null):Y-9999 (24) other bump:2.70685 Ang CB(166) at 15.9816 5.42214 -2.5422 in (null):V-9999 (22) and CE1(188) at 14.6703 4.3393 -4.64816 in (null):Y-9999 (24) other bump:1.43756 Ang CG1(167) at 15.3173 5.3987 -3.9232 in (null):V-9999 (22) and CE1(188) at 14.6703 4.3393 -4.64816 in (null):Y-9999 (24) other bump:2.73996 Ang CB(55) at 12.7755 2.76275 -9.32084 in (null):M-9999 (8) and CD2(187) at 13.0318 3.90565 -6.84385 in (null):Y-9999 (24) other bump:2.51348 Ang CG1(167) at 15.3173 5.3987 -3.9232 in (null):V-9999 (22) and CD1(186) at 13.3682 3.89695 -4.43601 in (null):Y-9999 (24) other bump:2.49827 Ang NZ(154) at 17.0198 8.13602 -3.19117 in (null):K-9999 (20) and CG2(168) at 17.4652 5.71868 -2.74459 in (null):V-9999 (22) other bump:2.74423 Ang OG1(86) at 18.528 4.34998 -4.87246 in (null):T-9999 (12) and CG2(168) at 17.4652 5.71868 -2.74459 in (null):V-9999 (22) other bump:2.20908 Ang CD(152) at 19.2127 7.05466 -2.94816 in (null):K-9999 (20) and CG2(168) at 17.4652 5.71868 -2.74459 in (null):V-9999 (22) other bump:2.18597 Ang CE(153) at 18.116 7.44282 -3.92028 in (null):K-9999 (20) and CG2(168) at 17.4652 5.71868 -2.74459 in (null):V-9999 (22) other bump:3.30561 Ang NZ(154) at 17.0198 8.13602 -3.19117 in (null):K-9999 (20) and CG1(167) at 15.3173 5.3987 -3.9232 in (null):V-9999 (22) other bump:2.8616 Ang NZ(154) at 17.0198 8.13602 -3.19117 in (null):K-9999 (20) and CA(165) at 15.329 6.468 -1.595 in (null):V-9999 (22) other bump:1.8742 Ang NH2(111) at 18.4188 7.57765 -5.76494 in (null):R-9999 (15) and CE(153) at 18.116 7.44282 -3.92028 in (null):K-9999 (20) other bump:2.33492 Ang OD1(7) at 5.6274 -1.67179 -12.0495 in (null):N-9999 (1) and OD1(28) at 5.05876 0.510288 -12.6553 in (null):N-9999 (4) other bump:2.39229 Ang OD1(7) at 5.6274 -1.67179 -12.0495 in (null):N-9999 (1) and CG(26) at 6.29575 0.50035 -12.7965 in (null):N-9999 (4) other bump:2.58626 Ang OD1(7) at 5.6274 -1.67179 -12.0495 in (null):N-9999 (1) and CB(25) at 7.19638 0.333236 -11.5946 in (null):N-9999 (4) Number of specific fragments= 9 total=153 Number of alignments=33 # Reading fragments from alignment file # T0159 read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1b16A/1b16A-T0159-fssp-global-adpstyle5.pw.a2m.gz # 1b16A read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1b16A/1b16A-T0159-fssp-global-adpstyle5.pw.a2m.gz # found chain 1b16A in template set T0159 1 :KKFYREGVFV 1b16A 6 :KNVIFVAALG Fragment has 8 clashes (null) has 8 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.40283 Ang CG1(86) at 9.1031 -10.2939 -2.16121 in (null):V-9999 (9) and N(90) at 8.302 -10.928 -4.336 in (null):G-9999 (10) other bump:2.30928 Ang O(50) at 19.589 -12.657 -1.758 in (null):R-9999 (4) and CG2(69) at 18.439 -12.1332 -3.69087 in (null):V-9999 (7) other bump:2.86417 Ang C(51) at 19.982 -11.572 -1.344 in (null):R-9999 (4) and CG2(69) at 18.439 -12.1332 -3.69087 in (null):V-9999 (7) other bump:2.63388 Ang CB(43) at 20.115 -10.1181 -3.43064 in (null):R-9999 (4) and CG2(69) at 18.439 -12.1332 -3.69087 in (null):V-9999 (7) other bump:2.86759 Ang CG(44) at 18.8263 -9.3443 -3.14755 in (null):R-9999 (4) and CG2(69) at 18.439 -12.1332 -3.69087 in (null):V-9999 (7) other bump:3.18296 Ang CD(45) at 17.9966 -9.06361 -4.4072 in (null):R-9999 (4) and CG2(69) at 18.439 -12.1332 -3.69087 in (null):V-9999 (7) other bump:3.14403 Ang CA(42) at 20.788 -10.632 -2.237 in (null):R-9999 (4) and CG2(69) at 18.439 -12.1332 -3.69087 in (null):V-9999 (7) other bump:2.70638 Ang CE2(25) at 21.626 -8.31864 -4.77357 in (null):F-9999 (2) and CB(43) at 20.115 -10.1181 -3.43064 in (null):R-9999 (4) T0159 11 :NGAAQGYLIDKK 1b16A 28 :RNLKNFVILDRV Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:2.95574 Ang CD2(42) at 25.1448 -15.9408 -1.47149 in (null):Y-9999 (7) and CD1(62) at 22.927 -16.7664 0.299537 in (null):I-9999 (9) other bump:2.28729 Ang CE2(44) at 25.0474 -16.9642 -0.535091 in (null):Y-9999 (7) and CD1(62) at 22.927 -16.7664 0.299537 in (null):I-9999 (9) other bump:2.99197 Ang CZ(45) at 25.1874 -18.2801 -0.946073 in (null):Y-9999 (7) and CD1(62) at 22.927 -16.7664 0.299537 in (null):I-9999 (9) T0159 24 :ADQYKITNIAQ 1b16A 40 :ENPTALAELKA Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 13 residues other bump:2.73877 Ang OD2(12) at 9.85968 -19.1211 -7.19203 in (null):D-9999 (2) and CD(40) at 11.1565 -16.7206 -7.43004 in (null):K-9999 (5) T0159 37 :DPKIAKLFDTNG 1b16A 68 :VAESKKLLKKIF Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:2.6732 Ang CG2(30) at 24.7514 -13.6399 8.5922 in (null):I-9999 (4) and CE1(62) at 25.2862 -12.9423 6.06766 in (null):F-9999 (8) T0159 49 :DGKADLTGCNPGW 1b16A 82 :LKTVDILINGAGI Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues neighbor-bump: 2.64608 Ang N(61) at 16.783 -7.872 1.993 in (null):N-9999 (10) and CD(73) at 15.9706 -9.53164 3.88703 in (null):P-9999 (11) neighbor-bump: 2.50366 Ang O(34) at 29.597 -4.028 -2.506 in (null):D-9999 (5) and CD1(40) at 27.8864 -2.61551 -3.66658 in (null):L-9999 (6) T0159 62 :GCEGAINHQLAAYELT 1b16A 107 :NFTGLVNTTTAILDFW Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 18 residues other bump:2.84456 Ang CG(59) at 24.9709 -4.13302 8.62792 in (null):Q-9999 (9) and CE2(90) at 27.7504 -3.53177 8.69553 in (null):Y-9999 (13) other bump:2.49788 Ang O(63) at 27.078 -6.704 9.155 in (null):Q-9999 (9) and CD2(88) at 28.3915 -4.58253 9.27138 in (null):Y-9999 (13) T0159 78 :NTVTHNQGN 1b16A 130 :GGIIANICS Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.24931 Ang CB(4) at 33.8762 -1.51936 3.57782 in (null):N-9999 (1) and N(10) at 32.585 -2.181 1.859 in (null):T-9999 (2) self-bump: 2.10263 Ang CB(4) at 33.8762 -1.51936 3.57782 in (null):N-9999 (1) and C(9) at 33.737 -2.838 1.946 in (null):N-9999 (1) self-bump: 1.28466 Ang CA(3) at 34.732 -2.237 2.943 in (null):N-9999 (1) and CB(4) at 33.8762 -1.51936 3.57782 in (null):N-9999 (1) T0159 87 :YAAMMADTISRYKEGK 1b16A 155 :KAAVVSFTNSLAKLAP Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 18 residues other bump:2.56473 Ang CA(75) at 25.357 2.7 9.027 in (null):R-9999 (11) and OE1(111) at 26.5297 3.99456 10.9049 in (null):E-9999 (14) other bump:1.29486 Ang O(72) at 25.706 4.941 10.585 in (null):S-9999 (10) and OE1(111) at 26.5297 3.99456 10.9049 in (null):E-9999 (14) other bump:2.07606 Ang C(73) at 24.553 4.462 10.476 in (null):S-9999 (10) and OE1(111) at 26.5297 3.99456 10.9049 in (null):E-9999 (14) other bump:2.07823 Ang O(72) at 25.706 4.941 10.585 in (null):S-9999 (10) and CD(110) at 27.0282 4.23545 12.0248 in (null):E-9999 (14) other bump:2.92862 Ang C(73) at 24.553 4.462 10.476 in (null):S-9999 (10) and CD(110) at 27.0282 4.23545 12.0248 in (null):E-9999 (14) other bump:2.59615 Ang CG2(64) at 20.5496 8.38389 9.43363 in (null):I-9999 (9) and NZ(103) at 22.424 10.123 9.883 in (null):K-9999 (13) T0159 103 :PVFYYT 1b16A 175 :TAYSIN Fragment has 8 clashes (null) has 8 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 8 residues other bump:2.7526 Ang CD1(20) at 21.029 2.245 -1.356 in (null):F-9999 (3) and OH(48) at 20.7631 1.31483 -3.93299 in (null):Y-9999 (5) other bump:1.75032 Ang CE1(22) at 21.377 1.294 -2.294 in (null):F-9999 (3) and OH(48) at 20.7631 1.31483 -3.93299 in (null):Y-9999 (5) other bump:2.37675 Ang CZ(24) at 22.719 1.133 -2.595 in (null):F-9999 (3) and OH(48) at 20.7631 1.31483 -3.93299 in (null):Y-9999 (5) other bump:2.71886 Ang CD1(20) at 21.029 2.245 -1.356 in (null):F-9999 (3) and CZ(47) at 19.5531 1.09284 -3.32743 in (null):Y-9999 (5) other bump:2.10594 Ang CE1(22) at 21.377 1.294 -2.294 in (null):F-9999 (3) and CZ(47) at 19.5531 1.09284 -3.32743 in (null):Y-9999 (5) other bump:2.7037 Ang CD1(20) at 21.029 2.245 -1.356 in (null):F-9999 (3) and CE2(46) at 19.4469 0.235639 -2.2331 in (null):Y-9999 (5) other bump:2.20211 Ang CE1(22) at 21.377 1.294 -2.294 in (null):F-9999 (3) and CE2(46) at 19.4469 0.235639 -2.2331 in (null):Y-9999 (5) neighbor-bump: 2.97684 Ang C(8) at 27.069 1.787 2.955 in (null):P-9999 (1) and CG1(12) at 25.2645 0.277423 4.77891 in (null):V-9999 (2) T0159 111 :P 1b16A 181 :P Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 3 residues T0159 112 :YWVSNELKPGKDVVWLQVPF 1b16A 209 :HPTQTSEQCGQNFVKAIEAN Fragment has 14 clashes (null) has 14 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 22 residues other bump:1.61891 Ang O(129) at 20.392 3.964 -9.452 in (null):W-9999 (15) and CD(159) at 21.8236 4.33055 -8.79086 in (null):P-9999 (19) other bump:2.75848 Ang C(130) at 19.355 3.289 -9.447 in (null):W-9999 (15) and CD(159) at 21.8236 4.33055 -8.79086 in (null):P-9999 (19) other bump:3.25097 Ang CA(132) at 19.202 3.532 -7.042 in (null):L-9999 (16) and CD(159) at 21.8236 4.33055 -8.79086 in (null):P-9999 (19) neighbor-bump: 2.79891 Ang CG1(151) at 21.9336 3.22562 -11.3601 in (null):V-9999 (18) and CD(159) at 21.8236 4.33055 -8.79086 in (null):P-9999 (19) other bump:2.88868 Ang C(138) at 20.531 2.87 -6.66 in (null):L-9999 (16) and CD(159) at 21.8236 4.33055 -8.79086 in (null):P-9999 (19) other bump:2.1185 Ang O(129) at 20.392 3.964 -9.452 in (null):W-9999 (15) and CG(158) at 21.2192 5.70525 -8.57348 in (null):P-9999 (19) other bump:3.17438 Ang C(130) at 19.355 3.289 -9.447 in (null):W-9999 (15) and CG(158) at 21.2192 5.70525 -8.57348 in (null):P-9999 (19) other bump:2.77851 Ang C(48) at 5.344 -3.093 -9.498 in (null):N-9999 (5) and CD(79) at 7.72327 -1.68316 -9.23051 in (null):P-9999 (9) other bump:3.26817 Ang CA(50) at 6.874 -4.809 -8.796 in (null):E-9999 (6) and CD(79) at 7.72327 -1.68316 -9.23051 in (null):P-9999 (9) other bump:3.04537 Ang C(57) at 7.909 -4.648 -9.901 in (null):E-9999 (6) and CD(79) at 7.72327 -1.68316 -9.23051 in (null):P-9999 (9) other bump:1.6498 Ang O(47) at 6.152 -2.181 -9.302 in (null):N-9999 (5) and CD(79) at 7.72327 -1.68316 -9.23051 in (null):P-9999 (9) other bump:2.29023 Ang O(47) at 6.152 -2.181 -9.302 in (null):N-9999 (5) and CG(78) at 7.7074 -1.6288 -7.71424 in (null):P-9999 (9) other bump:2.47669 Ang OD1(46) at 5.62739 -1.67179 -12.0495 in (null):N-9999 (5) and CG(69) at 6.35352 0.549726 -12.869 in (null):K-9999 (8) other bump:2.52035 Ang OD1(46) at 5.62739 -1.67179 -12.0495 in (null):N-9999 (5) and CB(68) at 7.18104 0.268995 -11.6351 in (null):K-9999 (8) Number of specific fragments= 11 total=164 Number of alignments=34 # Reading fragments from alignment file # T0159 read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1kq3A/T0159-1kq3A-2track-protein-EBGHSTL-local-adpstyle1.pw.a2m.gz # 1kq3A read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1kq3A/T0159-1kq3A-2track-protein-EBGHSTL-local-adpstyle1.pw.a2m.gz # found chain 1kq3A in template set T0159 60 :GWGCEGAINHQLAAYELTNTVT 1kq3A 64 :GGECSDEEIERLSGLVEEETDV Fragment has 11 clashes (null) has 11 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 24 residues other bump:1.32166 Ang OE1(118) at 8.05826 12.4268 13.165 in (null):E-9999 (16) and OG1(149) at 6.989 12.721 12.446 in (null):T-9999 (20) other bump:2.52866 Ang CD(117) at 9.23386 12.1806 13.4769 in (null):E-9999 (16) and OG1(149) at 6.989 12.721 12.446 in (null):T-9999 (20) other bump:2.53593 Ang OE1(118) at 8.05826 12.4268 13.165 in (null):E-9999 (16) and CG2(148) at 8.559 14.272 11.499 in (null):T-9999 (20) other bump:2.95657 Ang CD(117) at 9.23386 12.1806 13.4769 in (null):E-9999 (16) and CG2(148) at 8.559 14.272 11.499 in (null):T-9999 (20) other bump:2.11039 Ang OE1(118) at 8.05826 12.4268 13.165 in (null):E-9999 (16) and CB(147) at 7.614 13.08 11.208 in (null):T-9999 (20) other bump:2.92928 Ang CD(117) at 9.23386 12.1806 13.4769 in (null):E-9999 (16) and CB(147) at 7.614 13.08 11.208 in (null):T-9999 (20) other bump:2.40689 Ang O(81) at 12.876 7.34 20.983 in (null):Q-9999 (11) and CD1(105) at 10.8344 8.20905 21.9156 in (null):Y-9999 (15) other bump:2.94541 Ang OE2(36) at 21.9928 7.3873 26.0847 in (null):E-9999 (5) and CG1(51) at 20.4921 9.54057 24.7481 in (null):I-9999 (8) other bump:3.17867 Ang CG(33) at 23.1146 8.04205 24.0794 in (null):E-9999 (5) and N(48) at 20.294 7.338 22.794 in (null):I-9999 (8) neighbor-bump: 2.29831 Ang O(4) at 19.955 13.793 28.831 in (null):G-9999 (1) and CD1(10) at 20.5023 15.1214 30.6249 in (null):W-9999 (2) neighbor-bump: 2.37093 Ang O(4) at 19.955 13.793 28.831 in (null):G-9999 (1) and CG(9) at 20.7581 15.9086 29.5384 in (null):W-9999 (2) T0159 82 :HNQGNYAAMMADTISRYKEGKPVFYY 1kq3A 87 :VGIGGGKTLDTAKAVAYKLKKPVVIV Fragment has 62 clashes (null) has 62 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:2.30233 Ang CA(93) at 20.93 15.257 12.461 in (null):T-9999 (13) and OH(201) at 20.6057 16.9838 10.9732 in (null):Y-9999 (25) other bump:2.66629 Ang CG1(177) at 18.955 17.949 9.115 in (null):V-9999 (23) and OH(201) at 20.6057 16.9838 10.9732 in (null):Y-9999 (25) other bump:2.80166 Ang CG2(95) at 22.9422 15.438 10.9638 in (null):T-9999 (13) and OH(201) at 20.6057 16.9838 10.9732 in (null):Y-9999 (25) other bump:2.47852 Ang CB(94) at 22.3466 15.8251 12.3033 in (null):T-9999 (13) and OH(201) at 20.6057 16.9838 10.9732 in (null):Y-9999 (25) other bump:2.16977 Ang OG1(96) at 22.2403 17.2738 12.3702 in (null):T-9999 (13) and OH(201) at 20.6057 16.9838 10.9732 in (null):Y-9999 (25) other bump:3.09062 Ang CZ(119) at 17.5683 17.9782 11.9253 in (null):R-9999 (16) and CZ(200) at 20.5826 18.3081 11.3277 in (null):Y-9999 (25) other bump:2.00606 Ang NH2(121) at 18.7743 18.4787 12.1792 in (null):R-9999 (16) and CZ(200) at 20.5826 18.3081 11.3277 in (null):Y-9999 (25) other bump:2.77022 Ang CG1(177) at 18.955 17.949 9.115 in (null):V-9999 (23) and CZ(200) at 20.5826 18.3081 11.3277 in (null):Y-9999 (25) other bump:2.21463 Ang OG1(96) at 22.2403 17.2738 12.3702 in (null):T-9999 (13) and CZ(200) at 20.5826 18.3081 11.3277 in (null):Y-9999 (25) other bump:2.66822 Ang NH2(121) at 18.7743 18.4787 12.1792 in (null):R-9999 (16) and CE2(199) at 20.5385 19.3083 10.3574 in (null):Y-9999 (25) other bump:2.42868 Ang CG1(177) at 18.955 17.949 9.115 in (null):V-9999 (23) and CE2(199) at 20.5385 19.3083 10.3574 in (null):Y-9999 (25) other bump:1.92198 Ang NH2(121) at 18.7743 18.4787 12.1792 in (null):R-9999 (16) and CE1(198) at 20.6269 18.6276 12.6689 in (null):Y-9999 (25) other bump:2.1272 Ang OG1(96) at 22.2403 17.2738 12.3702 in (null):T-9999 (13) and CE1(198) at 20.6269 18.6276 12.6689 in (null):Y-9999 (25) other bump:2.53202 Ang NH2(121) at 18.7743 18.4787 12.1792 in (null):R-9999 (16) and CD1(196) at 20.6331 19.96 13.0519 in (null):Y-9999 (25) other bump:2.63642 Ang CD2(6) at 12.9697 22.3666 12.2447 in (null):H-9999 (1) and CB(183) at 15.0049 22.7005 10.6023 in (null):F-9999 (24) other bump:2.27733 Ang CD(117) at 16.152 16.5439 10.4906 in (null):R-9999 (16) and CG2(178) at 17.769 17.909 11.332 in (null):V-9999 (23) other bump:0.939629 Ang NE(118) at 17.4062 17.1677 10.8828 in (null):R-9999 (16) and CG2(178) at 17.769 17.909 11.332 in (null):V-9999 (23) other bump:1.88519 Ang NH1(120) at 16.5406 18.3101 12.7046 in (null):R-9999 (16) and CG2(178) at 17.769 17.909 11.332 in (null):V-9999 (23) other bump:0.630083 Ang CZ(119) at 17.5683 17.9782 11.9253 in (null):R-9999 (16) and CG2(178) at 17.769 17.909 11.332 in (null):V-9999 (23) other bump:1.43282 Ang NH2(121) at 18.7743 18.4787 12.1792 in (null):R-9999 (16) and CG2(178) at 17.769 17.909 11.332 in (null):V-9999 (23) other bump:2.4768 Ang NE(118) at 17.4062 17.1677 10.8828 in (null):R-9999 (16) and CG1(177) at 18.955 17.949 9.115 in (null):V-9999 (23) other bump:3.11491 Ang NH2(121) at 18.7743 18.4787 12.1792 in (null):R-9999 (16) and CG1(177) at 18.955 17.949 9.115 in (null):V-9999 (23) other bump:1.95889 Ang CD(117) at 16.152 16.5439 10.4906 in (null):R-9999 (16) and CB(176) at 17.643 17.631 9.833 in (null):V-9999 (23) other bump:1.17171 Ang NE(118) at 17.4062 17.1677 10.8828 in (null):R-9999 (16) and CB(176) at 17.643 17.631 9.833 in (null):V-9999 (23) other bump:2.12218 Ang CZ(119) at 17.5683 17.9782 11.9253 in (null):R-9999 (16) and CB(176) at 17.643 17.631 9.833 in (null):V-9999 (23) other bump:2.73919 Ang NH2(121) at 18.7743 18.4787 12.1792 in (null):R-9999 (16) and CB(176) at 17.643 17.631 9.833 in (null):V-9999 (23) other bump:2.28534 Ang CD(117) at 16.152 16.5439 10.4906 in (null):R-9999 (16) and CA(175) at 16.456 18.421 9.223 in (null):V-9999 (23) other bump:2.28664 Ang NE(118) at 17.4062 17.1677 10.8828 in (null):R-9999 (16) and CA(175) at 16.456 18.421 9.223 in (null):V-9999 (23) other bump:2.95561 Ang CZ(119) at 17.5683 17.9782 11.9253 in (null):R-9999 (16) and CA(175) at 16.456 18.421 9.223 in (null):V-9999 (23) other bump:2.96518 Ang CD(117) at 16.152 16.5439 10.4906 in (null):R-9999 (16) and N(174) at 16.192 17.942 7.876 in (null):V-9999 (23) other bump:3.06575 Ang CD(117) at 16.152 16.5439 10.4906 in (null):R-9999 (16) and C(173) at 15.169 17.113 7.643 in (null):P-9999 (22) other bump:2.62864 Ang CD(117) at 16.152 16.5439 10.4906 in (null):R-9999 (16) and O(172) at 14.391 16.731 8.548 in (null):P-9999 (22) other bump:2.74244 Ang C(1) at 13.81 18.134 12.521 in (null):G-9999 (0) and NH1(120) at 16.5406 18.3101 12.7046 in (null):R-9999 (16) other bump:2.93454 Ang ND2(16) at 18.3553 17.8461 14.7492 in (null):N-9999 (2) and CZ(119) at 17.5683 17.9782 11.9253 in (null):R-9999 (16) other bump:2.7289 Ang ND2(16) at 18.3553 17.8461 14.7492 in (null):N-9999 (2) and C(91) at 19.165 15.316 14.125 in (null):D-9999 (12) other bump:2.79949 Ang C(11) at 15.17 19.649 15.44 in (null):H-9999 (1) and OD2(89) at 17.3963 18.8669 16.9463 in (null):D-9999 (12) other bump:2.29285 Ang N(12) at 16.334 20.291 15.497 in (null):N-9999 (2) and OD2(89) at 17.3963 18.8669 16.9463 in (null):D-9999 (12) other bump:1.43991 Ang CA(13) at 17.174 20.264 16.678 in (null):N-9999 (2) and OD2(89) at 17.3963 18.8669 16.9463 in (null):D-9999 (12) other bump:2.84107 Ang C(19) at 17.334 21.699 17.163 in (null):N-9999 (2) and OD2(89) at 17.3963 18.8669 16.9463 in (null):D-9999 (12) other bump:1.44711 Ang CB(14) at 18.5085 19.6127 16.3977 in (null):N-9999 (2) and OD2(89) at 17.3963 18.8669 16.9463 in (null):D-9999 (12) other bump:1.51769 Ang CG(15) at 18.3759 18.1407 16.0428 in (null):N-9999 (2) and OD2(89) at 17.3963 18.8669 16.9463 in (null):D-9999 (12) other bump:1.81478 Ang OD1(17) at 18.279 17.2814 16.9225 in (null):N-9999 (2) and OD2(89) at 17.3963 18.8669 16.9463 in (null):D-9999 (12) other bump:2.36251 Ang CG(15) at 18.3759 18.1407 16.0428 in (null):N-9999 (2) and OD1(88) at 17.2556 16.7643 17.6021 in (null):D-9999 (12) other bump:1.33291 Ang OD1(17) at 18.279 17.2814 16.9225 in (null):N-9999 (2) and OD1(88) at 17.2556 16.7643 17.6021 in (null):D-9999 (12) other bump:2.65479 Ang CA(13) at 17.174 20.264 16.678 in (null):N-9999 (2) and CG(87) at 17.5914 17.644 16.7747 in (null):D-9999 (12) other bump:2.20424 Ang CB(14) at 18.5085 19.6127 16.3977 in (null):N-9999 (2) and CG(87) at 17.5914 17.644 16.7747 in (null):D-9999 (12) other bump:1.1823 Ang CG(15) at 18.3759 18.1407 16.0428 in (null):N-9999 (2) and CG(87) at 17.5914 17.644 16.7747 in (null):D-9999 (12) other bump:2.17409 Ang ND2(16) at 18.3553 17.8461 14.7492 in (null):N-9999 (2) and CG(87) at 17.5914 17.644 16.7747 in (null):D-9999 (12) other bump:0.791239 Ang OD1(17) at 18.279 17.2814 16.9225 in (null):N-9999 (2) and CG(87) at 17.5914 17.644 16.7747 in (null):D-9999 (12) other bump:2.58217 Ang CB(14) at 18.5085 19.6127 16.3977 in (null):N-9999 (2) and CB(86) at 18.259 17.2097 15.4861 in (null):D-9999 (12) other bump:1.09104 Ang CG(15) at 18.3759 18.1407 16.0428 in (null):N-9999 (2) and CB(86) at 18.259 17.2097 15.4861 in (null):D-9999 (12) other bump:0.978459 Ang ND2(16) at 18.3553 17.8461 14.7492 in (null):N-9999 (2) and CB(86) at 18.259 17.2097 15.4861 in (null):D-9999 (12) other bump:1.43828 Ang OD1(17) at 18.279 17.2814 16.9225 in (null):N-9999 (2) and CB(86) at 18.259 17.2097 15.4861 in (null):D-9999 (12) other bump:2.47659 Ang CG(15) at 18.3759 18.1407 16.0428 in (null):N-9999 (2) and CA(85) at 18.692 15.742 15.514 in (null):D-9999 (12) other bump:2.26399 Ang ND2(16) at 18.3553 17.8461 14.7492 in (null):N-9999 (2) and CA(85) at 18.692 15.742 15.514 in (null):D-9999 (12) other bump:2.12703 Ang OD1(17) at 18.279 17.2814 16.9225 in (null):N-9999 (2) and CA(85) at 18.692 15.742 15.514 in (null):D-9999 (12) other bump:2.99367 Ang CG(15) at 18.3759 18.1407 16.0428 in (null):N-9999 (2) and N(84) at 19.717 15.505 16.508 in (null):D-9999 (12) other bump:3.27647 Ang CE1(47) at 29.3618 19.3339 17.0427 in (null):Y-9999 (6) and SD(75) at 27.9406 16.4666 17.7454 in (null):M-9999 (10) other bump:2.7058 Ang OH(50) at 30.3085 17.1746 16.644 in (null):Y-9999 (6) and SD(75) at 27.9406 16.4666 17.7454 in (null):M-9999 (10) other bump:2.94077 Ang CD2(46) at 28.7179 18.5844 19.6319 in (null):Y-9999 (6) and SD(75) at 27.9406 16.4666 17.7454 in (null):M-9999 (10) other bump:2.15978 Ang CE2(48) at 29.3725 17.7032 18.7871 in (null):Y-9999 (6) and SD(75) at 27.9406 16.4666 17.7454 in (null):M-9999 (10) other bump:2.38273 Ang CZ(49) at 29.6846 18.0707 17.4951 in (null):Y-9999 (6) and SD(75) at 27.9406 16.4666 17.7454 in (null):M-9999 (10) Number of specific fragments= 2 total=166 Number of alignments=35 # Reading fragments from alignment file # T0159 read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1kq3A/T0159-1kq3A-2track-protein-EBGHSTL-local-adpstyle5.pw.a2m.gz # 1kq3A read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1kq3A/T0159-1kq3A-2track-protein-EBGHSTL-local-adpstyle5.pw.a2m.gz # found chain 1kq3A in template set T0159 36 :KDPKIAKLFD 1kq3A 45 :LGENFFSSFT Fragment has 11 clashes (null) has 11 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 12 residues other bump:1.89817 Ang CA(3) at 12.05 29.665 24.123 in (null):K-9999 (1) and CD1(40) at 10.3188 29.0898 23.5984 in (null):I-9999 (5) other bump:1.38381 Ang CB(4) at 11.583 28.7905 23.1216 in (null):K-9999 (1) and CD1(40) at 10.3188 29.0898 23.5984 in (null):I-9999 (5) other bump:1.89638 Ang O(9) at 9.91 30.614 24.65 in (null):K-9999 (1) and CD1(40) at 10.3188 29.0898 23.5984 in (null):I-9999 (5) other bump:1.6778 Ang C(10) at 10.82 29.864 25 in (null):K-9999 (1) and CD1(40) at 10.3188 29.0898 23.5984 in (null):I-9999 (5) other bump:2.58557 Ang N(11) at 10.812 29.178 26.135 in (null):D-9999 (2) and CD1(40) at 10.3188 29.0898 23.5984 in (null):I-9999 (5) other bump:2.24988 Ang OD1(15) at 8.06164 30.5631 25.3384 in (null):D-9999 (2) and CG1(38) at 8.82469 29.3876 23.5783 in (null):I-9999 (5) other bump:2.85886 Ang CB(4) at 11.583 28.7905 23.1216 in (null):K-9999 (1) and CG1(38) at 8.82469 29.3876 23.5783 in (null):I-9999 (5) other bump:1.95719 Ang O(9) at 9.91 30.614 24.65 in (null):K-9999 (1) and CG1(38) at 8.82469 29.3876 23.5783 in (null):I-9999 (5) other bump:2.49592 Ang C(10) at 10.82 29.864 25 in (null):K-9999 (1) and CG1(38) at 8.82469 29.3876 23.5783 in (null):I-9999 (5) neighbor-bump: 2.33117 Ang O(9) at 9.91 30.614 24.65 in (null):K-9999 (1) and CG(14) at 8.43465 31.1804 26.3637 in (null):D-9999 (2) self-bump: 1.39114 Ang CA(12) at 9.664 29.246 27.026 in (null):D-9999 (2) and CB(13) at 9.19458 30.4835 27.4543 in (null):D-9999 (2) T0159 47 :NGDGKADLTGCN 1kq3A 55 :KVRVNKQIFGGE Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues neighbor-bump: 2.08747 Ang O(65) at 19.955 13.793 28.831 in (null):G-9999 (10) and CB(69) at 21.5549 15.1321 28.7616 in (null):C-9999 (11) neighbor-bump: 2.55059 Ang C(66) at 19.53 14.009 27.692 in (null):G-9999 (10) and CB(69) at 21.5549 15.1321 28.7616 in (null):C-9999 (11) T0159 63 :CEGAINHQLAAYELT 1kq3A 67 :CSDEEIERLSGLVEE Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 17 residues other bump:2.40689 Ang O(59) at 12.876 7.34 20.983 in (null):Q-9999 (8) and CD1(83) at 10.8344 8.20905 21.9156 in (null):Y-9999 (12) other bump:2.94541 Ang OE2(14) at 21.9928 7.3873 26.0847 in (null):E-9999 (2) and CG1(29) at 20.4921 9.54057 24.7481 in (null):I-9999 (5) other bump:3.17867 Ang CG(11) at 23.1146 8.04205 24.0794 in (null):E-9999 (2) and N(26) at 20.294 7.338 22.794 in (null):I-9999 (5) T0159 78 :NTVTHNQGNYAAMMADTISRYKEGKPVFYYT 1kq3A 83 :TDVVVGIGGGKTLDTAKAVAYKLKKPVVIVP Fragment has 66 clashes (null) has 66 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 33 residues other bump:2.62226 Ang SD(96) at 23.3895 23.2617 16.5851 in (null):M-9999 (13) and OG1(249) at 23.6394 25.805 15.9973 in (null):T-9999 (31) other bump:2.30233 Ang CA(122) at 20.93 15.257 12.461 in (null):T-9999 (17) and OH(230) at 20.6057 16.9838 10.9732 in (null):Y-9999 (29) other bump:2.66629 Ang CG1(206) at 18.955 17.949 9.115 in (null):V-9999 (27) and OH(230) at 20.6057 16.9838 10.9732 in (null):Y-9999 (29) other bump:2.80166 Ang CG2(124) at 22.9422 15.438 10.9638 in (null):T-9999 (17) and OH(230) at 20.6057 16.9838 10.9732 in (null):Y-9999 (29) other bump:2.47852 Ang CB(123) at 22.3466 15.8251 12.3033 in (null):T-9999 (17) and OH(230) at 20.6057 16.9838 10.9732 in (null):Y-9999 (29) other bump:2.16977 Ang OG1(125) at 22.2403 17.2738 12.3702 in (null):T-9999 (17) and OH(230) at 20.6057 16.9838 10.9732 in (null):Y-9999 (29) other bump:3.09062 Ang CZ(148) at 17.5683 17.9782 11.9253 in (null):R-9999 (20) and CZ(229) at 20.5826 18.3081 11.3277 in (null):Y-9999 (29) other bump:2.00606 Ang NH2(150) at 18.7743 18.4787 12.1792 in (null):R-9999 (20) and CZ(229) at 20.5826 18.3081 11.3277 in (null):Y-9999 (29) other bump:2.77022 Ang CG1(206) at 18.955 17.949 9.115 in (null):V-9999 (27) and CZ(229) at 20.5826 18.3081 11.3277 in (null):Y-9999 (29) other bump:2.21463 Ang OG1(125) at 22.2403 17.2738 12.3702 in (null):T-9999 (17) and CZ(229) at 20.5826 18.3081 11.3277 in (null):Y-9999 (29) other bump:2.66822 Ang NH2(150) at 18.7743 18.4787 12.1792 in (null):R-9999 (20) and CE2(228) at 20.5385 19.3083 10.3574 in (null):Y-9999 (29) other bump:2.42868 Ang CG1(206) at 18.955 17.949 9.115 in (null):V-9999 (27) and CE2(228) at 20.5385 19.3083 10.3574 in (null):Y-9999 (29) other bump:1.92198 Ang NH2(150) at 18.7743 18.4787 12.1792 in (null):R-9999 (20) and CE1(227) at 20.6269 18.6276 12.6689 in (null):Y-9999 (29) other bump:2.1272 Ang OG1(125) at 22.2403 17.2738 12.3702 in (null):T-9999 (17) and CE1(227) at 20.6269 18.6276 12.6689 in (null):Y-9999 (29) other bump:2.53202 Ang NH2(150) at 18.7743 18.4787 12.1792 in (null):R-9999 (20) and CD1(225) at 20.6331 19.96 13.0519 in (null):Y-9999 (29) other bump:2.90832 Ang ND1(36) at 14.5355 22.9569 14.5365 in (null):H-9999 (5) and CD2(215) at 14.5901 24.6241 12.1541 in (null):F-9999 (28) other bump:2.27733 Ang CD(146) at 16.152 16.5439 10.4906 in (null):R-9999 (20) and CG2(207) at 17.769 17.909 11.332 in (null):V-9999 (27) other bump:1.88519 Ang NH1(149) at 16.5406 18.3101 12.7046 in (null):R-9999 (20) and CG2(207) at 17.769 17.909 11.332 in (null):V-9999 (27) other bump:0.939629 Ang NE(147) at 17.4062 17.1677 10.8828 in (null):R-9999 (20) and CG2(207) at 17.769 17.909 11.332 in (null):V-9999 (27) other bump:0.630083 Ang CZ(148) at 17.5683 17.9782 11.9253 in (null):R-9999 (20) and CG2(207) at 17.769 17.909 11.332 in (null):V-9999 (27) other bump:1.43282 Ang NH2(150) at 18.7743 18.4787 12.1792 in (null):R-9999 (20) and CG2(207) at 17.769 17.909 11.332 in (null):V-9999 (27) other bump:2.4768 Ang NE(147) at 17.4062 17.1677 10.8828 in (null):R-9999 (20) and CG1(206) at 18.955 17.949 9.115 in (null):V-9999 (27) other bump:3.11491 Ang NH2(150) at 18.7743 18.4787 12.1792 in (null):R-9999 (20) and CG1(206) at 18.955 17.949 9.115 in (null):V-9999 (27) other bump:1.95889 Ang CD(146) at 16.152 16.5439 10.4906 in (null):R-9999 (20) and CB(205) at 17.643 17.631 9.833 in (null):V-9999 (27) other bump:1.17171 Ang NE(147) at 17.4062 17.1677 10.8828 in (null):R-9999 (20) and CB(205) at 17.643 17.631 9.833 in (null):V-9999 (27) other bump:2.12218 Ang CZ(148) at 17.5683 17.9782 11.9253 in (null):R-9999 (20) and CB(205) at 17.643 17.631 9.833 in (null):V-9999 (27) other bump:2.73919 Ang NH2(150) at 18.7743 18.4787 12.1792 in (null):R-9999 (20) and CB(205) at 17.643 17.631 9.833 in (null):V-9999 (27) other bump:2.28534 Ang CD(146) at 16.152 16.5439 10.4906 in (null):R-9999 (20) and CA(204) at 16.456 18.421 9.223 in (null):V-9999 (27) other bump:2.28664 Ang NE(147) at 17.4062 17.1677 10.8828 in (null):R-9999 (20) and CA(204) at 16.456 18.421 9.223 in (null):V-9999 (27) other bump:2.95561 Ang CZ(148) at 17.5683 17.9782 11.9253 in (null):R-9999 (20) and CA(204) at 16.456 18.421 9.223 in (null):V-9999 (27) other bump:2.96518 Ang CD(146) at 16.152 16.5439 10.4906 in (null):R-9999 (20) and N(203) at 16.192 17.942 7.876 in (null):V-9999 (27) other bump:3.06575 Ang CD(146) at 16.152 16.5439 10.4906 in (null):R-9999 (20) and C(202) at 15.169 17.113 7.643 in (null):P-9999 (26) other bump:2.62864 Ang CD(146) at 16.152 16.5439 10.4906 in (null):R-9999 (20) and O(201) at 14.391 16.731 8.548 in (null):P-9999 (26) other bump:2.74244 Ang C(30) at 13.81 18.134 12.521 in (null):T-9999 (4) and NH1(149) at 16.5406 18.3101 12.7046 in (null):R-9999 (20) other bump:1.94507 Ang OG1(28) at 14.9815 15.544 11.6795 in (null):T-9999 (4) and CD(146) at 16.152 16.5439 10.4906 in (null):R-9999 (20) other bump:2.76438 Ang CB(26) at 13.8169 15.5846 12.5118 in (null):T-9999 (4) and CG(145) at 16.053 15.0903 10.9635 in (null):R-9999 (20) other bump:1.36621 Ang OG1(28) at 14.9815 15.544 11.6795 in (null):T-9999 (4) and CG(145) at 16.053 15.0903 10.9635 in (null):R-9999 (20) other bump:2.79949 Ang C(40) at 15.17 19.649 15.44 in (null):H-9999 (5) and OD2(118) at 17.3963 18.8669 16.9463 in (null):D-9999 (16) other bump:2.29285 Ang N(41) at 16.334 20.291 15.497 in (null):N-9999 (6) and OD2(118) at 17.3963 18.8669 16.9463 in (null):D-9999 (16) other bump:1.43991 Ang CA(42) at 17.174 20.264 16.678 in (null):N-9999 (6) and OD2(118) at 17.3963 18.8669 16.9463 in (null):D-9999 (16) other bump:1.50544 Ang CB(43) at 18.5461 19.6559 16.3792 in (null):N-9999 (6) and OD2(118) at 17.3963 18.8669 16.9463 in (null):D-9999 (16) other bump:2.84107 Ang C(48) at 17.334 21.699 17.163 in (null):N-9999 (6) and OD2(118) at 17.3963 18.8669 16.9463 in (null):D-9999 (16) other bump:2.36949 Ang CG(44) at 19.4551 19.8469 17.5907 in (null):N-9999 (6) and OD2(118) at 17.3963 18.8669 16.9463 in (null):D-9999 (16) other bump:2.65479 Ang CA(42) at 17.174 20.264 16.678 in (null):N-9999 (6) and CG(116) at 17.5914 17.644 16.7747 in (null):D-9999 (16) other bump:2.26178 Ang CB(43) at 18.5461 19.6559 16.3792 in (null):N-9999 (6) and CG(116) at 17.5914 17.644 16.7747 in (null):D-9999 (16) other bump:2.99868 Ang CG(44) at 19.4551 19.8469 17.5907 in (null):N-9999 (6) and CG(116) at 17.5914 17.644 16.7747 in (null):D-9999 (16) other bump:2.61992 Ang CB(43) at 18.5461 19.6559 16.3792 in (null):N-9999 (6) and CB(115) at 18.259 17.2097 15.4861 in (null):D-9999 (16) other bump:3.27647 Ang CE1(76) at 29.3618 19.3339 17.0427 in (null):Y-9999 (10) and SD(104) at 27.9406 16.4666 17.7454 in (null):M-9999 (14) other bump:2.7058 Ang OH(79) at 30.3085 17.1746 16.644 in (null):Y-9999 (10) and SD(104) at 27.9406 16.4666 17.7454 in (null):M-9999 (14) other bump:2.94077 Ang CD2(75) at 28.7179 18.5844 19.6319 in (null):Y-9999 (10) and SD(104) at 27.9406 16.4666 17.7454 in (null):M-9999 (14) other bump:2.15978 Ang CE2(77) at 29.3725 17.7032 18.7871 in (null):Y-9999 (10) and SD(104) at 27.9406 16.4666 17.7454 in (null):M-9999 (14) other bump:2.38273 Ang CZ(78) at 29.6846 18.0707 17.4951 in (null):Y-9999 (10) and SD(104) at 27.9406 16.4666 17.7454 in (null):M-9999 (14) other bump:2.38514 Ang OD1(46) at 20.3377 20.6819 17.5968 in (null):N-9999 (6) and CG(95) at 22.3274 21.9163 17.1424 in (null):M-9999 (13) other bump:2.63015 Ang OD1(46) at 20.3377 20.6819 17.5968 in (null):N-9999 (6) and CB(94) at 22.7602 20.5601 16.5796 in (null):M-9999 (13) other bump:2.53535 Ang CG(44) at 19.4551 19.8469 17.5907 in (null):N-9999 (6) and CA(93) at 21.898 19.406 17.075 in (null):M-9999 (13) other bump:2.082 Ang OD1(46) at 20.3377 20.6819 17.5968 in (null):N-9999 (6) and CA(93) at 21.898 19.406 17.075 in (null):M-9999 (13) other bump:2.69266 Ang CG(44) at 19.4551 19.8469 17.5907 in (null):N-9999 (6) and N(92) at 21.916 19.283 18.527 in (null):M-9999 (13) other bump:2.17775 Ang ND2(45) at 19.1201 19.141 18.6772 in (null):N-9999 (6) and C(91) at 21.117 18.402 19.134 in (null):A-9999 (12) other bump:2.68909 Ang CG(44) at 19.4551 19.8469 17.5907 in (null):N-9999 (6) and C(91) at 21.117 18.402 19.134 in (null):A-9999 (12) other bump:2.85802 Ang OD1(46) at 20.3377 20.6819 17.5968 in (null):N-9999 (6) and C(91) at 21.117 18.402 19.134 in (null):A-9999 (12) other bump:1.93926 Ang ND2(45) at 19.1201 19.141 18.6772 in (null):N-9999 (6) and O(90) at 20.355 17.656 18.503 in (null):A-9999 (12) other bump:2.53812 Ang CG(44) at 19.4551 19.8469 17.5907 in (null):N-9999 (6) and O(90) at 20.355 17.656 18.503 in (null):A-9999 (12) other bump:2.54332 Ang NE2(38) at 14.0513 23.8958 16.3515 in (null):H-9999 (5) and NE2(55) at 13.32 25.0558 18.4935 in (null):Q-9999 (7) other bump:2.42204 Ang CE1(37) at 14.8048 24.0118 15.2811 in (null):H-9999 (5) and OE1(54) at 14.0413 25.9367 16.5374 in (null):Q-9999 (7) other bump:2.04934 Ang NE2(38) at 14.0513 23.8958 16.3515 in (null):H-9999 (5) and OE1(54) at 14.0413 25.9367 16.5374 in (null):Q-9999 (7) other bump:2.55029 Ang NE2(38) at 14.0513 23.8958 16.3515 in (null):H-9999 (5) and CG(52) at 15.6763 25.0007 17.9771 in (null):Q-9999 (7) Number of specific fragments= 4 total=170 Number of alignments=36 # Reading fragments from alignment file # T0159 read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1pot/1pot-T0159-fssp-global-adpstyle1.pw.a2m.gz # 1pot read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1pot/1pot-T0159-fssp-global-adpstyle1.pw.a2m.gz # found chain 1pot in training set T0159 1 :KKFYREGVFVNGAAQGY 1pot 61 :SNETMYAKLKTYKDGAY Fragment has 14 clashes (null) has 14 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 18 residues neighbor-bump: 2.22246 Ang CB(114) at 54.9519 49.2149 -3.57804 in (null):Q-9999 (14) and N(121) at 54.297 47.214 -2.866 in (null):G-9999 (15) self-bump: 2.21887 Ang CB(114) at 54.9519 49.2149 -3.57804 in (null):Q-9999 (14) and C(120) at 54.914 47.042 -4.026 in (null):Q-9999 (14) other bump:1.47322 Ang O(70) at 55.285 54.084 -2.208 in (null):V-9999 (7) and NE2(118) at 55.0138 52.646 -2.37801 in (null):Q-9999 (14) other bump:1.81203 Ang C(71) at 56.049 53.684 -1.313 in (null):V-9999 (7) and NE2(118) at 55.0138 52.646 -2.37801 in (null):Q-9999 (14) other bump:2.68629 Ang CA(73) at 54.217 52.999 0.163 in (null):F-9999 (8) and NE2(118) at 55.0138 52.646 -2.37801 in (null):Q-9999 (14) other bump:2.50966 Ang CG1(68) at 57.2749 51.6307 -2.77155 in (null):V-9999 (7) and NE2(118) at 55.0138 52.646 -2.37801 in (null):Q-9999 (14) other bump:2.92187 Ang CA(66) at 57.568 53.755 -1.493 in (null):V-9999 (7) and NE2(118) at 55.0138 52.646 -2.37801 in (null):Q-9999 (14) other bump:2.65868 Ang C(101) at 53.171 52.468 -5.417 in (null):G-9999 (11) and OE1(117) at 53.2495 51.4044 -2.98161 in (null):Q-9999 (14) other bump:1.49655 Ang O(100) at 52.915 51.951 -4.334 in (null):G-9999 (11) and OE1(117) at 53.2495 51.4044 -2.98161 in (null):Q-9999 (14) other bump:2.88059 Ang C(101) at 53.171 52.468 -5.417 in (null):G-9999 (11) and CD(116) at 54.4624 51.6077 -2.99007 in (null):Q-9999 (14) other bump:3.10498 Ang C(71) at 56.049 53.684 -1.313 in (null):V-9999 (7) and CD(116) at 54.4624 51.6077 -2.99007 in (null):Q-9999 (14) other bump:2.07809 Ang O(100) at 52.915 51.951 -4.334 in (null):G-9999 (11) and CD(116) at 54.4624 51.6077 -2.99007 in (null):Q-9999 (14) other bump:2.82106 Ang CG1(68) at 57.2749 51.6307 -2.77155 in (null):V-9999 (7) and CD(116) at 54.4624 51.6077 -2.99007 in (null):Q-9999 (14) other bump:2.30864 Ang CG1(68) at 57.2749 51.6307 -2.77155 in (null):V-9999 (7) and CG(115) at 55.4027 50.6579 -3.7087 in (null):Q-9999 (14) T0159 18 :LIDKKTADQYKITNIAQL 1pot 79 :LVVPSTYYVDKMRKEGMI Fragment has 19 clashes (null) has 19 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 20 residues neighbor-bump: 2.45204 Ang CB(141) at 48.2397 49.0026 7.34953 in (null):L-9999 (18) and N(147) at 45.903 49.154 8.077 in (null):G-9999 (19) self-bump: 2.17988 Ang CB(141) at 48.2397 49.0026 7.34953 in (null):L-9999 (18) and C(146) at 46.728 50.128 8.445 in (null):L-9999 (18) self-bump: 1.24747 Ang CA(140) at 48.086 50.173 7.753 in (null):L-9999 (18) and CB(141) at 48.2397 49.0026 7.34953 in (null):L-9999 (18) other bump:2.78648 Ang CA(95) at 52.554 53.939 10.021 in (null):I-9999 (12) and OE1(135) at 52.8663 55.473 7.7158 in (null):Q-9999 (17) other bump:2.91737 Ang CD1(122) at 53.7906 57.9499 8.94926 in (null):I-9999 (15) and OE1(135) at 52.8663 55.473 7.7158 in (null):Q-9999 (17) other bump:2.96152 Ang CG2(121) at 51.2393 57.9662 7.099 in (null):I-9999 (15) and CG(133) at 51.0433 55.1428 6.22696 in (null):Q-9999 (17) other bump:2.73161 Ang CG2(98) at 51.8638 52.2644 8.3376 in (null):I-9999 (12) and CB(132) at 50.5112 53.7436 6.48182 in (null):Q-9999 (17) neighbor-bump: 2.57408 Ang C(124) at 48.597 57.615 8.562 in (null):I-9999 (15) and CB(127) at 46.0695 57.3145 8.17852 in (null):A-9999 (16) other bump:2.15692 Ang CE1(79) at 51.9978 56.9069 17.8089 in (null):Y-9999 (10) and OD1(114) at 51.4986 57.6235 15.8367 in (null):N-9999 (14) other bump:2.44686 Ang CD1(77) at 52.7842 55.992 17.13 in (null):Y-9999 (10) and OD1(114) at 51.4986 57.6235 15.8367 in (null):N-9999 (14) other bump:1.67793 Ang CD(30) at 55.4761 49.7459 8.60654 in (null):K-9999 (4) and CD1(99) at 54.8618 51.2948 8.40877 in (null):I-9999 (12) other bump:1.11442 Ang CE(31) at 54.9042 50.664 7.49099 in (null):K-9999 (4) and CD1(99) at 54.8618 51.2948 8.40877 in (null):I-9999 (12) other bump:0.913621 Ang NZ(32) at 54.0589 51.6918 8.22869 in (null):K-9999 (4) and CD1(99) at 54.8618 51.2948 8.40877 in (null):I-9999 (12) other bump:2.27112 Ang NZ(32) at 54.0589 51.6918 8.22869 in (null):K-9999 (4) and CG2(98) at 51.8638 52.2644 8.3376 in (null):I-9999 (12) other bump:3.14458 Ang CD(30) at 55.4761 49.7459 8.60654 in (null):K-9999 (4) and CG1(97) at 54.3357 52.67 8.80065 in (null):I-9999 (12) other bump:2.46216 Ang CE(31) at 54.9042 50.664 7.49099 in (null):K-9999 (4) and CG1(97) at 54.3357 52.67 8.80065 in (null):I-9999 (12) other bump:1.16642 Ang NZ(32) at 54.0589 51.6918 8.22869 in (null):K-9999 (4) and CG1(97) at 54.3357 52.67 8.80065 in (null):I-9999 (12) other bump:1.8718 Ang NZ(32) at 54.0589 51.6918 8.22869 in (null):K-9999 (4) and CB(96) at 52.9014 52.6079 9.37953 in (null):I-9999 (12) neighbor-bump: 2.75611 Ang CG2(14) at 54.781 46.7661 4.99772 in (null):I-9999 (2) and N(18) at 55.848 44.254 5.381 in (null):D-9999 (3) T0159 36 :KDPKIAKLFDTNGDGKADLTGC 1pot 146 :KSVTSWADLWKPEYKGSLLLTD Fragment has 13 clashes (null) has 13 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 24 residues other bump:2.97756 Ang CA(44) at 81.509 47.059 18.85 in (null):A-9999 (6) and CE2(72) at 82.2928 45.3708 16.5259 in (null):F-9999 (9) other bump:2.74266 Ang O(41) at 83.62 45.163 18.917 in (null):I-9999 (5) and CE2(72) at 82.2928 45.3708 16.5259 in (null):F-9999 (9) other bump:2.32731 Ang O(46) at 83.262 48.306 17.701 in (null):A-9999 (6) and CD2(70) at 82.8558 46.5992 16.1719 in (null):F-9999 (9) other bump:3.03275 Ang CA(44) at 81.509 47.059 18.85 in (null):A-9999 (6) and CD2(70) at 82.8558 46.5992 16.1719 in (null):F-9999 (9) other bump:2.95198 Ang C(47) at 82.744 47.998 18.769 in (null):A-9999 (6) and CD2(70) at 82.8558 46.5992 16.1719 in (null):F-9999 (9) other bump:2.26171 Ang N(26) at 85.901 41.563 20.169 in (null):K-9999 (4) and CD1(61) at 86.8402 43.604 19.9093 in (null):L-9999 (8) other bump:2.98971 Ang N(35) at 84.048 43.491 20.972 in (null):I-9999 (5) and CD1(61) at 86.8402 43.604 19.9093 in (null):L-9999 (8) other bump:2.82704 Ang CG2(39) at 85.0696 46.3175 21.4263 in (null):I-9999 (5) and CG(60) at 87.0909 45.0954 19.8729 in (null):L-9999 (8) other bump:2.76651 Ang CG2(39) at 85.0696 46.3175 21.4263 in (null):I-9999 (5) and N(57) at 85.733 47.677 19.11 in (null):L-9999 (8) other bump:2.45145 Ang CD1(40) at 83.4368 47.6543 23.6633 in (null):I-9999 (5) and CD(52) at 84.1277 49.9827 23.9956 in (null):K-9999 (7) other bump:2.63055 Ang CD1(40) at 83.4368 47.6543 23.6633 in (null):I-9999 (5) and CG(51) at 83.6954 50.015 22.5319 in (null):K-9999 (7) other bump:2.92584 Ang CD1(40) at 83.4368 47.6543 23.6633 in (null):I-9999 (5) and CB(50) at 84.6652 49.3491 21.619 in (null):K-9999 (7) neighbor-bump: 1.79576 Ang OD1(15) at 89.8407 38.7914 16.0514 in (null):D-9999 (2) and CD(23) at 88.3042 39.3722 16.7771 in (null):P-9999 (3) T0159 59 :PGWGCEGAINHQL 1pot 168 :DAREVFQMALRKL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues T0159 72 :AAYELTNTVT 1pot 194 :AAYNELKKLM Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 12 residues T0159 83 :NQGNYAAMMA 1pot 204 :PNVAAFNSDN Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 12 residues neighbor-bump: 2.48518 Ang OD1(28) at 83.0547 46.7141 3.44103 in (null):N-9999 (4) and CD1(35) at 82.4942 46.1863 1.0781 in (null):Y-9999 (5) T0159 94 :TISRYKEGKPVFYYTWTPYWVSNE 1pot 214 :PANPYMEGEVNLGMIWNGSAFVAR Fragment has 108 clashes (null) has 108 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 26 residues other bump:2.18427 Ang CE(51) at 77.8539 32.2591 2.25346 in (null):K-9999 (6) and OD1(205) at 76.098 33.5367 2.48981 in (null):N-9999 (23) other bump:1.85266 Ang NZ(52) at 77.4623 32.8423 3.53335 in (null):K-9999 (6) and OD1(205) at 76.098 33.5367 2.48981 in (null):N-9999 (23) other bump:2.56113 Ang CG2(13) at 76.9624 35.1868 4.24746 in (null):I-9999 (2) and OD1(205) at 76.098 33.5367 2.48981 in (null):N-9999 (23) other bump:1.65862 Ang CB(11) at 76.0497 36.3767 4.42396 in (null):I-9999 (2) and ND2(204) at 76.9017 35.0483 3.91364 in (null):N-9999 (23) other bump:2.79338 Ang CG1(12) at 75.3513 36.3978 5.80525 in (null):I-9999 (2) and ND2(204) at 76.9017 35.0483 3.91364 in (null):N-9999 (23) other bump:2.30766 Ang NZ(52) at 77.4623 32.8423 3.53335 in (null):K-9999 (6) and ND2(204) at 76.9017 35.0483 3.91364 in (null):N-9999 (23) other bump:2.68737 Ang CA(10) at 76.856 37.716 4.235 in (null):I-9999 (2) and ND2(204) at 76.9017 35.0483 3.91364 in (null):N-9999 (23) other bump:0.366473 Ang CG2(13) at 76.9624 35.1868 4.24746 in (null):I-9999 (2) and ND2(204) at 76.9017 35.0483 3.91364 in (null):N-9999 (23) other bump:2.91472 Ang C(16) at 77.753 37.676 2.983 in (null):I-9999 (2) and ND2(204) at 76.9017 35.0483 3.91364 in (null):N-9999 (23) other bump:2.81452 Ang CB(11) at 76.0497 36.3767 4.42396 in (null):I-9999 (2) and CG(203) at 76.6937 33.7836 3.53941 in (null):N-9999 (23) other bump:2.88641 Ang CD(50) at 78.4639 33.2887 1.31391 in (null):K-9999 (6) and CG(203) at 76.6937 33.7836 3.53941 in (null):N-9999 (23) other bump:2.3073 Ang CE(51) at 77.8539 32.2591 2.25346 in (null):K-9999 (6) and CG(203) at 76.6937 33.7836 3.53941 in (null):N-9999 (23) other bump:1.21522 Ang NZ(52) at 77.4623 32.8423 3.53335 in (null):K-9999 (6) and CG(203) at 76.6937 33.7836 3.53941 in (null):N-9999 (23) other bump:1.59454 Ang CG2(13) at 76.9624 35.1868 4.24746 in (null):I-9999 (2) and CG(203) at 76.6937 33.7836 3.53941 in (null):N-9999 (23) other bump:2.20474 Ang CE(51) at 77.8539 32.2591 2.25346 in (null):K-9999 (6) and CB(202) at 77.3273 32.6758 4.35347 in (null):N-9999 (23) other bump:0.847673 Ang NZ(52) at 77.4623 32.8423 3.53335 in (null):K-9999 (6) and CB(202) at 77.3273 32.6758 4.35347 in (null):N-9999 (23) other bump:2.53964 Ang CG2(13) at 76.9624 35.1868 4.24746 in (null):I-9999 (2) and CB(202) at 77.3273 32.6758 4.35347 in (null):N-9999 (23) other bump:2.56821 Ang CE(51) at 77.8539 32.2591 2.25346 in (null):K-9999 (6) and CA(201) at 76.582 31.418 4.32 in (null):N-9999 (23) other bump:1.84995 Ang NZ(52) at 77.4623 32.8423 3.53335 in (null):K-9999 (6) and CA(201) at 76.582 31.418 4.32 in (null):N-9999 (23) other bump:2.75431 Ang CA(127) at 76.018 40.768 10.254 in (null):T-9999 (15) and CH2(184) at 76.8461 39.3381 12.4576 in (null):W-9999 (20) other bump:2.4772 Ang O(131) at 74.602 40.353 12.192 in (null):T-9999 (15) and CH2(184) at 76.8461 39.3381 12.4576 in (null):W-9999 (20) other bump:2.82406 Ang C(132) at 74.698 40.387 10.954 in (null):T-9999 (15) and CH2(184) at 76.8461 39.3381 12.4576 in (null):W-9999 (20) other bump:2.25909 Ang CB(128) at 77.1339 39.6978 10.246 in (null):T-9999 (15) and CH2(184) at 76.8461 39.3381 12.4576 in (null):W-9999 (20) other bump:1.74585 Ang CG2(129) at 76.9486 38.3962 10.9912 in (null):T-9999 (15) and CH2(184) at 76.8461 39.3381 12.4576 in (null):W-9999 (20) other bump:3.02255 Ang N(126) at 76.654 41.914 10.888 in (null):T-9999 (15) and CH2(184) at 76.8461 39.3381 12.4576 in (null):W-9999 (20) other bump:2.05521 Ang CG2(129) at 76.9486 38.3962 10.9912 in (null):T-9999 (15) and CZ3(183) at 76.5218 38.0687 12.9748 in (null):W-9999 (20) other bump:1.78364 Ang CA(127) at 76.018 40.768 10.254 in (null):T-9999 (15) and CZ2(182) at 76.9956 39.5454 11.109 in (null):W-9999 (20) other bump:2.74851 Ang O(131) at 74.602 40.353 12.192 in (null):T-9999 (15) and CZ2(182) at 76.9956 39.5454 11.109 in (null):W-9999 (20) other bump:2.45177 Ang C(132) at 74.698 40.387 10.954 in (null):T-9999 (15) and CZ2(182) at 76.9956 39.5454 11.109 in (null):W-9999 (20) other bump:0.887203 Ang CB(128) at 77.1339 39.6978 10.246 in (null):T-9999 (15) and CZ2(182) at 76.9956 39.5454 11.109 in (null):W-9999 (20) other bump:2.27493 Ang OG1(130) at 77.3386 39.3281 8.8706 in (null):T-9999 (15) and CZ2(182) at 76.9956 39.5454 11.109 in (null):W-9999 (20) other bump:1.15618 Ang CG2(129) at 76.9486 38.3962 10.9912 in (null):T-9999 (15) and CZ2(182) at 76.9956 39.5454 11.109 in (null):W-9999 (20) other bump:2.40326 Ang N(126) at 76.654 41.914 10.888 in (null):T-9999 (15) and CZ2(182) at 76.9956 39.5454 11.109 in (null):W-9999 (20) other bump:2.90334 Ang CA(127) at 76.018 40.768 10.254 in (null):T-9999 (15) and NE1(181) at 76.8971 38.3579 8.89459 in (null):W-9999 (20) other bump:1.91775 Ang CB(128) at 77.1339 39.6978 10.246 in (null):T-9999 (15) and NE1(181) at 76.8971 38.3579 8.89459 in (null):W-9999 (20) other bump:1.06623 Ang OG1(130) at 77.3386 39.3281 8.8706 in (null):T-9999 (15) and NE1(181) at 76.8971 38.3579 8.89459 in (null):W-9999 (20) other bump:2.0976 Ang CG2(129) at 76.9486 38.3962 10.9912 in (null):T-9999 (15) and NE1(181) at 76.8971 38.3579 8.89459 in (null):W-9999 (20) other bump:1.9198 Ang CG2(129) at 76.9486 38.3962 10.9912 in (null):T-9999 (15) and CE3(180) at 76.3392 36.9748 12.1286 in (null):W-9999 (20) other bump:2.45369 Ang CA(127) at 76.018 40.768 10.254 in (null):T-9999 (15) and CE2(179) at 76.8117 38.4462 10.2583 in (null):W-9999 (20) other bump:2.9527 Ang C(132) at 74.698 40.387 10.954 in (null):T-9999 (15) and CE2(179) at 76.8117 38.4462 10.2583 in (null):W-9999 (20) other bump:1.29243 Ang CB(128) at 77.1339 39.6978 10.246 in (null):T-9999 (15) and CE2(179) at 76.8117 38.4462 10.2583 in (null):W-9999 (20) other bump:1.72655 Ang OG1(130) at 77.3386 39.3281 8.8706 in (null):T-9999 (15) and CE2(179) at 76.8117 38.4462 10.2583 in (null):W-9999 (20) other bump:0.747261 Ang CG2(129) at 76.9486 38.3962 10.9912 in (null):T-9999 (15) and CE2(179) at 76.8117 38.4462 10.2583 in (null):W-9999 (20) other bump:2.66822 Ang CB(128) at 77.1339 39.6978 10.246 in (null):T-9999 (15) and CD2(178) at 76.4854 37.1584 10.7463 in (null):W-9999 (20) other bump:1.34415 Ang CG2(129) at 76.9486 38.3962 10.9912 in (null):T-9999 (15) and CD2(178) at 76.4854 37.1584 10.7463 in (null):W-9999 (20) other bump:2.39807 Ang OG1(130) at 77.3386 39.3281 8.8706 in (null):T-9999 (15) and CD1(177) at 76.6351 37.0637 8.51229 in (null):W-9999 (20) other bump:2.83175 Ang CG2(129) at 76.9486 38.3962 10.9912 in (null):T-9999 (15) and CD1(177) at 76.6351 37.0637 8.51229 in (null):W-9999 (20) other bump:2.58292 Ang CG2(129) at 76.9486 38.3962 10.9912 in (null):T-9999 (15) and CG(176) at 76.3778 36.2902 9.609 in (null):W-9999 (20) other bump:3.26583 Ang CG1(12) at 75.3513 36.3978 5.80525 in (null):I-9999 (2) and CA(174) at 75.607 34.288 8.285 in (null):W-9999 (20) other bump:2.86103 Ang CD1(14) at 74.3082 35.2958 5.94342 in (null):I-9999 (2) and CA(174) at 75.607 34.288 8.285 in (null):W-9999 (20) other bump:2.07133 Ang CD1(14) at 74.3082 35.2958 5.94342 in (null):I-9999 (2) and N(173) at 74.302 34.882 7.973 in (null):W-9999 (20) other bump:2.4257 Ang CG1(12) at 75.3513 36.3978 5.80525 in (null):I-9999 (2) and C(172) at 73.804 34.795 6.765 in (null):Y-9999 (19) other bump:1.08625 Ang CD1(14) at 74.3082 35.2958 5.94342 in (null):I-9999 (2) and C(172) at 73.804 34.795 6.765 in (null):Y-9999 (19) other bump:2.35866 Ang CG1(12) at 75.3513 36.3978 5.80525 in (null):I-9999 (2) and O(171) at 74.318 34.278 5.758 in (null):Y-9999 (19) other bump:1.03456 Ang CD1(14) at 74.3082 35.2958 5.94342 in (null):I-9999 (2) and O(171) at 74.318 34.278 5.758 in (null):Y-9999 (19) other bump:3.32969 Ang CE3(140) at 70.182 41.548 6.85 in (null):W-9999 (16) and CE1(167) at 69.155 38.6187 5.64543 in (null):Y-9999 (19) other bump:2.88095 Ang CG1(12) at 75.3513 36.3978 5.80525 in (null):I-9999 (2) and CB(163) at 72.5117 36.8527 5.97851 in (null):Y-9999 (19) other bump:2.37748 Ang CD1(14) at 74.3082 35.2958 5.94342 in (null):I-9999 (2) and CB(163) at 72.5117 36.8527 5.97851 in (null):Y-9999 (19) other bump:3.20111 Ang CG1(12) at 75.3513 36.3978 5.80525 in (null):I-9999 (2) and CA(162) at 72.401 35.394 6.537 in (null):Y-9999 (19) other bump:1.99982 Ang CD1(14) at 74.3082 35.2958 5.94342 in (null):I-9999 (2) and CA(162) at 72.401 35.394 6.537 in (null):Y-9999 (19) neighbor-bump: 2.79874 Ang OG1(151) at 70.5732 36.0793 13.7337 in (null):T-9999 (17) and CD(158) at 69.9656 36.5027 11.0348 in (null):P-9999 (18) neighbor-bump: 2.57721 Ang N(147) at 72.085 37.632 11.97 in (null):T-9999 (17) and CD(158) at 69.9656 36.5027 11.0348 in (null):P-9999 (18) other bump:2.30979 Ang CE2(109) at 79.0687 40.6647 8.12531 in (null):Y-9999 (13) and OG1(130) at 77.3386 39.3281 8.8706 in (null):T-9999 (15) other bump:3.02914 Ang CE2(109) at 79.0687 40.6647 8.12531 in (null):Y-9999 (13) and CB(128) at 77.1339 39.6978 10.246 in (null):T-9999 (15) neighbor-bump: 2.78291 Ang CD2(107) at 79.5197 41.9372 8.46055 in (null):Y-9999 (13) and C(125) at 77.56 42.656 10.301 in (null):Y-9999 (14) neighbor-bump: 2.29261 Ang CE2(109) at 79.0687 40.6647 8.12531 in (null):Y-9999 (13) and O(124) at 78.034 42.429 9.161 in (null):Y-9999 (14) neighbor-bump: 1.71464 Ang CD2(107) at 79.5197 41.9372 8.46055 in (null):Y-9999 (13) and O(124) at 78.034 42.429 9.161 in (null):Y-9999 (14) other bump:2.06082 Ang CD1(38) at 80.147 39.453 5.702 in (null):Y-9999 (5) and OH(111) at 79.5611 38.4439 7.40063 in (null):Y-9999 (13) other bump:2.08187 Ang CE1(40) at 79.789 40.375 6.657 in (null):Y-9999 (5) and OH(111) at 79.5611 38.4439 7.40063 in (null):Y-9999 (13) other bump:2.40684 Ang CZ(42) at 80.622 40.576 7.749 in (null):Y-9999 (5) and OH(111) at 79.5611 38.4439 7.40063 in (null):Y-9999 (13) other bump:2.42636 Ang CG(37) at 81.347 38.734 5.784 in (null):Y-9999 (5) and OH(111) at 79.5611 38.4439 7.40063 in (null):Y-9999 (13) other bump:2.72199 Ang CE2(41) at 81.821 39.887 7.869 in (null):Y-9999 (5) and OH(111) at 79.5611 38.4439 7.40063 in (null):Y-9999 (13) other bump:2.03431 Ang CD1(38) at 80.147 39.453 5.702 in (null):Y-9999 (5) and CZ(110) at 79.9844 39.7087 7.71361 in (null):Y-9999 (13) other bump:1.26433 Ang CE1(40) at 79.789 40.375 6.657 in (null):Y-9999 (5) and CZ(110) at 79.9844 39.7087 7.71361 in (null):Y-9999 (13) other bump:1.07703 Ang CZ(42) at 80.622 40.576 7.749 in (null):Y-9999 (5) and CZ(110) at 79.9844 39.7087 7.71361 in (null):Y-9999 (13) other bump:2.04012 Ang OH(43) at 80.303 41.444 8.738 in (null):Y-9999 (5) and CZ(110) at 79.9844 39.7087 7.71361 in (null):Y-9999 (13) other bump:2.55543 Ang CG(37) at 81.347 38.734 5.784 in (null):Y-9999 (5) and CZ(110) at 79.9844 39.7087 7.71361 in (null):Y-9999 (13) other bump:2.45486 Ang CD2(39) at 82.17 38.953 6.89 in (null):Y-9999 (5) and CZ(110) at 79.9844 39.7087 7.71361 in (null):Y-9999 (13) other bump:1.85178 Ang CE2(41) at 81.821 39.887 7.869 in (null):Y-9999 (5) and CZ(110) at 79.9844 39.7087 7.71361 in (null):Y-9999 (13) other bump:1.66092 Ang CE1(40) at 79.789 40.375 6.657 in (null):Y-9999 (5) and CE2(109) at 79.0687 40.6647 8.12531 in (null):Y-9999 (13) other bump:1.60069 Ang CZ(42) at 80.622 40.576 7.749 in (null):Y-9999 (5) and CE2(109) at 79.0687 40.6647 8.12531 in (null):Y-9999 (13) other bump:1.5831 Ang OH(43) at 80.303 41.444 8.738 in (null):Y-9999 (5) and CE2(109) at 79.0687 40.6647 8.12531 in (null):Y-9999 (13) other bump:2.32965 Ang CD1(38) at 80.147 39.453 5.702 in (null):Y-9999 (5) and CE1(108) at 81.3309 40.016 7.62781 in (null):Y-9999 (13) other bump:1.85705 Ang CE1(40) at 79.789 40.375 6.657 in (null):Y-9999 (5) and CE1(108) at 81.3309 40.016 7.62781 in (null):Y-9999 (13) other bump:0.911439 Ang CZ(42) at 80.622 40.576 7.749 in (null):Y-9999 (5) and CE1(108) at 81.3309 40.016 7.62781 in (null):Y-9999 (13) other bump:2.0804 Ang OH(43) at 80.303 41.444 8.738 in (null):Y-9999 (5) and CE1(108) at 81.3309 40.016 7.62781 in (null):Y-9999 (13) other bump:2.24578 Ang CG(37) at 81.347 38.734 5.784 in (null):Y-9999 (5) and CE1(108) at 81.3309 40.016 7.62781 in (null):Y-9999 (13) other bump:1.54226 Ang CD2(39) at 82.17 38.953 6.89 in (null):Y-9999 (5) and CE1(108) at 81.3309 40.016 7.62781 in (null):Y-9999 (13) other bump:0.561304 Ang CE2(41) at 81.821 39.887 7.869 in (null):Y-9999 (5) and CE1(108) at 81.3309 40.016 7.62781 in (null):Y-9999 (13) other bump:2.40118 Ang CE1(40) at 79.789 40.375 6.657 in (null):Y-9999 (5) and CD2(107) at 79.5197 41.9372 8.46055 in (null):Y-9999 (13) other bump:1.89051 Ang CZ(42) at 80.622 40.576 7.749 in (null):Y-9999 (5) and CD2(107) at 79.5197 41.9372 8.46055 in (null):Y-9999 (13) other bump:0.966271 Ang OH(43) at 80.303 41.444 8.738 in (null):Y-9999 (5) and CD2(107) at 79.5197 41.9372 8.46055 in (null):Y-9999 (13) other bump:2.54618 Ang CE1(40) at 79.789 40.375 6.657 in (null):Y-9999 (5) and CD1(106) at 81.7688 41.3018 7.96257 in (null):Y-9999 (13) other bump:1.37387 Ang CZ(42) at 80.622 40.576 7.749 in (null):Y-9999 (5) and CD1(106) at 81.7688 41.3018 7.96257 in (null):Y-9999 (13) other bump:1.66434 Ang OH(43) at 80.303 41.444 8.738 in (null):Y-9999 (5) and CD1(106) at 81.7688 41.3018 7.96257 in (null):Y-9999 (13) other bump:2.6131 Ang CD2(39) at 82.17 38.953 6.89 in (null):Y-9999 (5) and CD1(106) at 81.7688 41.3018 7.96257 in (null):Y-9999 (13) other bump:1.41886 Ang CE2(41) at 81.821 39.887 7.869 in (null):Y-9999 (5) and CD1(106) at 81.7688 41.3018 7.96257 in (null):Y-9999 (13) other bump:1.84089 Ang CZ(42) at 80.622 40.576 7.749 in (null):Y-9999 (5) and CG(105) at 80.8809 42.2859 8.37995 in (null):Y-9999 (13) other bump:1.08212 Ang OH(43) at 80.303 41.444 8.738 in (null):Y-9999 (5) and CG(105) at 80.8809 42.2859 8.37995 in (null):Y-9999 (13) other bump:2.62669 Ang CE2(41) at 81.821 39.887 7.869 in (null):Y-9999 (5) and CG(105) at 80.8809 42.2859 8.37995 in (null):Y-9999 (13) other bump:2.45374 Ang OH(43) at 80.303 41.444 8.738 in (null):Y-9999 (5) and CB(104) at 81.3094 43.6818 8.75665 in (null):Y-9999 (13) neighbor-bump: 2.64744 Ang C(101) at 83.662 42.718 9.495 in (null):F-9999 (12) and CB(104) at 81.3094 43.6818 8.75665 in (null):Y-9999 (13) neighbor-bump: 2.89828 Ang CG2(88) at 88.4736 41.8589 8.31969 in (null):V-9999 (11) and CD2(96) at 87.5426 43.7501 10.3088 in (null):F-9999 (12) neighbor-bump: 2.4412 Ang N(68) at 85.68 40.233 0.492 in (null):K-9999 (9) and CD(81) at 84.2296 41.6341 1.86773 in (null):P-9999 (10) neighbor-bump: 1.92408 Ang C(76) at 85.924 42.408 1.386 in (null):K-9999 (9) and CD(81) at 84.2296 41.6341 1.86773 in (null):P-9999 (10) other bump:1.81594 Ang OE1(60) at 82.02 40.453 -4.266 in (null):E-9999 (7) and NZ(74) at 83.1467 41.3315 -5.38689 in (null):K-9999 (9) other bump:2.45595 Ang OE1(60) at 82.02 40.453 -4.266 in (null):E-9999 (7) and CE(73) at 84.3662 41.1147 -4.56481 in (null):K-9999 (9) other bump:2.50131 Ang CG2(13) at 76.9624 35.1868 4.24746 in (null):I-9999 (2) and NZ(52) at 77.4623 32.8423 3.53335 in (null):K-9999 (6) T0159 118 :LKPGKDVVWLQVPFSALPGDKNADT 1pot 245 :VVWPKEGGIFWMDSLAIPANAKNKE Fragment has 23 clashes (null) has 23 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 27 residues other bump:2.71074 Ang CB(157) at 45.4479 45.9738 0.820715 in (null):K-9999 (21) and OD1(181) at 43.5457 44.7414 2.30774 in (null):D-9999 (24) other bump:2.36012 Ang CB(130) at 46.8774 44.1916 5.76783 in (null):L-9999 (17) and NZ(161) at 48.6184 44.2714 4.17637 in (null):K-9999 (21) other bump:2.73154 Ang CD2(133) at 48.1038 42.042 5.66841 in (null):L-9999 (17) and NZ(161) at 48.6184 44.2714 4.17637 in (null):K-9999 (21) other bump:1.94856 Ang CA(129) at 48.04 45.153 5.815 in (null):L-9999 (17) and NZ(161) at 48.6184 44.2714 4.17637 in (null):K-9999 (21) other bump:2.8222 Ang C(135) at 47.742 46.611 5.489 in (null):L-9999 (17) and NZ(161) at 48.6184 44.2714 4.17637 in (null):K-9999 (21) other bump:2.35354 Ang CD(140) at 49.37 46.433 3.627 in (null):P-9999 (18) and NZ(161) at 48.6184 44.2714 4.17637 in (null):K-9999 (21) other bump:2.69473 Ang CA(129) at 48.04 45.153 5.815 in (null):L-9999 (17) and CE(160) at 48.5074 45.4104 3.17363 in (null):K-9999 (21) other bump:2.71814 Ang C(135) at 47.742 46.611 5.489 in (null):L-9999 (17) and CE(160) at 48.5074 45.4104 3.17363 in (null):K-9999 (21) other bump:2.15042 Ang N(136) at 48.375 47.133 4.454 in (null):P-9999 (18) and CE(160) at 48.5074 45.4104 3.17363 in (null):K-9999 (21) other bump:2.50449 Ang CG(139) at 49.855 47.458 2.66 in (null):P-9999 (18) and CE(160) at 48.5074 45.4104 3.17363 in (null):K-9999 (21) other bump:1.41256 Ang CD(140) at 49.37 46.433 3.627 in (null):P-9999 (18) and CE(160) at 48.5074 45.4104 3.17363 in (null):K-9999 (21) other bump:2.79903 Ang CD(140) at 49.37 46.433 3.627 in (null):P-9999 (18) and CD(159) at 47.1284 45.2029 2.48822 in (null):K-9999 (21) other bump:2.95736 Ang CG1(95) at 59.2246 40.7605 15.5821 in (null):V-9999 (12) and CZ(114) at 56.9035 42.2721 16.6181 in (null):F-9999 (14) other bump:3.13513 Ang CG1(95) at 59.2246 40.7605 15.5821 in (null):V-9999 (12) and CE2(113) at 57.3712 43.282 15.7716 in (null):F-9999 (14) other bump:3.15167 Ang CG1(50) at 74.4974 44.8186 20.2813 in (null):V-9999 (7) and NE1(69) at 73.9534 47.5649 18.8339 in (null):W-9999 (9) neighbor-bump: 2.51135 Ang CG1(50) at 74.4974 44.8186 20.2813 in (null):V-9999 (7) and C(60) at 72.412 43.484 19.861 in (null):V-9999 (8) neighbor-bump: 2.36161 Ang O(52) at 74.118 42.008 22.718 in (null):V-9999 (7) and CG2(58) at 74.5929 40.5341 20.935 in (null):V-9999 (8) neighbor-bump: 2.31319 Ang O(52) at 74.118 42.008 22.718 in (null):V-9999 (7) and CB(56) at 73.3369 41.3507 20.6422 in (null):V-9999 (8) neighbor-bump: 2.93837 Ang CB(49) at 75.6106 44.5685 21.3046 in (null):V-9999 (7) and CA(55) at 73.757 42.689 20.014 in (null):V-9999 (8) neighbor-bump: 2.27044 Ang CG1(50) at 74.4974 44.8186 20.2813 in (null):V-9999 (7) and CA(55) at 73.757 42.689 20.014 in (null):V-9999 (8) neighbor-bump: 1.65489 Ang CB(49) at 75.6106 44.5685 21.3046 in (null):V-9999 (7) and N(54) at 74.338 43.532 21.093 in (null):V-9999 (8) neighbor-bump: 1.52957 Ang CG1(50) at 74.4974 44.8186 20.2813 in (null):V-9999 (7) and N(54) at 74.338 43.532 21.093 in (null):V-9999 (8) self-bump: 2.09196 Ang CB(49) at 75.6106 44.5685 21.3046 in (null):V-9999 (7) and C(53) at 74.459 43.168 22.348 in (null):V-9999 (7) T0159 143 :KLPNGANYG 1pot 288 :AETIGYPTP Fragment has 12 clashes (null) has 12 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 10 residues other bump:2.71229 Ang NZ(8) at 59.552 30.7294 12.744 in (null):K-9999 (1) and CD2(56) at 57.7062 29.8884 14.5447 in (null):Y-9999 (8) other bump:2.3338 Ang NZ(8) at 59.552 30.7294 12.744 in (null):K-9999 (1) and CD1(55) at 57.6201 31.9168 13.2958 in (null):Y-9999 (8) other bump:2.48661 Ang CE(7) at 60.7374 30.2355 13.4384 in (null):K-9999 (1) and CG(54) at 58.3738 30.8923 13.8446 in (null):Y-9999 (8) other bump:1.62047 Ang NZ(8) at 59.552 30.7294 12.744 in (null):K-9999 (1) and CG(54) at 58.3738 30.8923 13.8446 in (null):Y-9999 (8) other bump:1.10291 Ang CE(7) at 60.7374 30.2355 13.4384 in (null):K-9999 (1) and CB(53) at 59.8781 30.8819 13.6835 in (null):Y-9999 (8) other bump:1.00618 Ang NZ(8) at 59.552 30.7294 12.744 in (null):K-9999 (1) and CB(53) at 59.8781 30.8819 13.6835 in (null):Y-9999 (8) other bump:2.55358 Ang CD(6) at 61.397 29.0794 12.7014 in (null):K-9999 (1) and CB(53) at 59.8781 30.8819 13.6835 in (null):Y-9999 (8) other bump:2.09201 Ang CE(7) at 60.7374 30.2355 13.4384 in (null):K-9999 (1) and CA(52) at 60.545 32.145 14.271 in (null):Y-9999 (8) other bump:2.30693 Ang NZ(8) at 59.552 30.7294 12.744 in (null):K-9999 (1) and CA(52) at 60.545 32.145 14.271 in (null):Y-9999 (8) other bump:2.33803 Ang CE(7) at 60.7374 30.2355 13.4384 in (null):K-9999 (1) and N(51) at 61.987 32.022 14.283 in (null):Y-9999 (8) other bump:2.9969 Ang C(1) at 62.754 28.728 7.173 in (null):G-9999 (0) and CD(23) at 64.398 26.435 6.16255 in (null):P-9999 (3) neighbor-bump: 2.6174 Ang N(11) at 64.586 26.751 8.754 in (null):L-9999 (2) and CD(23) at 64.398 26.435 6.16255 in (null):P-9999 (3) Number of specific fragments= 9 total=179 Number of alignments=37 # Reading fragments from alignment file # T0159 read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1pot/1pot-T0159-fssp-global-adpstyle5.pw.a2m.gz # 1pot read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1pot/1pot-T0159-fssp-global-adpstyle5.pw.a2m.gz # found chain 1pot in training set T0159 1 :KKFYREGVF 1pot 27 :NTLYFYNWT Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 10 residues T0159 12 :GAAQGYL 1pot 37 :YVPPGLL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 9 residues T0159 20 :DK 1pot 60 :ES Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues T0159 22 :KTADQYK 1pot 64 :TMYAKLK Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 9 residues other bump:2.25384 Ang O(16) at 57.449 51.586 1.91 in (null):T-9999 (2) and CD1(44) at 55.6687 50.3461 1.29924 in (null):Y-9999 (6) T0159 30 :TNIAQL 1pot 77 :YDLVVP Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 8 residues T0159 37 :DPKI 1pot 83 :STYY Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 6 residues T0159 41 :AKLFD 1pot 93 :EGMIQ Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 7 residues T0159 46 :TNGDGKADLTG 1pot 146 :KSVTSWADLWK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 13 residues T0159 58 :NPGWGCEGAINHQL 1pot 167 :DDAREVFQMALRKL Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 16 residues neighbor-bump: 2.28788 Ang N(2) at 73.194 48.42 5.922 in (null):N-9999 (1) and CD(14) at 71.6315 48.7437 7.56153 in (null):P-9999 (2) neighbor-bump: 1.96793 Ang C(9) at 71.362 50.112 6.173 in (null):N-9999 (1) and CD(14) at 71.6315 48.7437 7.56153 in (null):P-9999 (2) other bump:2.50814 Ang C(1) at 74.005 48.238 6.928 in (null):G-9999 (0) and CD(14) at 71.6315 48.7437 7.56153 in (null):P-9999 (2) neighbor-bump: 2.72477 Ang C(9) at 71.362 50.112 6.173 in (null):N-9999 (1) and CG(13) at 70.2294 48.2835 7.84578 in (null):P-9999 (2) T0159 72 :AAYELTNTVT 1pot 194 :AAYNELKKLM Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 12 residues T0159 83 :NQGNYAA 1pot 204 :PNVAAFN Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 9 residues neighbor-bump: 2.48518 Ang OD1(28) at 83.0547 46.7141 3.44103 in (null):N-9999 (4) and CD1(35) at 82.4942 46.1863 1.0781 in (null):Y-9999 (5) T0159 91 :MADTISRYKEGKPVFYYTWTPYWVSNELK 1pot 211 :SDNPANPYMEGEVNLGMIWNGSAFVARQA Fragment has 112 clashes (null) has 112 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 31 residues other bump:2.21955 Ang O(236) at 78.375 27.001 5.247 in (null):E-9999 (27) and N(255) at 79.616 26.781 3.42 in (null):G-9999 (30) other bump:2.18427 Ang CE(72) at 77.8539 32.2591 2.25346 in (null):K-9999 (9) and OD1(226) at 76.098 33.5367 2.48981 in (null):N-9999 (26) other bump:1.85266 Ang NZ(73) at 77.4623 32.8423 3.53335 in (null):K-9999 (9) and OD1(226) at 76.098 33.5367 2.48981 in (null):N-9999 (26) other bump:2.56112 Ang CG2(34) at 76.9624 35.1868 4.24745 in (null):I-9999 (5) and OD1(226) at 76.098 33.5367 2.48981 in (null):N-9999 (26) other bump:1.65861 Ang CB(32) at 76.0497 36.3767 4.42395 in (null):I-9999 (5) and ND2(225) at 76.9017 35.0483 3.91364 in (null):N-9999 (26) other bump:2.79337 Ang CG1(33) at 75.3513 36.3978 5.80525 in (null):I-9999 (5) and ND2(225) at 76.9017 35.0483 3.91364 in (null):N-9999 (26) other bump:2.30766 Ang NZ(73) at 77.4623 32.8423 3.53335 in (null):K-9999 (9) and ND2(225) at 76.9017 35.0483 3.91364 in (null):N-9999 (26) other bump:0.366465 Ang CG2(34) at 76.9624 35.1868 4.24745 in (null):I-9999 (5) and ND2(225) at 76.9017 35.0483 3.91364 in (null):N-9999 (26) other bump:2.68737 Ang CA(31) at 76.856 37.716 4.235 in (null):I-9999 (5) and ND2(225) at 76.9017 35.0483 3.91364 in (null):N-9999 (26) other bump:2.91472 Ang C(37) at 77.753 37.676 2.983 in (null):I-9999 (5) and ND2(225) at 76.9017 35.0483 3.91364 in (null):N-9999 (26) other bump:2.81451 Ang CB(32) at 76.0497 36.3767 4.42395 in (null):I-9999 (5) and CG(224) at 76.6937 33.7836 3.53941 in (null):N-9999 (26) other bump:2.3073 Ang CE(72) at 77.8539 32.2591 2.25346 in (null):K-9999 (9) and CG(224) at 76.6937 33.7836 3.53941 in (null):N-9999 (26) other bump:1.21522 Ang NZ(73) at 77.4623 32.8423 3.53335 in (null):K-9999 (9) and CG(224) at 76.6937 33.7836 3.53941 in (null):N-9999 (26) other bump:2.88641 Ang CD(71) at 78.4639 33.2887 1.31391 in (null):K-9999 (9) and CG(224) at 76.6937 33.7836 3.53941 in (null):N-9999 (26) other bump:1.59453 Ang CG2(34) at 76.9624 35.1868 4.24745 in (null):I-9999 (5) and CG(224) at 76.6937 33.7836 3.53941 in (null):N-9999 (26) other bump:2.20474 Ang CE(72) at 77.8539 32.2591 2.25346 in (null):K-9999 (9) and CB(223) at 77.3273 32.6758 4.35347 in (null):N-9999 (26) other bump:0.847673 Ang NZ(73) at 77.4623 32.8423 3.53335 in (null):K-9999 (9) and CB(223) at 77.3273 32.6758 4.35347 in (null):N-9999 (26) other bump:2.53964 Ang CG2(34) at 76.9624 35.1868 4.24745 in (null):I-9999 (5) and CB(223) at 77.3273 32.6758 4.35347 in (null):N-9999 (26) other bump:2.56821 Ang CE(72) at 77.8539 32.2591 2.25346 in (null):K-9999 (9) and CA(222) at 76.582 31.418 4.32 in (null):N-9999 (26) other bump:1.84995 Ang NZ(73) at 77.4623 32.8423 3.53335 in (null):K-9999 (9) and CA(222) at 76.582 31.418 4.32 in (null):N-9999 (26) other bump:2.75431 Ang CA(148) at 76.018 40.768 10.254 in (null):T-9999 (18) and CH2(205) at 76.8461 39.3381 12.4576 in (null):W-9999 (23) other bump:2.4772 Ang O(152) at 74.602 40.353 12.192 in (null):T-9999 (18) and CH2(205) at 76.8461 39.3381 12.4576 in (null):W-9999 (23) other bump:2.82406 Ang C(153) at 74.698 40.387 10.954 in (null):T-9999 (18) and CH2(205) at 76.8461 39.3381 12.4576 in (null):W-9999 (23) other bump:2.25909 Ang CB(149) at 77.1339 39.6978 10.246 in (null):T-9999 (18) and CH2(205) at 76.8461 39.3381 12.4576 in (null):W-9999 (23) other bump:1.74585 Ang CG2(150) at 76.9486 38.3962 10.9912 in (null):T-9999 (18) and CH2(205) at 76.8461 39.3381 12.4576 in (null):W-9999 (23) other bump:3.02255 Ang N(147) at 76.654 41.914 10.888 in (null):T-9999 (18) and CH2(205) at 76.8461 39.3381 12.4576 in (null):W-9999 (23) other bump:2.05521 Ang CG2(150) at 76.9486 38.3962 10.9912 in (null):T-9999 (18) and CZ3(204) at 76.5218 38.0687 12.9748 in (null):W-9999 (23) other bump:1.78364 Ang CA(148) at 76.018 40.768 10.254 in (null):T-9999 (18) and CZ2(203) at 76.9956 39.5454 11.109 in (null):W-9999 (23) other bump:2.74851 Ang O(152) at 74.602 40.353 12.192 in (null):T-9999 (18) and CZ2(203) at 76.9956 39.5454 11.109 in (null):W-9999 (23) other bump:2.45177 Ang C(153) at 74.698 40.387 10.954 in (null):T-9999 (18) and CZ2(203) at 76.9956 39.5454 11.109 in (null):W-9999 (23) other bump:0.887203 Ang CB(149) at 77.1339 39.6978 10.246 in (null):T-9999 (18) and CZ2(203) at 76.9956 39.5454 11.109 in (null):W-9999 (23) other bump:2.27493 Ang OG1(151) at 77.3386 39.3281 8.8706 in (null):T-9999 (18) and CZ2(203) at 76.9956 39.5454 11.109 in (null):W-9999 (23) other bump:1.15618 Ang CG2(150) at 76.9486 38.3962 10.9912 in (null):T-9999 (18) and CZ2(203) at 76.9956 39.5454 11.109 in (null):W-9999 (23) other bump:2.40326 Ang N(147) at 76.654 41.914 10.888 in (null):T-9999 (18) and CZ2(203) at 76.9956 39.5454 11.109 in (null):W-9999 (23) other bump:2.90334 Ang CA(148) at 76.018 40.768 10.254 in (null):T-9999 (18) and NE1(202) at 76.8971 38.3579 8.89459 in (null):W-9999 (23) other bump:1.91775 Ang CB(149) at 77.1339 39.6978 10.246 in (null):T-9999 (18) and NE1(202) at 76.8971 38.3579 8.89459 in (null):W-9999 (23) other bump:1.06623 Ang OG1(151) at 77.3386 39.3281 8.8706 in (null):T-9999 (18) and NE1(202) at 76.8971 38.3579 8.89459 in (null):W-9999 (23) other bump:2.0976 Ang CG2(150) at 76.9486 38.3962 10.9912 in (null):T-9999 (18) and NE1(202) at 76.8971 38.3579 8.89459 in (null):W-9999 (23) other bump:1.9198 Ang CG2(150) at 76.9486 38.3962 10.9912 in (null):T-9999 (18) and CE3(201) at 76.3392 36.9748 12.1286 in (null):W-9999 (23) other bump:2.45369 Ang CA(148) at 76.018 40.768 10.254 in (null):T-9999 (18) and CE2(200) at 76.8117 38.4462 10.2583 in (null):W-9999 (23) other bump:2.9527 Ang C(153) at 74.698 40.387 10.954 in (null):T-9999 (18) and CE2(200) at 76.8117 38.4462 10.2583 in (null):W-9999 (23) other bump:1.29243 Ang CB(149) at 77.1339 39.6978 10.246 in (null):T-9999 (18) and CE2(200) at 76.8117 38.4462 10.2583 in (null):W-9999 (23) other bump:1.72655 Ang OG1(151) at 77.3386 39.3281 8.8706 in (null):T-9999 (18) and CE2(200) at 76.8117 38.4462 10.2583 in (null):W-9999 (23) other bump:0.747261 Ang CG2(150) at 76.9486 38.3962 10.9912 in (null):T-9999 (18) and CE2(200) at 76.8117 38.4462 10.2583 in (null):W-9999 (23) other bump:2.66822 Ang CB(149) at 77.1339 39.6978 10.246 in (null):T-9999 (18) and CD2(199) at 76.4854 37.1584 10.7463 in (null):W-9999 (23) other bump:1.34415 Ang CG2(150) at 76.9486 38.3962 10.9912 in (null):T-9999 (18) and CD2(199) at 76.4854 37.1584 10.7463 in (null):W-9999 (23) other bump:2.39807 Ang OG1(151) at 77.3386 39.3281 8.8706 in (null):T-9999 (18) and CD1(198) at 76.6351 37.0637 8.51229 in (null):W-9999 (23) other bump:2.83175 Ang CG2(150) at 76.9486 38.3962 10.9912 in (null):T-9999 (18) and CD1(198) at 76.6351 37.0637 8.51229 in (null):W-9999 (23) other bump:2.58292 Ang CG2(150) at 76.9486 38.3962 10.9912 in (null):T-9999 (18) and CG(197) at 76.3778 36.2902 9.609 in (null):W-9999 (23) other bump:3.26583 Ang CG1(33) at 75.3513 36.3978 5.80525 in (null):I-9999 (5) and CA(195) at 75.607 34.288 8.285 in (null):W-9999 (23) other bump:2.86104 Ang CD1(35) at 74.3082 35.2957 5.94341 in (null):I-9999 (5) and CA(195) at 75.607 34.288 8.285 in (null):W-9999 (23) other bump:2.07134 Ang CD1(35) at 74.3082 35.2957 5.94341 in (null):I-9999 (5) and N(194) at 74.302 34.882 7.973 in (null):W-9999 (23) other bump:2.42569 Ang CG1(33) at 75.3513 36.3978 5.80525 in (null):I-9999 (5) and C(193) at 73.804 34.795 6.765 in (null):Y-9999 (22) other bump:1.08625 Ang CD1(35) at 74.3082 35.2957 5.94341 in (null):I-9999 (5) and C(193) at 73.804 34.795 6.765 in (null):Y-9999 (22) other bump:2.35865 Ang CG1(33) at 75.3513 36.3978 5.80525 in (null):I-9999 (5) and O(192) at 74.318 34.278 5.758 in (null):Y-9999 (22) other bump:1.03454 Ang CD1(35) at 74.3082 35.2957 5.94341 in (null):I-9999 (5) and O(192) at 74.318 34.278 5.758 in (null):Y-9999 (22) other bump:3.32969 Ang CE3(161) at 70.182 41.548 6.85 in (null):W-9999 (19) and CE1(188) at 69.155 38.6187 5.64543 in (null):Y-9999 (22) other bump:2.88095 Ang CG1(33) at 75.3513 36.3978 5.80525 in (null):I-9999 (5) and CB(184) at 72.5117 36.8527 5.97851 in (null):Y-9999 (22) other bump:2.37749 Ang CD1(35) at 74.3082 35.2957 5.94341 in (null):I-9999 (5) and CB(184) at 72.5117 36.8527 5.97851 in (null):Y-9999 (22) other bump:3.20111 Ang CG1(33) at 75.3513 36.3978 5.80525 in (null):I-9999 (5) and CA(183) at 72.401 35.394 6.537 in (null):Y-9999 (22) other bump:1.99983 Ang CD1(35) at 74.3082 35.2957 5.94341 in (null):I-9999 (5) and CA(183) at 72.401 35.394 6.537 in (null):Y-9999 (22) neighbor-bump: 2.79874 Ang OG1(172) at 70.5732 36.0793 13.7337 in (null):T-9999 (20) and CD(179) at 69.9656 36.5027 11.0348 in (null):P-9999 (21) neighbor-bump: 2.57721 Ang N(168) at 72.085 37.632 11.97 in (null):T-9999 (20) and CD(179) at 69.9656 36.5027 11.0348 in (null):P-9999 (21) other bump:3.14286 Ang CE(7) at 69.5168 46.8268 7.04301 in (null):M-9999 (1) and CH2(165) at 69.212 43.759 6.432 in (null):W-9999 (19) other bump:2.78889 Ang CE(7) at 69.5168 46.8268 7.04301 in (null):M-9999 (1) and CZ2(163) at 69.345 44.135 7.752 in (null):W-9999 (19) other bump:2.30979 Ang CE2(130) at 79.0687 40.6647 8.12531 in (null):Y-9999 (16) and OG1(151) at 77.3386 39.3281 8.8706 in (null):T-9999 (18) other bump:3.02914 Ang CE2(130) at 79.0687 40.6647 8.12531 in (null):Y-9999 (16) and CB(149) at 77.1339 39.6978 10.246 in (null):T-9999 (18) neighbor-bump: 2.78291 Ang CD2(128) at 79.5197 41.9372 8.46055 in (null):Y-9999 (16) and C(146) at 77.56 42.656 10.301 in (null):Y-9999 (17) neighbor-bump: 2.29261 Ang CE2(130) at 79.0687 40.6647 8.12531 in (null):Y-9999 (16) and O(145) at 78.034 42.429 9.161 in (null):Y-9999 (17) neighbor-bump: 1.71464 Ang CD2(128) at 79.5197 41.9372 8.46055 in (null):Y-9999 (16) and O(145) at 78.034 42.429 9.161 in (null):Y-9999 (17) other bump:2.06082 Ang CD1(59) at 80.147 39.453 5.702 in (null):Y-9999 (8) and OH(132) at 79.5611 38.4439 7.40063 in (null):Y-9999 (16) other bump:2.08187 Ang CE1(61) at 79.789 40.375 6.657 in (null):Y-9999 (8) and OH(132) at 79.5611 38.4439 7.40063 in (null):Y-9999 (16) other bump:2.40684 Ang CZ(63) at 80.622 40.576 7.749 in (null):Y-9999 (8) and OH(132) at 79.5611 38.4439 7.40063 in (null):Y-9999 (16) other bump:2.42636 Ang CG(58) at 81.347 38.734 5.784 in (null):Y-9999 (8) and OH(132) at 79.5611 38.4439 7.40063 in (null):Y-9999 (16) other bump:2.72199 Ang CE2(62) at 81.821 39.887 7.869 in (null):Y-9999 (8) and OH(132) at 79.5611 38.4439 7.40063 in (null):Y-9999 (16) other bump:2.03431 Ang CD1(59) at 80.147 39.453 5.702 in (null):Y-9999 (8) and CZ(131) at 79.9844 39.7087 7.71361 in (null):Y-9999 (16) other bump:1.26433 Ang CE1(61) at 79.789 40.375 6.657 in (null):Y-9999 (8) and CZ(131) at 79.9844 39.7087 7.71361 in (null):Y-9999 (16) other bump:1.07703 Ang CZ(63) at 80.622 40.576 7.749 in (null):Y-9999 (8) and CZ(131) at 79.9844 39.7087 7.71361 in (null):Y-9999 (16) other bump:2.04012 Ang OH(64) at 80.303 41.444 8.738 in (null):Y-9999 (8) and CZ(131) at 79.9844 39.7087 7.71361 in (null):Y-9999 (16) other bump:2.55543 Ang CG(58) at 81.347 38.734 5.784 in (null):Y-9999 (8) and CZ(131) at 79.9844 39.7087 7.71361 in (null):Y-9999 (16) other bump:2.45486 Ang CD2(60) at 82.17 38.953 6.89 in (null):Y-9999 (8) and CZ(131) at 79.9844 39.7087 7.71361 in (null):Y-9999 (16) other bump:1.85178 Ang CE2(62) at 81.821 39.887 7.869 in (null):Y-9999 (8) and CZ(131) at 79.9844 39.7087 7.71361 in (null):Y-9999 (16) other bump:1.66092 Ang CE1(61) at 79.789 40.375 6.657 in (null):Y-9999 (8) and CE2(130) at 79.0687 40.6647 8.12531 in (null):Y-9999 (16) other bump:1.60069 Ang CZ(63) at 80.622 40.576 7.749 in (null):Y-9999 (8) and CE2(130) at 79.0687 40.6647 8.12531 in (null):Y-9999 (16) other bump:1.5831 Ang OH(64) at 80.303 41.444 8.738 in (null):Y-9999 (8) and CE2(130) at 79.0687 40.6647 8.12531 in (null):Y-9999 (16) other bump:2.32965 Ang CD1(59) at 80.147 39.453 5.702 in (null):Y-9999 (8) and CE1(129) at 81.3309 40.016 7.62781 in (null):Y-9999 (16) other bump:1.85705 Ang CE1(61) at 79.789 40.375 6.657 in (null):Y-9999 (8) and CE1(129) at 81.3309 40.016 7.62781 in (null):Y-9999 (16) other bump:0.911439 Ang CZ(63) at 80.622 40.576 7.749 in (null):Y-9999 (8) and CE1(129) at 81.3309 40.016 7.62781 in (null):Y-9999 (16) other bump:2.0804 Ang OH(64) at 80.303 41.444 8.738 in (null):Y-9999 (8) and CE1(129) at 81.3309 40.016 7.62781 in (null):Y-9999 (16) other bump:2.24578 Ang CG(58) at 81.347 38.734 5.784 in (null):Y-9999 (8) and CE1(129) at 81.3309 40.016 7.62781 in (null):Y-9999 (16) other bump:1.54226 Ang CD2(60) at 82.17 38.953 6.89 in (null):Y-9999 (8) and CE1(129) at 81.3309 40.016 7.62781 in (null):Y-9999 (16) other bump:0.561304 Ang CE2(62) at 81.821 39.887 7.869 in (null):Y-9999 (8) and CE1(129) at 81.3309 40.016 7.62781 in (null):Y-9999 (16) other bump:2.40118 Ang CE1(61) at 79.789 40.375 6.657 in (null):Y-9999 (8) and CD2(128) at 79.5197 41.9372 8.46055 in (null):Y-9999 (16) other bump:1.89051 Ang CZ(63) at 80.622 40.576 7.749 in (null):Y-9999 (8) and CD2(128) at 79.5197 41.9372 8.46055 in (null):Y-9999 (16) other bump:0.966271 Ang OH(64) at 80.303 41.444 8.738 in (null):Y-9999 (8) and CD2(128) at 79.5197 41.9372 8.46055 in (null):Y-9999 (16) other bump:2.54618 Ang CE1(61) at 79.789 40.375 6.657 in (null):Y-9999 (8) and CD1(127) at 81.7688 41.3018 7.96257 in (null):Y-9999 (16) other bump:1.37387 Ang CZ(63) at 80.622 40.576 7.749 in (null):Y-9999 (8) and CD1(127) at 81.7688 41.3018 7.96257 in (null):Y-9999 (16) other bump:1.66434 Ang OH(64) at 80.303 41.444 8.738 in (null):Y-9999 (8) and CD1(127) at 81.7688 41.3018 7.96257 in (null):Y-9999 (16) other bump:2.6131 Ang CD2(60) at 82.17 38.953 6.89 in (null):Y-9999 (8) and CD1(127) at 81.7688 41.3018 7.96257 in (null):Y-9999 (16) other bump:1.41886 Ang CE2(62) at 81.821 39.887 7.869 in (null):Y-9999 (8) and CD1(127) at 81.7688 41.3018 7.96257 in (null):Y-9999 (16) other bump:1.84089 Ang CZ(63) at 80.622 40.576 7.749 in (null):Y-9999 (8) and CG(126) at 80.8809 42.2859 8.37995 in (null):Y-9999 (16) other bump:1.08212 Ang OH(64) at 80.303 41.444 8.738 in (null):Y-9999 (8) and CG(126) at 80.8809 42.2859 8.37995 in (null):Y-9999 (16) other bump:2.62669 Ang CE2(62) at 81.821 39.887 7.869 in (null):Y-9999 (8) and CG(126) at 80.8809 42.2859 8.37995 in (null):Y-9999 (16) other bump:2.45374 Ang OH(64) at 80.303 41.444 8.738 in (null):Y-9999 (8) and CB(125) at 81.3094 43.6818 8.75665 in (null):Y-9999 (16) neighbor-bump: 2.64744 Ang C(122) at 83.662 42.718 9.495 in (null):F-9999 (15) and CB(125) at 81.3094 43.6818 8.75665 in (null):Y-9999 (16) neighbor-bump: 2.89828 Ang CG2(109) at 88.4736 41.8589 8.31969 in (null):V-9999 (14) and CD2(117) at 87.5426 43.7501 10.3088 in (null):F-9999 (15) neighbor-bump: 2.4412 Ang N(89) at 85.68 40.233 0.492 in (null):K-9999 (12) and CD(102) at 84.2296 41.6341 1.86773 in (null):P-9999 (13) neighbor-bump: 1.92408 Ang C(97) at 85.924 42.408 1.386 in (null):K-9999 (12) and CD(102) at 84.2296 41.6341 1.86773 in (null):P-9999 (13) other bump:1.81594 Ang OE1(81) at 82.02 40.453 -4.266 in (null):E-9999 (10) and NZ(95) at 83.1467 41.3315 -5.38689 in (null):K-9999 (12) other bump:2.45595 Ang OE1(81) at 82.02 40.453 -4.266 in (null):E-9999 (10) and CE(94) at 84.3662 41.1147 -4.56481 in (null):K-9999 (12) other bump:2.5013 Ang CG2(34) at 76.9624 35.1868 4.24745 in (null):I-9999 (5) and NZ(73) at 77.4623 32.8423 3.53335 in (null):K-9999 (9) other bump:2.33191 Ang O(0) at 73.736 45.177 4.526 in (null):G-9999 (0) and CG2(26) at 74.1717 43.072 5.42974 in (null):T-9999 (4) T0159 120 :PGKDVVWLQ 1pot 241 :TPIDVVWPK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues T0159 129 :VPFSALPGD 1pot 256 :MDSLAIPAN Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.95736 Ang CG1(5) at 59.2246 40.7605 15.5821 in (null):V-9999 (1) and CZ(24) at 56.9035 42.2721 16.6181 in (null):F-9999 (3) other bump:3.13513 Ang CG1(5) at 59.2246 40.7605 15.5821 in (null):V-9999 (1) and CE2(23) at 57.3712 43.282 15.7716 in (null):F-9999 (3) T0159 138 :KNADTKL 1pot 298 :LAARKLL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 9 residues T0159 145 :PNGANYG 1pot 341 :YQKLKAG Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 8 residues other bump:2.75216 Ang O(24) at 78.613 59.061 4.802 in (null):A-9999 (4) and C(49) at 80.848 60.577 4.272 in (null):G-9999 (7) Number of specific fragments= 16 total=195 Number of alignments=38 # Reading fragments from alignment file # T0159 read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1kq3A/T0159-1kq3A-2track-protein-EBGHTL-local-adpstyle1.pw.a2m.gz # 1kq3A read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1kq3A/T0159-1kq3A-2track-protein-EBGHTL-local-adpstyle1.pw.a2m.gz # found chain 1kq3A in template set T0159 40 :IAKLF 1kq3A 49 :FFSSF Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 7 residues T0159 46 :TNGDGKADLTGCNPG 1kq3A 54 :TKVRVNKQIFGGECS Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 17 residues neighbor-bump: 2.08747 Ang O(72) at 19.955 13.793 28.831 in (null):G-9999 (11) and CB(76) at 21.5549 15.1321 28.7616 in (null):C-9999 (12) neighbor-bump: 2.55059 Ang C(73) at 19.53 14.009 27.692 in (null):G-9999 (11) and CB(76) at 21.5549 15.1321 28.7616 in (null):C-9999 (12) T0159 64 :EGAINHQLAAYELTNTVTHNQGNYAAMMADTISRYKEGKPVFYY 1kq3A 69 :DEEIERLSGLVEEETDVVVGIGGGKTLDTAKAVAYKLKKPVVIV Fragment has 73 clashes (null) has 73 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 46 residues other bump:2.30233 Ang CA(229) at 20.93 15.257 12.461 in (null):T-9999 (31) and OH(337) at 20.6057 16.9838 10.9732 in (null):Y-9999 (43) other bump:2.66629 Ang CG1(313) at 18.955 17.949 9.115 in (null):V-9999 (41) and OH(337) at 20.6057 16.9838 10.9732 in (null):Y-9999 (43) other bump:2.47852 Ang CB(230) at 22.3466 15.8251 12.3033 in (null):T-9999 (31) and OH(337) at 20.6057 16.9838 10.9732 in (null):Y-9999 (43) other bump:2.80166 Ang CG2(231) at 22.9422 15.438 10.9638 in (null):T-9999 (31) and OH(337) at 20.6057 16.9838 10.9732 in (null):Y-9999 (43) other bump:2.16977 Ang OG1(232) at 22.2403 17.2738 12.3702 in (null):T-9999 (31) and OH(337) at 20.6057 16.9838 10.9732 in (null):Y-9999 (43) other bump:3.09062 Ang CZ(255) at 17.5683 17.9782 11.9253 in (null):R-9999 (34) and CZ(336) at 20.5826 18.3081 11.3277 in (null):Y-9999 (43) other bump:2.00606 Ang NH2(257) at 18.7743 18.4787 12.1792 in (null):R-9999 (34) and CZ(336) at 20.5826 18.3081 11.3277 in (null):Y-9999 (43) other bump:2.77022 Ang CG1(313) at 18.955 17.949 9.115 in (null):V-9999 (41) and CZ(336) at 20.5826 18.3081 11.3277 in (null):Y-9999 (43) other bump:2.21463 Ang OG1(232) at 22.2403 17.2738 12.3702 in (null):T-9999 (31) and CZ(336) at 20.5826 18.3081 11.3277 in (null):Y-9999 (43) other bump:2.66822 Ang NH2(257) at 18.7743 18.4787 12.1792 in (null):R-9999 (34) and CE2(335) at 20.5385 19.3083 10.3574 in (null):Y-9999 (43) other bump:2.42868 Ang CG1(313) at 18.955 17.949 9.115 in (null):V-9999 (41) and CE2(335) at 20.5385 19.3083 10.3574 in (null):Y-9999 (43) other bump:1.92198 Ang NH2(257) at 18.7743 18.4787 12.1792 in (null):R-9999 (34) and CE1(334) at 20.6269 18.6276 12.6689 in (null):Y-9999 (43) other bump:2.1272 Ang OG1(232) at 22.2403 17.2738 12.3702 in (null):T-9999 (31) and CE1(334) at 20.6269 18.6276 12.6689 in (null):Y-9999 (43) other bump:2.53202 Ang NH2(257) at 18.7743 18.4787 12.1792 in (null):R-9999 (34) and CD1(332) at 20.6331 19.96 13.0519 in (null):Y-9999 (43) other bump:2.90832 Ang ND1(143) at 14.5355 22.9569 14.5365 in (null):H-9999 (19) and CD2(322) at 14.5901 24.6241 12.1541 in (null):F-9999 (42) other bump:2.27733 Ang CD(253) at 16.152 16.5439 10.4906 in (null):R-9999 (34) and CG2(314) at 17.769 17.909 11.332 in (null):V-9999 (41) other bump:0.939629 Ang NE(254) at 17.4062 17.1677 10.8828 in (null):R-9999 (34) and CG2(314) at 17.769 17.909 11.332 in (null):V-9999 (41) other bump:0.630083 Ang CZ(255) at 17.5683 17.9782 11.9253 in (null):R-9999 (34) and CG2(314) at 17.769 17.909 11.332 in (null):V-9999 (41) other bump:1.88519 Ang NH1(256) at 16.5406 18.3101 12.7046 in (null):R-9999 (34) and CG2(314) at 17.769 17.909 11.332 in (null):V-9999 (41) other bump:1.43282 Ang NH2(257) at 18.7743 18.4787 12.1792 in (null):R-9999 (34) and CG2(314) at 17.769 17.909 11.332 in (null):V-9999 (41) other bump:2.4768 Ang NE(254) at 17.4062 17.1677 10.8828 in (null):R-9999 (34) and CG1(313) at 18.955 17.949 9.115 in (null):V-9999 (41) other bump:3.11491 Ang NH2(257) at 18.7743 18.4787 12.1792 in (null):R-9999 (34) and CG1(313) at 18.955 17.949 9.115 in (null):V-9999 (41) other bump:1.95889 Ang CD(253) at 16.152 16.5439 10.4906 in (null):R-9999 (34) and CB(312) at 17.643 17.631 9.833 in (null):V-9999 (41) other bump:1.17171 Ang NE(254) at 17.4062 17.1677 10.8828 in (null):R-9999 (34) and CB(312) at 17.643 17.631 9.833 in (null):V-9999 (41) other bump:2.12218 Ang CZ(255) at 17.5683 17.9782 11.9253 in (null):R-9999 (34) and CB(312) at 17.643 17.631 9.833 in (null):V-9999 (41) other bump:2.73919 Ang NH2(257) at 18.7743 18.4787 12.1792 in (null):R-9999 (34) and CB(312) at 17.643 17.631 9.833 in (null):V-9999 (41) other bump:2.28534 Ang CD(253) at 16.152 16.5439 10.4906 in (null):R-9999 (34) and CA(311) at 16.456 18.421 9.223 in (null):V-9999 (41) other bump:2.28664 Ang NE(254) at 17.4062 17.1677 10.8828 in (null):R-9999 (34) and CA(311) at 16.456 18.421 9.223 in (null):V-9999 (41) other bump:2.95561 Ang CZ(255) at 17.5683 17.9782 11.9253 in (null):R-9999 (34) and CA(311) at 16.456 18.421 9.223 in (null):V-9999 (41) other bump:2.96518 Ang CD(253) at 16.152 16.5439 10.4906 in (null):R-9999 (34) and N(310) at 16.192 17.942 7.876 in (null):V-9999 (41) other bump:3.06575 Ang CD(253) at 16.152 16.5439 10.4906 in (null):R-9999 (34) and C(309) at 15.169 17.113 7.643 in (null):P-9999 (40) other bump:2.62864 Ang CD(253) at 16.152 16.5439 10.4906 in (null):R-9999 (34) and O(308) at 14.391 16.731 8.548 in (null):P-9999 (40) other bump:2.63215 Ang CG(58) at 14.3949 6.24159 14.692 in (null):L-9999 (8) and OE2(287) at 13.396 6.0279 12.2662 in (null):E-9999 (37) other bump:2.00961 Ang CD1(59) at 14.1818 7.29816 13.6106 in (null):L-9999 (8) and OE2(287) at 13.396 6.0279 12.2662 in (null):E-9999 (37) other bump:2.41732 Ang CD1(59) at 14.1818 7.29816 13.6106 in (null):L-9999 (8) and CD(285) at 12.8608 6.95413 11.6156 in (null):E-9999 (37) other bump:2.29284 Ang CD1(59) at 14.1818 7.29816 13.6106 in (null):L-9999 (8) and CG(284) at 13.4898 8.33089 11.684 in (null):E-9999 (37) other bump:1.99228 Ang CD2(60) at 15.4351 5.24768 14.2867 in (null):L-9999 (8) and NZ(278) at 16.069 3.522 13.519 in (null):K-9999 (36) other bump:2.10205 Ang CD2(60) at 15.4351 5.24768 14.2867 in (null):L-9999 (8) and CE(277) at 17.225 4.146 14.252 in (null):K-9999 (36) other bump:2.09124 Ang CD2(60) at 15.4351 5.24768 14.2867 in (null):L-9999 (8) and CD(276) at 17.449 5.595 13.843 in (null):K-9999 (36) other bump:2.74244 Ang C(137) at 13.81 18.134 12.521 in (null):T-9999 (18) and NH1(256) at 16.5406 18.3101 12.7046 in (null):R-9999 (34) other bump:1.94507 Ang OG1(135) at 14.9815 15.544 11.6795 in (null):T-9999 (18) and CD(253) at 16.152 16.5439 10.4906 in (null):R-9999 (34) other bump:2.76438 Ang CB(133) at 13.8169 15.5846 12.5118 in (null):T-9999 (18) and CG(252) at 16.053 15.0903 10.9635 in (null):R-9999 (34) other bump:1.36621 Ang OG1(135) at 14.9815 15.544 11.6795 in (null):T-9999 (18) and CG(252) at 16.053 15.0903 10.9635 in (null):R-9999 (34) other bump:2.88902 Ang CD1(25) at 22.712 9.363 17.444 in (null):I-9999 (4) and CG2(239) at 21.9765 9.5248 14.6549 in (null):I-9999 (32) other bump:2.79949 Ang C(147) at 15.17 19.649 15.44 in (null):H-9999 (19) and OD2(225) at 17.3963 18.8669 16.9463 in (null):D-9999 (30) other bump:2.29285 Ang N(148) at 16.334 20.291 15.497 in (null):N-9999 (20) and OD2(225) at 17.3963 18.8669 16.9463 in (null):D-9999 (30) other bump:1.43991 Ang CA(149) at 17.174 20.264 16.678 in (null):N-9999 (20) and OD2(225) at 17.3963 18.8669 16.9463 in (null):D-9999 (30) other bump:2.84107 Ang C(155) at 17.334 21.699 17.163 in (null):N-9999 (20) and OD2(225) at 17.3963 18.8669 16.9463 in (null):D-9999 (30) other bump:1.50544 Ang CB(150) at 18.5461 19.6559 16.3792 in (null):N-9999 (20) and OD2(225) at 17.3963 18.8669 16.9463 in (null):D-9999 (30) other bump:2.36949 Ang CG(151) at 19.4551 19.8469 17.5907 in (null):N-9999 (20) and OD2(225) at 17.3963 18.8669 16.9463 in (null):D-9999 (30) other bump:2.65479 Ang CA(149) at 17.174 20.264 16.678 in (null):N-9999 (20) and CG(223) at 17.5914 17.644 16.7747 in (null):D-9999 (30) other bump:2.26178 Ang CB(150) at 18.5461 19.6559 16.3792 in (null):N-9999 (20) and CG(223) at 17.5914 17.644 16.7747 in (null):D-9999 (30) other bump:2.99868 Ang CG(151) at 19.4551 19.8469 17.5907 in (null):N-9999 (20) and CG(223) at 17.5914 17.644 16.7747 in (null):D-9999 (30) other bump:2.61992 Ang CB(150) at 18.5461 19.6559 16.3792 in (null):N-9999 (20) and CB(222) at 18.259 17.2097 15.4861 in (null):D-9999 (30) other bump:2.7058 Ang OH(186) at 30.3085 17.1746 16.644 in (null):Y-9999 (24) and SD(211) at 27.9406 16.4666 17.7454 in (null):M-9999 (28) other bump:2.94077 Ang CD2(182) at 28.7179 18.5844 19.6319 in (null):Y-9999 (24) and SD(211) at 27.9406 16.4666 17.7454 in (null):M-9999 (28) other bump:2.15978 Ang CE2(184) at 29.3725 17.7032 18.7871 in (null):Y-9999 (24) and SD(211) at 27.9406 16.4666 17.7454 in (null):M-9999 (28) other bump:2.38273 Ang CZ(185) at 29.6846 18.0707 17.4951 in (null):Y-9999 (24) and SD(211) at 27.9406 16.4666 17.7454 in (null):M-9999 (28) other bump:3.27647 Ang CE1(183) at 29.3618 19.3339 17.0427 in (null):Y-9999 (24) and SD(211) at 27.9406 16.4666 17.7454 in (null):M-9999 (28) other bump:2.38514 Ang OD1(153) at 20.3377 20.6819 17.5968 in (null):N-9999 (20) and CG(202) at 22.3274 21.9163 17.1424 in (null):M-9999 (27) other bump:2.63015 Ang OD1(153) at 20.3377 20.6819 17.5968 in (null):N-9999 (20) and CB(201) at 22.7602 20.5601 16.5796 in (null):M-9999 (27) other bump:2.53535 Ang CG(151) at 19.4551 19.8469 17.5907 in (null):N-9999 (20) and CA(200) at 21.898 19.406 17.075 in (null):M-9999 (27) other bump:2.082 Ang OD1(153) at 20.3377 20.6819 17.5968 in (null):N-9999 (20) and CA(200) at 21.898 19.406 17.075 in (null):M-9999 (27) other bump:2.69266 Ang CG(151) at 19.4551 19.8469 17.5907 in (null):N-9999 (20) and N(199) at 21.916 19.283 18.527 in (null):M-9999 (27) other bump:2.68909 Ang CG(151) at 19.4551 19.8469 17.5907 in (null):N-9999 (20) and C(198) at 21.117 18.402 19.134 in (null):A-9999 (26) other bump:2.17775 Ang ND2(152) at 19.1201 19.141 18.6772 in (null):N-9999 (20) and C(198) at 21.117 18.402 19.134 in (null):A-9999 (26) other bump:2.85802 Ang OD1(153) at 20.3377 20.6819 17.5968 in (null):N-9999 (20) and C(198) at 21.117 18.402 19.134 in (null):A-9999 (26) other bump:2.53812 Ang CG(151) at 19.4551 19.8469 17.5907 in (null):N-9999 (20) and O(197) at 20.355 17.656 18.503 in (null):A-9999 (26) other bump:1.93926 Ang ND2(152) at 19.1201 19.141 18.6772 in (null):N-9999 (20) and O(197) at 20.355 17.656 18.503 in (null):A-9999 (26) other bump:2.54332 Ang NE2(145) at 14.0513 23.8958 16.3515 in (null):H-9999 (19) and NE2(162) at 13.32 25.0558 18.4935 in (null):Q-9999 (21) other bump:2.42204 Ang CE1(144) at 14.8048 24.0118 15.2811 in (null):H-9999 (19) and OE1(161) at 14.0413 25.9367 16.5374 in (null):Q-9999 (21) other bump:2.04934 Ang NE2(145) at 14.0513 23.8958 16.3515 in (null):H-9999 (19) and OE1(161) at 14.0413 25.9367 16.5374 in (null):Q-9999 (21) other bump:2.55029 Ang NE2(145) at 14.0513 23.8958 16.3515 in (null):H-9999 (19) and CG(159) at 15.6763 25.0007 17.9771 in (null):Q-9999 (21) Number of specific fragments= 3 total=198 Number of alignments=39 # Reading fragments from alignment file # T0159 read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1kq3A/T0159-1kq3A-2track-protein-EBGHTL-local-adpstyle5.pw.a2m.gz # 1kq3A read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1kq3A/T0159-1kq3A-2track-protein-EBGHTL-local-adpstyle5.pw.a2m.gz # found chain 1kq3A in template set T0159 18 :LIDKKTAD 1kq3A 35 :VIDDFVDK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 10 residues T0159 35 :LKDPKIAKLF 1kq3A 44 :VLGENFFSSF Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 12 residues other bump:1.89817 Ang CA(11) at 12.05 29.665 24.123 in (null):K-9999 (2) and CD1(48) at 10.3188 29.0898 23.5984 in (null):I-9999 (6) other bump:1.62 Ang CB(12) at 11.7927 28.6065 23.1309 in (null):K-9999 (2) and CD1(48) at 10.3188 29.0898 23.5984 in (null):I-9999 (6) other bump:1.89638 Ang O(17) at 9.91 30.614 24.65 in (null):K-9999 (2) and CD1(48) at 10.3188 29.0898 23.5984 in (null):I-9999 (6) other bump:1.6778 Ang C(18) at 10.82 29.864 25 in (null):K-9999 (2) and CD1(48) at 10.3188 29.0898 23.5984 in (null):I-9999 (6) other bump:2.58557 Ang N(19) at 10.812 29.178 26.135 in (null):D-9999 (3) and CD1(48) at 10.3188 29.0898 23.5984 in (null):I-9999 (6) other bump:2.24988 Ang OD1(23) at 8.06164 30.5631 25.3384 in (null):D-9999 (3) and CG1(46) at 8.82469 29.3876 23.5783 in (null):I-9999 (6) other bump:1.95719 Ang O(17) at 9.91 30.614 24.65 in (null):K-9999 (2) and CG1(46) at 8.82469 29.3876 23.5783 in (null):I-9999 (6) other bump:2.49592 Ang C(18) at 10.82 29.864 25 in (null):K-9999 (2) and CG1(46) at 8.82469 29.3876 23.5783 in (null):I-9999 (6) neighbor-bump: 2.33116 Ang O(17) at 9.91 30.614 24.65 in (null):K-9999 (2) and CG(22) at 8.43465 31.1804 26.3637 in (null):D-9999 (3) self-bump: 1.39115 Ang CA(20) at 9.664 29.246 27.026 in (null):D-9999 (3) and CB(21) at 9.19458 30.4835 27.4543 in (null):D-9999 (3) T0159 46 :TNGDGKADLTGCNPGW 1kq3A 54 :TKVRVNKQIFGGECSD Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 18 residues neighbor-bump: 2.55059 Ang C(73) at 19.53 14.009 27.692 in (null):G-9999 (11) and CB(76) at 21.5549 15.1321 28.7616 in (null):C-9999 (12) neighbor-bump: 2.08747 Ang O(72) at 19.955 13.793 28.831 in (null):G-9999 (11) and CB(76) at 21.5549 15.1321 28.7616 in (null):C-9999 (12) T0159 65 :GAINHQLAAYELTNTVTHNQGNYAAMMADTISRYKEGKPVFYY 1kq3A 70 :EEIERLSGLVEEETDVVVGIGGGKTLDTAKAVAYKLKKPVVIV Fragment has 73 clashes (null) has 73 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 45 residues other bump:2.30233 Ang CA(220) at 20.93 15.257 12.461 in (null):T-9999 (30) and OH(328) at 20.6057 16.9838 10.9732 in (null):Y-9999 (42) other bump:2.66629 Ang CG1(304) at 18.955 17.949 9.115 in (null):V-9999 (40) and OH(328) at 20.6057 16.9838 10.9732 in (null):Y-9999 (42) other bump:2.47852 Ang CB(221) at 22.3466 15.8251 12.3033 in (null):T-9999 (30) and OH(328) at 20.6057 16.9838 10.9732 in (null):Y-9999 (42) other bump:2.80166 Ang CG2(222) at 22.9422 15.438 10.9638 in (null):T-9999 (30) and OH(328) at 20.6057 16.9838 10.9732 in (null):Y-9999 (42) other bump:2.16977 Ang OG1(223) at 22.2403 17.2738 12.3702 in (null):T-9999 (30) and OH(328) at 20.6057 16.9838 10.9732 in (null):Y-9999 (42) other bump:3.09062 Ang CZ(246) at 17.5683 17.9782 11.9253 in (null):R-9999 (33) and CZ(327) at 20.5826 18.3081 11.3277 in (null):Y-9999 (42) other bump:2.00606 Ang NH2(248) at 18.7743 18.4787 12.1792 in (null):R-9999 (33) and CZ(327) at 20.5826 18.3081 11.3277 in (null):Y-9999 (42) other bump:2.77022 Ang CG1(304) at 18.955 17.949 9.115 in (null):V-9999 (40) and CZ(327) at 20.5826 18.3081 11.3277 in (null):Y-9999 (42) other bump:2.21463 Ang OG1(223) at 22.2403 17.2738 12.3702 in (null):T-9999 (30) and CZ(327) at 20.5826 18.3081 11.3277 in (null):Y-9999 (42) other bump:2.66822 Ang NH2(248) at 18.7743 18.4787 12.1792 in (null):R-9999 (33) and CE2(326) at 20.5385 19.3083 10.3574 in (null):Y-9999 (42) other bump:2.42868 Ang CG1(304) at 18.955 17.949 9.115 in (null):V-9999 (40) and CE2(326) at 20.5385 19.3083 10.3574 in (null):Y-9999 (42) other bump:1.92198 Ang NH2(248) at 18.7743 18.4787 12.1792 in (null):R-9999 (33) and CE1(325) at 20.6269 18.6276 12.6689 in (null):Y-9999 (42) other bump:2.1272 Ang OG1(223) at 22.2403 17.2738 12.3702 in (null):T-9999 (30) and CE1(325) at 20.6269 18.6276 12.6689 in (null):Y-9999 (42) other bump:2.53202 Ang NH2(248) at 18.7743 18.4787 12.1792 in (null):R-9999 (33) and CD1(323) at 20.6331 19.96 13.0519 in (null):Y-9999 (42) other bump:2.90832 Ang ND1(134) at 14.5355 22.9569 14.5365 in (null):H-9999 (18) and CD2(313) at 14.5901 24.6241 12.1541 in (null):F-9999 (41) other bump:2.27733 Ang CD(244) at 16.152 16.5439 10.4906 in (null):R-9999 (33) and CG2(305) at 17.769 17.909 11.332 in (null):V-9999 (40) other bump:0.939629 Ang NE(245) at 17.4062 17.1677 10.8828 in (null):R-9999 (33) and CG2(305) at 17.769 17.909 11.332 in (null):V-9999 (40) other bump:0.630083 Ang CZ(246) at 17.5683 17.9782 11.9253 in (null):R-9999 (33) and CG2(305) at 17.769 17.909 11.332 in (null):V-9999 (40) other bump:1.88519 Ang NH1(247) at 16.5406 18.3101 12.7046 in (null):R-9999 (33) and CG2(305) at 17.769 17.909 11.332 in (null):V-9999 (40) other bump:1.43282 Ang NH2(248) at 18.7743 18.4787 12.1792 in (null):R-9999 (33) and CG2(305) at 17.769 17.909 11.332 in (null):V-9999 (40) other bump:2.4768 Ang NE(245) at 17.4062 17.1677 10.8828 in (null):R-9999 (33) and CG1(304) at 18.955 17.949 9.115 in (null):V-9999 (40) other bump:3.11491 Ang NH2(248) at 18.7743 18.4787 12.1792 in (null):R-9999 (33) and CG1(304) at 18.955 17.949 9.115 in (null):V-9999 (40) other bump:1.95889 Ang CD(244) at 16.152 16.5439 10.4906 in (null):R-9999 (33) and CB(303) at 17.643 17.631 9.833 in (null):V-9999 (40) other bump:1.17171 Ang NE(245) at 17.4062 17.1677 10.8828 in (null):R-9999 (33) and CB(303) at 17.643 17.631 9.833 in (null):V-9999 (40) other bump:2.12218 Ang CZ(246) at 17.5683 17.9782 11.9253 in (null):R-9999 (33) and CB(303) at 17.643 17.631 9.833 in (null):V-9999 (40) other bump:2.73919 Ang NH2(248) at 18.7743 18.4787 12.1792 in (null):R-9999 (33) and CB(303) at 17.643 17.631 9.833 in (null):V-9999 (40) other bump:2.28534 Ang CD(244) at 16.152 16.5439 10.4906 in (null):R-9999 (33) and CA(302) at 16.456 18.421 9.223 in (null):V-9999 (40) other bump:2.28664 Ang NE(245) at 17.4062 17.1677 10.8828 in (null):R-9999 (33) and CA(302) at 16.456 18.421 9.223 in (null):V-9999 (40) other bump:2.95561 Ang CZ(246) at 17.5683 17.9782 11.9253 in (null):R-9999 (33) and CA(302) at 16.456 18.421 9.223 in (null):V-9999 (40) other bump:2.96518 Ang CD(244) at 16.152 16.5439 10.4906 in (null):R-9999 (33) and N(301) at 16.192 17.942 7.876 in (null):V-9999 (40) other bump:3.06575 Ang CD(244) at 16.152 16.5439 10.4906 in (null):R-9999 (33) and C(300) at 15.169 17.113 7.643 in (null):P-9999 (39) other bump:2.62864 Ang CD(244) at 16.152 16.5439 10.4906 in (null):R-9999 (33) and O(299) at 14.391 16.731 8.548 in (null):P-9999 (39) other bump:2.63215 Ang CG(49) at 14.3949 6.24159 14.692 in (null):L-9999 (7) and OE2(278) at 13.396 6.0279 12.2662 in (null):E-9999 (36) other bump:2.00961 Ang CD1(50) at 14.1818 7.29816 13.6106 in (null):L-9999 (7) and OE2(278) at 13.396 6.0279 12.2662 in (null):E-9999 (36) other bump:2.41732 Ang CD1(50) at 14.1818 7.29816 13.6106 in (null):L-9999 (7) and CD(276) at 12.8608 6.95413 11.6156 in (null):E-9999 (36) other bump:2.29284 Ang CD1(50) at 14.1818 7.29816 13.6106 in (null):L-9999 (7) and CG(275) at 13.4898 8.33089 11.684 in (null):E-9999 (36) other bump:1.99228 Ang CD2(51) at 15.4351 5.24768 14.2867 in (null):L-9999 (7) and NZ(269) at 16.069 3.522 13.519 in (null):K-9999 (35) other bump:2.10205 Ang CD2(51) at 15.4351 5.24768 14.2867 in (null):L-9999 (7) and CE(268) at 17.225 4.146 14.252 in (null):K-9999 (35) other bump:2.09124 Ang CD2(51) at 15.4351 5.24768 14.2867 in (null):L-9999 (7) and CD(267) at 17.449 5.595 13.843 in (null):K-9999 (35) other bump:2.74244 Ang C(128) at 13.81 18.134 12.521 in (null):T-9999 (17) and NH1(247) at 16.5406 18.3101 12.7046 in (null):R-9999 (33) other bump:1.94507 Ang OG1(126) at 14.9815 15.544 11.6795 in (null):T-9999 (17) and CD(244) at 16.152 16.5439 10.4906 in (null):R-9999 (33) other bump:2.76438 Ang CB(124) at 13.8169 15.5846 12.5118 in (null):T-9999 (17) and CG(243) at 16.053 15.0903 10.9635 in (null):R-9999 (33) other bump:1.36621 Ang OG1(126) at 14.9815 15.544 11.6795 in (null):T-9999 (17) and CG(243) at 16.053 15.0903 10.9635 in (null):R-9999 (33) other bump:2.88902 Ang CD1(16) at 22.712 9.363 17.444 in (null):I-9999 (3) and CG2(230) at 21.9765 9.5248 14.6549 in (null):I-9999 (31) other bump:2.79949 Ang C(138) at 15.17 19.649 15.44 in (null):H-9999 (18) and OD2(216) at 17.3963 18.8669 16.9463 in (null):D-9999 (29) other bump:2.29285 Ang N(139) at 16.334 20.291 15.497 in (null):N-9999 (19) and OD2(216) at 17.3963 18.8669 16.9463 in (null):D-9999 (29) other bump:1.43991 Ang CA(140) at 17.174 20.264 16.678 in (null):N-9999 (19) and OD2(216) at 17.3963 18.8669 16.9463 in (null):D-9999 (29) other bump:2.84107 Ang C(146) at 17.334 21.699 17.163 in (null):N-9999 (19) and OD2(216) at 17.3963 18.8669 16.9463 in (null):D-9999 (29) other bump:1.50544 Ang CB(141) at 18.5461 19.6559 16.3792 in (null):N-9999 (19) and OD2(216) at 17.3963 18.8669 16.9463 in (null):D-9999 (29) other bump:2.36949 Ang CG(142) at 19.4551 19.8469 17.5907 in (null):N-9999 (19) and OD2(216) at 17.3963 18.8669 16.9463 in (null):D-9999 (29) other bump:2.65479 Ang CA(140) at 17.174 20.264 16.678 in (null):N-9999 (19) and CG(214) at 17.5914 17.644 16.7747 in (null):D-9999 (29) other bump:2.26178 Ang CB(141) at 18.5461 19.6559 16.3792 in (null):N-9999 (19) and CG(214) at 17.5914 17.644 16.7747 in (null):D-9999 (29) other bump:2.99868 Ang CG(142) at 19.4551 19.8469 17.5907 in (null):N-9999 (19) and CG(214) at 17.5914 17.644 16.7747 in (null):D-9999 (29) other bump:2.61992 Ang CB(141) at 18.5461 19.6559 16.3792 in (null):N-9999 (19) and CB(213) at 18.259 17.2097 15.4861 in (null):D-9999 (29) other bump:2.7058 Ang OH(177) at 30.3085 17.1746 16.644 in (null):Y-9999 (23) and SD(202) at 27.9406 16.4666 17.7454 in (null):M-9999 (27) other bump:2.94077 Ang CD2(173) at 28.7179 18.5844 19.6319 in (null):Y-9999 (23) and SD(202) at 27.9406 16.4666 17.7454 in (null):M-9999 (27) other bump:2.15978 Ang CE2(175) at 29.3725 17.7032 18.7871 in (null):Y-9999 (23) and SD(202) at 27.9406 16.4666 17.7454 in (null):M-9999 (27) other bump:2.38273 Ang CZ(176) at 29.6846 18.0707 17.4951 in (null):Y-9999 (23) and SD(202) at 27.9406 16.4666 17.7454 in (null):M-9999 (27) other bump:3.27647 Ang CE1(174) at 29.3618 19.3339 17.0427 in (null):Y-9999 (23) and SD(202) at 27.9406 16.4666 17.7454 in (null):M-9999 (27) other bump:2.38514 Ang OD1(144) at 20.3377 20.6819 17.5968 in (null):N-9999 (19) and CG(193) at 22.3274 21.9163 17.1424 in (null):M-9999 (26) other bump:2.63015 Ang OD1(144) at 20.3377 20.6819 17.5968 in (null):N-9999 (19) and CB(192) at 22.7602 20.5601 16.5796 in (null):M-9999 (26) other bump:2.53535 Ang CG(142) at 19.4551 19.8469 17.5907 in (null):N-9999 (19) and CA(191) at 21.898 19.406 17.075 in (null):M-9999 (26) other bump:2.082 Ang OD1(144) at 20.3377 20.6819 17.5968 in (null):N-9999 (19) and CA(191) at 21.898 19.406 17.075 in (null):M-9999 (26) other bump:2.69266 Ang CG(142) at 19.4551 19.8469 17.5907 in (null):N-9999 (19) and N(190) at 21.916 19.283 18.527 in (null):M-9999 (26) other bump:2.68909 Ang CG(142) at 19.4551 19.8469 17.5907 in (null):N-9999 (19) and C(189) at 21.117 18.402 19.134 in (null):A-9999 (25) other bump:2.17775 Ang ND2(143) at 19.1201 19.141 18.6772 in (null):N-9999 (19) and C(189) at 21.117 18.402 19.134 in (null):A-9999 (25) other bump:2.85802 Ang OD1(144) at 20.3377 20.6819 17.5968 in (null):N-9999 (19) and C(189) at 21.117 18.402 19.134 in (null):A-9999 (25) other bump:2.53812 Ang CG(142) at 19.4551 19.8469 17.5907 in (null):N-9999 (19) and O(188) at 20.355 17.656 18.503 in (null):A-9999 (25) other bump:1.93926 Ang ND2(143) at 19.1201 19.141 18.6772 in (null):N-9999 (19) and O(188) at 20.355 17.656 18.503 in (null):A-9999 (25) other bump:2.54332 Ang NE2(136) at 14.0513 23.8958 16.3515 in (null):H-9999 (18) and NE2(153) at 13.32 25.0558 18.4935 in (null):Q-9999 (20) other bump:2.42204 Ang CE1(135) at 14.8048 24.0118 15.2811 in (null):H-9999 (18) and OE1(152) at 14.0413 25.9367 16.5374 in (null):Q-9999 (20) other bump:2.04934 Ang NE2(136) at 14.0513 23.8958 16.3515 in (null):H-9999 (18) and OE1(152) at 14.0413 25.9367 16.5374 in (null):Q-9999 (20) other bump:2.55029 Ang NE2(136) at 14.0513 23.8958 16.3515 in (null):H-9999 (18) and CG(150) at 15.6763 25.0007 17.9771 in (null):Q-9999 (20) T0159 111 :PYWVS 1kq3A 113 :PTIAS Fragment has 15 clashes (null) has 15 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 7 residues other bump:2.89241 Ang CZ3(31) at 29.2159 26.09 20.7478 in (null):W-9999 (3) and N(48) at 30.684 26.626 18.314 in (null):G-9999 (6) other bump:2.63153 Ang CZ3(31) at 29.2159 26.09 20.7478 in (null):W-9999 (3) and C(47) at 31.194 27.187 19.403 in (null):S-9999 (5) other bump:2.23062 Ang CD2(26) at 26.9795 26.5675 21.5475 in (null):W-9999 (3) and OG(45) at 29.201 26.439 21.392 in (null):S-9999 (5) other bump:2.79106 Ang CE2(27) at 26.712 25.1804 21.4952 in (null):W-9999 (3) and OG(45) at 29.201 26.439 21.392 in (null):S-9999 (5) other bump:2.69911 Ang CZ2(30) at 27.684 24.2303 21.0671 in (null):W-9999 (3) and OG(45) at 29.201 26.439 21.392 in (null):S-9999 (5) other bump:1.12974 Ang CE3(28) at 28.2597 27.0221 21.168 in (null):W-9999 (3) and OG(45) at 29.201 26.439 21.392 in (null):S-9999 (5) other bump:0.73284 Ang CZ3(31) at 29.2159 26.09 20.7478 in (null):W-9999 (3) and OG(45) at 29.201 26.439 21.392 in (null):S-9999 (5) other bump:1.88751 Ang CH2(32) at 28.9225 24.7058 20.6983 in (null):W-9999 (3) and OG(45) at 29.201 26.439 21.392 in (null):S-9999 (5) other bump:1.89217 Ang CE3(28) at 28.2597 27.0221 21.168 in (null):W-9999 (3) and CB(44) at 30.025 27.584 21.553 in (null):S-9999 (5) other bump:1.88021 Ang CZ3(31) at 29.2159 26.09 20.7478 in (null):W-9999 (3) and CB(44) at 30.025 27.584 21.553 in (null):S-9999 (5) other bump:3.19843 Ang CH2(32) at 28.9225 24.7058 20.6983 in (null):W-9999 (3) and CB(44) at 30.025 27.584 21.553 in (null):S-9999 (5) other bump:2.56691 Ang CE3(28) at 28.2597 27.0221 21.168 in (null):W-9999 (3) and CA(43) at 30.326 28.169 20.166 in (null):S-9999 (5) other bump:2.4276 Ang CZ3(31) at 29.2159 26.09 20.7478 in (null):W-9999 (3) and CA(43) at 30.326 28.169 20.166 in (null):S-9999 (5) other bump:2.43424 Ang CE3(28) at 28.2597 27.0221 21.168 in (null):W-9999 (3) and N(42) at 29.096 28.626 19.539 in (null):S-9999 (5) other bump:2.81194 Ang CZ3(31) at 29.2159 26.09 20.7478 in (null):W-9999 (3) and N(42) at 29.096 28.626 19.539 in (null):S-9999 (5) T0159 117 :ELKPGKDVVWLQVPFSA 1kq3A 118 :TDAPCSALSVIYTPNGE Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 19 residues neighbor-bump: 2.92786 Ang CG1(104) at 29.3519 5.43152 27.154 in (null):V-9999 (13) and CD(112) at 26.528 5.214 26.412 in (null):P-9999 (14) other bump:3.16177 Ang CG1(59) at 30.8065 15.1227 12.1133 in (null):V-9999 (8) and NE1(78) at 32.3801 15.9586 14.7252 in (null):W-9999 (10) other bump:1.82765 Ang CD(6) at 31.3096 22.4784 19.6604 in (null):E-9999 (1) and NZ(25) at 31.1898 21.0513 18.5249 in (null):K-9999 (3) other bump:0.709776 Ang OE2(8) at 30.9426 21.6623 18.7883 in (null):E-9999 (1) and NZ(25) at 31.1898 21.0513 18.5249 in (null):K-9999 (3) other bump:1.96422 Ang OE2(8) at 30.9426 21.6623 18.7883 in (null):E-9999 (1) and CE(24) at 30.3166 20.0535 17.8512 in (null):K-9999 (3) Number of specific fragments= 6 total=204 Number of alignments=40 # Reading fragments from alignment file # T0159 read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1b16A/T0159-1b16A-2track-protein-EBGHSTL-local-adpstyle5.pw.a2m.gz # 1b16A read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1b16A/T0159-1b16A-2track-protein-EBGHSTL-local-adpstyle5.pw.a2m.gz # found chain 1b16A in template set T0159 48 :GDGKADLTGCNPGWGCEGAINHQLAAYELTNTVTHNQGNYAAMMADTI 1b16A 2 :DLTNKNVIFVAALGGIGLDTSRELVKRNLKNFVILDRVENPTALAELK Fragment has 23 clashes (null) has 23 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 50 residues other bump:2.53302 Ang CE1(148) at 12.6031 -12.9292 -13.0238 in (null):H-9999 (22) and OD1(330) at 12.5617 -14.57 -14.9531 in (null):D-9999 (46) other bump:2.80027 Ang CD1(287) at 10.4524 -20.0145 -8.36363 in (null):Y-9999 (40) and N(305) at 12.085 -19.654 -10.61 in (null):M-9999 (43) other bump:2.58076 Ang CE1(289) at 9.41251 -20.0567 -9.29941 in (null):Y-9999 (40) and CB(302) at 9.759 -21.524 -11.394 in (null):A-9999 (42) other bump:2.1619 Ang CG2(51) at 24.4655 -12.2441 -0.0954647 in (null):T-9999 (8) and NE2(251) at 24.2248 -14.3713 0.206193 in (null):H-9999 (35) other bump:2.50953 Ang CG2(51) at 24.4655 -12.2441 -0.0954647 in (null):T-9999 (8) and CD2(248) at 22.8704 -14.1563 0.216652 in (null):H-9999 (35) other bump:2.23524 Ang CG(76) at 17.4341 -13.8696 -3.36836 in (null):P-9999 (12) and CG2(240) at 18.2674 -15.8011 -4.12421 in (null):T-9999 (34) other bump:2.57666 Ang CD1(204) at 24.141 -9.164 -10.12 in (null):L-9999 (29) and OG1(227) at 24.0878 -11.7323 -9.92016 in (null):T-9999 (32) other bump:2.76257 Ang CA(19) at 31.361 -7.8 -13.401 in (null):K-9999 (4) and CG2(211) at 31.8376 -10.3483 -12.4467 in (null):T-9999 (30) other bump:2.70214 Ang C(26) at 31.413 -7.74 -11.883 in (null):K-9999 (4) and CG2(211) at 31.8376 -10.3483 -12.4467 in (null):T-9999 (30) other bump:2.51946 Ang O(25) at 32.402 -8.174 -11.306 in (null):K-9999 (4) and CG2(211) at 31.8376 -10.3483 -12.4467 in (null):T-9999 (30) other bump:2.3837 Ang CD1(44) at 26.1099 -7.64971 -8.27055 in (null):L-9999 (7) and CD2(205) at 25.812 -7.362 -10.618 in (null):L-9999 (29) other bump:2.84616 Ang O(159) at 19.249 -5.965 -14.221 in (null):Q-9999 (23) and CE2(186) at 19.8323 -3.17965 -14.1746 in (null):Y-9999 (27) other bump:2.55602 Ang O(159) at 19.249 -5.965 -14.221 in (null):Q-9999 (23) and CD2(184) at 20.9188 -4.03608 -14.0648 in (null):Y-9999 (27) other bump:2.44318 Ang O(119) at 13.31 -10.383 -10.264 in (null):G-9999 (18) and CD2(146) at 12.1936 -10.872 -12.3814 in (null):H-9999 (22) other bump:3.14142 Ang C(120) at 12.52 -10.243 -9.321 in (null):G-9999 (18) and CD2(146) at 12.1936 -10.872 -12.3814 in (null):H-9999 (22) other bump:2.92762 Ang C(72) at 15.086 -11.892 -1.509 in (null):N-9999 (11) and CD(112) at 14.6265 -9.0991 -2.25703 in (null):E-9999 (17) other bump:2.05159 Ang O(71) at 14.232 -11.07 -1.846 in (null):N-9999 (11) and CD(112) at 14.6265 -9.0991 -2.25703 in (null):E-9999 (17) other bump:2.70422 Ang C(72) at 15.086 -11.892 -1.509 in (null):N-9999 (11) and CG(111) at 13.4648 -10.0036 -2.56648 in (null):E-9999 (17) other bump:1.49833 Ang O(71) at 14.232 -11.07 -1.846 in (null):N-9999 (11) and CG(111) at 13.4648 -10.0036 -2.56648 in (null):E-9999 (17) other bump:2.74357 Ang C(79) at 14.622 -12.706 -4.567 in (null):P-9999 (12) and CB(110) at 13.2922 -10.3667 -4.03146 in (null):E-9999 (17) other bump:2.48071 Ang O(71) at 14.232 -11.07 -1.846 in (null):N-9999 (11) and CB(110) at 13.2922 -10.3667 -4.03146 in (null):E-9999 (17) other bump:3.09025 Ang CA(74) at 15.823 -12.129 -3.833 in (null):P-9999 (12) and CB(110) at 13.2922 -10.3667 -4.03146 in (null):E-9999 (17) neighbor-bump: 2.47038 Ang N(65) at 16.651 -12.535 0.28 in (null):N-9999 (11) and CD(77) at 17.0305 -13.2992 -2.03835 in (null):P-9999 (12) T0159 97 :RYKEGKPVFYYTWT 1b16A 50 :AINPKVNITFHTYD Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 16 residues Number of specific fragments= 2 total=206 Number of alignments=41 # Reading fragments from alignment file # T0159 read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1b16A/T0159-1b16A-2track-protein-EBGHSTL-local-adpstyle1.pw.a2m.gz # 1b16A read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1b16A/T0159-1b16A-2track-protein-EBGHSTL-local-adpstyle1.pw.a2m.gz # found chain 1b16A in template set T0159 48 :GDGKADLTGCNPGWGCEGAINHQLAAYELTNTVTHNQGNYAAMMADT 1b16A 2 :DLTNKNVIFVAALGGIGLDTSRELVKRNLKNFVILDRVENPTALAEL Fragment has 23 clashes (null) has 23 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 49 residues other bump:2.53302 Ang CE1(148) at 12.6031 -12.9292 -13.0238 in (null):H-9999 (22) and OD1(330) at 12.5617 -14.57 -14.9531 in (null):D-9999 (46) other bump:2.80027 Ang CD1(287) at 10.4524 -20.0145 -8.36363 in (null):Y-9999 (40) and N(305) at 12.085 -19.654 -10.61 in (null):M-9999 (43) other bump:2.58076 Ang CE1(289) at 9.41251 -20.0567 -9.29941 in (null):Y-9999 (40) and CB(302) at 9.759 -21.524 -11.394 in (null):A-9999 (42) other bump:2.1619 Ang CG2(51) at 24.4655 -12.2441 -0.0954647 in (null):T-9999 (8) and NE2(251) at 24.2248 -14.3713 0.206193 in (null):H-9999 (35) other bump:2.50953 Ang CG2(51) at 24.4655 -12.2441 -0.0954647 in (null):T-9999 (8) and CD2(248) at 22.8704 -14.1563 0.216652 in (null):H-9999 (35) other bump:2.23524 Ang CG(76) at 17.4341 -13.8696 -3.36836 in (null):P-9999 (12) and CG2(240) at 18.2674 -15.8011 -4.12421 in (null):T-9999 (34) other bump:2.57666 Ang CD1(204) at 24.141 -9.164 -10.12 in (null):L-9999 (29) and OG1(227) at 24.0878 -11.7323 -9.92016 in (null):T-9999 (32) other bump:2.76257 Ang CA(19) at 31.361 -7.8 -13.401 in (null):K-9999 (4) and CG2(211) at 31.8376 -10.3483 -12.4467 in (null):T-9999 (30) other bump:2.70214 Ang C(26) at 31.413 -7.74 -11.883 in (null):K-9999 (4) and CG2(211) at 31.8376 -10.3483 -12.4467 in (null):T-9999 (30) other bump:2.51946 Ang O(25) at 32.402 -8.174 -11.306 in (null):K-9999 (4) and CG2(211) at 31.8376 -10.3483 -12.4467 in (null):T-9999 (30) other bump:2.3837 Ang CD1(44) at 26.1099 -7.64971 -8.27055 in (null):L-9999 (7) and CD2(205) at 25.812 -7.362 -10.618 in (null):L-9999 (29) other bump:2.84616 Ang O(159) at 19.249 -5.965 -14.221 in (null):Q-9999 (23) and CE2(186) at 19.8323 -3.17965 -14.1746 in (null):Y-9999 (27) other bump:2.55602 Ang O(159) at 19.249 -5.965 -14.221 in (null):Q-9999 (23) and CD2(184) at 20.9188 -4.03608 -14.0648 in (null):Y-9999 (27) other bump:2.44318 Ang O(119) at 13.31 -10.383 -10.264 in (null):G-9999 (18) and CD2(146) at 12.1936 -10.872 -12.3814 in (null):H-9999 (22) other bump:3.14142 Ang C(120) at 12.52 -10.243 -9.321 in (null):G-9999 (18) and CD2(146) at 12.1936 -10.872 -12.3814 in (null):H-9999 (22) other bump:2.92762 Ang C(72) at 15.086 -11.892 -1.509 in (null):N-9999 (11) and CD(112) at 14.6265 -9.0991 -2.25703 in (null):E-9999 (17) other bump:2.05159 Ang O(71) at 14.232 -11.07 -1.846 in (null):N-9999 (11) and CD(112) at 14.6265 -9.0991 -2.25703 in (null):E-9999 (17) other bump:2.70422 Ang C(72) at 15.086 -11.892 -1.509 in (null):N-9999 (11) and CG(111) at 13.4648 -10.0036 -2.56648 in (null):E-9999 (17) other bump:1.49833 Ang O(71) at 14.232 -11.07 -1.846 in (null):N-9999 (11) and CG(111) at 13.4648 -10.0036 -2.56648 in (null):E-9999 (17) other bump:2.74357 Ang C(79) at 14.622 -12.706 -4.567 in (null):P-9999 (12) and CB(110) at 13.2922 -10.3667 -4.03146 in (null):E-9999 (17) other bump:2.48071 Ang O(71) at 14.232 -11.07 -1.846 in (null):N-9999 (11) and CB(110) at 13.2922 -10.3667 -4.03146 in (null):E-9999 (17) other bump:3.09025 Ang CA(74) at 15.823 -12.129 -3.833 in (null):P-9999 (12) and CB(110) at 13.2922 -10.3667 -4.03146 in (null):E-9999 (17) neighbor-bump: 2.47038 Ang N(65) at 16.651 -12.535 0.28 in (null):N-9999 (11) and CD(77) at 17.0305 -13.2992 -2.03835 in (null):P-9999 (12) T0159 96 :SRYKEGKPVFYYTW 1b16A 49 :KAINPKVNITFHTY Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 16 residues Number of specific fragments= 2 total=208 Number of alignments=42 # Reading fragments from alignment file # T0159 read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1cl2A/1cl2A-T0159-fssp-global-adpstyle1.pw.a2m.gz # 1cl2A read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1cl2A/1cl2A-T0159-fssp-global-adpstyle1.pw.a2m.gz # found chain 1cl2A in template set T0159 4 :YREGVFVNGAAQGYLIDKKTA 1cl2A 77 :GAGCVLFPCGAAAVANSILAF Fragment has 12 clashes (null) has 12 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 23 residues other bump:1.46466 Ang ND2(67) at -2.28176 10.0753 39.3784 in (null):N-9999 (8) and NE2(91) at -2.40337 8.61792 39.2981 in (null):Q-9999 (12) other bump:2.4664 Ang CG(66) at -1.82229 10.716 40.4571 in (null):N-9999 (8) and NE2(91) at -2.40337 8.61792 39.2981 in (null):Q-9999 (12) other bump:1.7031 Ang ND2(67) at -2.28176 10.0753 39.3784 in (null):N-9999 (8) and OE1(90) at -1.47268 9.91634 40.8686 in (null):Q-9999 (12) other bump:0.948674 Ang OD1(68) at -1.96943 10.2694 41.5956 in (null):N-9999 (8) and OE1(90) at -1.47268 9.91634 40.8686 in (null):Q-9999 (12) other bump:2.23404 Ang CB(65) at -1.07838 12.0219 40.2344 in (null):N-9999 (8) and OE1(90) at -1.47268 9.91634 40.8686 in (null):Q-9999 (12) other bump:0.964913 Ang CG(66) at -1.82229 10.716 40.4571 in (null):N-9999 (8) and OE1(90) at -1.47268 9.91634 40.8686 in (null):Q-9999 (12) other bump:2.71829 Ang CA(64) at -0.136 12.244 41.298 in (null):N-9999 (8) and OE1(90) at -1.47268 9.91634 40.8686 in (null):Q-9999 (12) other bump:1.71005 Ang ND2(67) at -2.28176 10.0753 39.3784 in (null):N-9999 (8) and CD(89) at -1.9793 8.85009 40.5324 in (null):Q-9999 (12) other bump:1.77343 Ang OD1(68) at -1.96943 10.2694 41.5956 in (null):N-9999 (8) and CD(89) at -1.9793 8.85009 40.5324 in (null):Q-9999 (12) other bump:1.87406 Ang CG(66) at -1.82229 10.716 40.4571 in (null):N-9999 (8) and CD(89) at -1.9793 8.85009 40.5324 in (null):Q-9999 (12) other bump:2.5507 Ang OD1(68) at -1.96943 10.2694 41.5956 in (null):N-9999 (8) and CG(88) at -2.15725 7.72658 41.5262 in (null):Q-9999 (12) other bump:2.65305 Ang CG2(60) at 2.08647 9.75073 44.6727 in (null):V-9999 (7) and O(73) at -0.494 9.665 45.283 in (null):G-9999 (9) T0159 25 :DQYKITNIAQLKDPKIA 1cl2A 102 :DHVLMTNTAYEPSQDFC Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 19 residues T0159 42 :KLFDT 1cl2A 120 :KILSK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 7 residues T0159 48 :GDGKADLTGCNPGWGCEGAI 1cl2A 125 :LGVTTSWFDPLIGADIVKHL Fragment has 9 clashes (null) has 9 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 22 residues other bump:2.15137 Ang O(82) at 2.945 -7.952 66.188 in (null):G-9999 (13) and SG(105) at 2.19962 -7.91287 64.1703 in (null):C-9999 (16) other bump:2.5396 Ang C(58) at -4.282 -5.354 63.94 in (null):G-9999 (9) and CD(77) at -2.53972 -5.70402 65.7542 in (null):P-9999 (12) other bump:1.66188 Ang O(57) at -3.152 -5.777 64.211 in (null):G-9999 (9) and CD(77) at -2.53972 -5.70402 65.7542 in (null):P-9999 (12) other bump:3.28581 Ang CA(60) at -3.613 -2.975 64.272 in (null):C-9999 (10) and CD(77) at -2.53972 -5.70402 65.7542 in (null):P-9999 (12) other bump:2.56244 Ang C(64) at -2.789 -3.163 65.537 in (null):C-9999 (10) and CD(77) at -2.53972 -5.70402 65.7542 in (null):P-9999 (12) neighbor-bump: 2.30872 Ang N(65) at -3.428 -3.73 66.557 in (null):N-9999 (11) and CD(77) at -2.53972 -5.70402 65.7542 in (null):P-9999 (12) other bump:3.20044 Ang CA(56) at -5.43 -6.319 63.629 in (null):G-9999 (9) and CG(76) at -2.63622 -7.02828 65.0199 in (null):P-9999 (12) other bump:2.58417 Ang C(58) at -4.282 -5.354 63.94 in (null):G-9999 (9) and CG(76) at -2.63622 -7.02828 65.0199 in (null):P-9999 (12) other bump:1.57671 Ang O(57) at -3.152 -5.777 64.211 in (null):G-9999 (9) and CG(76) at -2.63622 -7.02828 65.0199 in (null):P-9999 (12) T0159 68 :NHQLAAYELTNTV 1cl2A 147 :NTKIVFLESPGSI Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues other bump:2.30095 Ang OE2(65) at -4.682 5.043 56.93 in (null):E-9999 (8) and OG1(95) at -6.97451 5.00179 56.7375 in (null):T-9999 (12) neighbor-bump: 2.87967 Ang CG2(79) at -4.39491 4.24879 63.9993 in (null):T-9999 (10) and CA(84) at -5.285 3.81 61.296 in (null):N-9999 (11) neighbor-bump: 2.39155 Ang CB(78) at -3.34503 5.31538 64.2426 in (null):T-9999 (10) and N(83) at -4.486 4.397 62.352 in (null):N-9999 (11) neighbor-bump: 1.65643 Ang CG2(79) at -4.39491 4.24879 63.9993 in (null):T-9999 (10) and N(83) at -4.486 4.397 62.352 in (null):N-9999 (11) self-bump: 2.18122 Ang CB(78) at -3.34503 5.31538 64.2426 in (null):T-9999 (10) and C(82) at -3.56 5.307 62.072 in (null):T-9999 (10) self-bump: 2.35187 Ang CG2(79) at -4.39491 4.24879 63.9993 in (null):T-9999 (10) and C(82) at -3.56 5.307 62.072 in (null):T-9999 (10) self-bump: 1.27276 Ang CA(77) at -2.795 5.883 63.245 in (null):T-9999 (10) and CB(78) at -3.34503 5.31538 64.2426 in (null):T-9999 (10) T0159 82 :HNQGNYAAMMADTISRYKEGKPVFYYT 1cl2A 160 :TMEVHDVPAIVAAVRSVVPDAIIMIDN Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 29 residues other bump:2.14807 Ang CD2(197) at 3.78137 5.00925 58.6992 in (null):Y-9999 (25) and CG2(219) at 4.87685 6.65998 57.869 in (null):T-9999 (27) other bump:2.76726 Ang CE2(199) at 3.09566 5.64783 59.7293 in (null):Y-9999 (25) and CG2(219) at 4.87685 6.65998 57.869 in (null):T-9999 (27) other bump:2.32881 Ang CD1(104) at 8.86783 -6.4559 58.4198 in (null):I-9999 (14) and CG1(177) at 8.678 -4.609 57.014 in (null):V-9999 (23) other bump:2.96558 Ang CE(141) at 6.31075 -14.4 54.9072 in (null):K-9999 (18) and NZ(164) at 8.02902 -12.8021 53.0937 in (null):K-9999 (21) other bump:2.03291 Ang CD(140) at 7.71275 -13.8198 54.8249 in (null):K-9999 (18) and NZ(164) at 8.02902 -12.8021 53.0937 in (null):K-9999 (21) other bump:3.0843 Ang CB(138) at 9.2131 -12.3832 56.2341 in (null):K-9999 (18) and CG(161) at 8.30807 -10.0966 54.3726 in (null):K-9999 (21) other bump:2.51349 Ang CB(4) at -11.0499 3.20054 64.094 in (null):H-9999 (1) and NE2(26) at -9.35489 1.99399 65.5042 in (null):Q-9999 (3) T0159 109 :WT 1cl2A 188 :WA Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues neighbor-bump: 3.16886 Ang CE3(9) at -0.655 11.189 63.457 in (null):W-9999 (1) and CG2(19) at 2.36179 10.5342 62.7416 in (null):T-9999 (2) T0159 111 :PYWVS 1cl2A 191 :GVLFK Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 7 residues neighbor-bump: 0.731871 Ang C(1) at 4.609 13.903 57.777 in (null):G-9999 (0) and CD(6) at 4.97481 13.9015 57.1431 in (null):P-9999 (1) neighbor-bump: 1.0345 Ang O(0) at 5.438 14.768 57.467 in (null):G-9999 (0) and CD(6) at 4.97481 13.9015 57.1431 in (null):P-9999 (1) neighbor-bump: 2.15046 Ang C(1) at 4.609 13.903 57.777 in (null):G-9999 (0) and CG(5) at 5.36534 13.1105 55.9265 in (null):P-9999 (1) self-bump: 2.17621 Ang N(2) at 4.937 12.633 58.006 in (null):P-9999 (1) and CG(5) at 5.36534 13.1105 55.9265 in (null):P-9999 (1) neighbor-bump: 2.26401 Ang O(0) at 5.438 14.768 57.467 in (null):G-9999 (0) and CG(5) at 5.36534 13.1105 55.9265 in (null):P-9999 (1) T0159 117 :ELKPG 1cl2A 196 :ALDFG Fragment has 8 clashes (null) has 8 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 7 residues other bump:3.17821 Ang C(10) at 10.558 5.036 59.626 in (null):E-9999 (1) and CD(32) at 12.2096 4.69445 62.3198 in (null):P-9999 (4) neighbor-bump: 2.17413 Ang N(19) at 13.467 5.518 60.749 in (null):K-9999 (3) and CD(32) at 12.2096 4.69445 62.3198 in (null):P-9999 (4) neighbor-bump: 2.22843 Ang CA(20) at 14.318 5.284 61.904 in (null):K-9999 (3) and CD(32) at 12.2096 4.69445 62.3198 in (null):P-9999 (4) neighbor-bump: 2.66991 Ang CB(21) at 14.0427 6.58624 62.7549 in (null):K-9999 (3) and CD(32) at 12.2096 4.69445 62.3198 in (null):P-9999 (4) neighbor-bump: 1.84578 Ang C(27) at 13.897 4.034 62.671 in (null):K-9999 (3) and CD(32) at 12.2096 4.69445 62.3198 in (null):P-9999 (4) self-bump: 1.28418 Ang N(28) at 12.706 3.512 62.387 in (null):P-9999 (4) and CD(32) at 12.2096 4.69445 62.3198 in (null):P-9999 (4) other bump:2.3982 Ang O(0) at 11.207 6.795 61.742 in (null):G-9999 (0) and CD(32) at 12.2096 4.69445 62.3198 in (null):P-9999 (4) self-bump: 2.14371 Ang N(28) at 12.706 3.512 62.387 in (null):P-9999 (4) and CG(31) at 10.9486 4.48383 63.137 in (null):P-9999 (4) T0159 122 :KDVVWLQVPFSALPGDKNADTKLPNG 1cl2A 210 :KYLVGHSDAMIGTAVCNARCWEQLRE Fragment has 61 clashes (null) has 61 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:1.72472 Ang O(155) at 13.557 0.742 46.252 in (null):D-9999 (20) and CD(185) at 12.4348 0.755435 44.9424 in (null):P-9999 (24) other bump:2.9474 Ang C(156) at 14.309 0.908 47.212 in (null):D-9999 (20) and CD(185) at 12.4348 0.755435 44.9424 in (null):P-9999 (24) other bump:2.39353 Ang O(155) at 13.557 0.742 46.252 in (null):D-9999 (20) and CG(184) at 11.2535 1.19592 45.7866 in (null):P-9999 (24) other bump:2.60195 Ang CB(121) at 12.9712 4.45507 49.1419 in (null):D-9999 (16) and CG2(160) at 15.2905 4.92223 48.059 in (null):T-9999 (21) other bump:2.85794 Ang CG(122) at 13.4525 3.01412 49.1307 in (null):D-9999 (16) and CG2(160) at 15.2905 4.92223 48.059 in (null):T-9999 (21) other bump:2.37194 Ang OD2(124) at 14.5163 2.73088 48.533 in (null):D-9999 (16) and CG2(160) at 15.2905 4.92223 48.059 in (null):T-9999 (21) other bump:2.6948 Ang OD2(124) at 14.5163 2.73088 48.533 in (null):D-9999 (16) and CB(159) at 15.6642 4.347 46.7074 in (null):T-9999 (21) other bump:3.0672 Ang CG(122) at 13.4525 3.01412 49.1307 in (null):D-9999 (16) and CA(158) at 14.915 3.101 46.436 in (null):T-9999 (21) other bump:2.16638 Ang OD2(124) at 14.5163 2.73088 48.533 in (null):D-9999 (16) and CA(158) at 14.915 3.101 46.436 in (null):T-9999 (21) other bump:2.56241 Ang CG(122) at 13.4525 3.01412 49.1307 in (null):D-9999 (16) and N(157) at 15.025 2.007 47.376 in (null):T-9999 (21) other bump:1.45648 Ang OD2(124) at 14.5163 2.73088 48.533 in (null):D-9999 (16) and N(157) at 15.025 2.007 47.376 in (null):T-9999 (21) other bump:2.97501 Ang CG(122) at 13.4525 3.01412 49.1307 in (null):D-9999 (16) and C(156) at 14.309 0.908 47.212 in (null):D-9999 (20) other bump:2.26071 Ang OD2(124) at 14.5163 2.73088 48.533 in (null):D-9999 (16) and C(156) at 14.309 0.908 47.212 in (null):D-9999 (20) other bump:2.21961 Ang OD1(123) at 12.7618 2.16232 49.7254 in (null):D-9999 (16) and CB(151) at 13.1734 0.0101676 49.3712 in (null):D-9999 (20) neighbor-bump: 2.22732 Ang OD2(124) at 14.5163 2.73088 48.533 in (null):D-9999 (16) and O(134) at 16.122 2.976 50.057 in (null):K-9999 (17) neighbor-bump: 1.83577 Ang C(107) at 5.784 9.494 48.66 in (null):L-9999 (13) and CD(112) at 6.16243 8.62797 47.0862 in (null):P-9999 (14) neighbor-bump: 2.5815 Ang C(107) at 5.784 9.494 48.66 in (null):L-9999 (13) and CG(111) at 5.7049 7.23453 47.4139 in (null):P-9999 (14) neighbor-bump: 2.49701 Ang N(64) at -5.801 22.263 48.104 in (null):V-9999 (8) and CD(75) at -3.63002 22.1446 46.876 in (null):P-9999 (9) neighbor-bump: 2.28469 Ang CA(65) at -5.844 22.682 46.705 in (null):V-9999 (8) and CD(75) at -3.63002 22.1446 46.876 in (null):P-9999 (9) neighbor-bump: 2.38506 Ang O(69) at -4.515 22.616 44.712 in (null):V-9999 (8) and CD(75) at -3.63002 22.1446 46.876 in (null):P-9999 (9) other bump:3.22053 Ang CG1(29) at -1.611 21.564 49.317 in (null):V-9999 (4) and CD(75) at -3.63002 22.1446 46.876 in (null):P-9999 (9) neighbor-bump: 1.6123 Ang C(70) at -4.805 22.063 45.775 in (null):V-9999 (8) and CD(75) at -3.63002 22.1446 46.876 in (null):P-9999 (9) neighbor-bump: 2.54312 Ang C(70) at -4.805 22.063 45.775 in (null):V-9999 (8) and CG(74) at -2.30714 22.3116 46.1829 in (null):P-9999 (9) neighbor-bump: 2.68129 Ang C(54) at -5.592 23.594 51.104 in (null):L-9999 (6) and CB(57) at -7.95751 22.3401 51.2504 in (null):Q-9999 (7) other bump:3.15992 Ang CG(14) at -1.07479 17.2592 58.0812 in (null):D-9999 (2) and CH2(44) at 1.62089 18.518 57.0163 in (null):W-9999 (5) other bump:1.8758 Ang CB(13) at 0.00372958 17.5683 57.0568 in (null):D-9999 (2) and CH2(44) at 1.62089 18.518 57.0163 in (null):W-9999 (5) other bump:2.97677 Ang N(19) at 1.251 18.357 54.067 in (null):V-9999 (3) and CH2(44) at 1.62089 18.518 57.0163 in (null):W-9999 (5) other bump:2.52065 Ang CA(12) at -0.545 18.365 55.736 in (null):D-9999 (2) and CH2(44) at 1.62089 18.518 57.0163 in (null):W-9999 (5) other bump:2.35652 Ang O(17) at 0.999 20.139 55.423 in (null):D-9999 (2) and CH2(44) at 1.62089 18.518 57.0163 in (null):W-9999 (5) other bump:2.26122 Ang C(18) at 0.633 19.023 55.046 in (null):D-9999 (2) and CH2(44) at 1.62089 18.518 57.0163 in (null):W-9999 (5) other bump:2.80486 Ang N(11) at -1.31 17.346 55.031 in (null):D-9999 (2) and CZ3(43) at 0.23789 18.7365 56.9119 in (null):W-9999 (5) other bump:2.29631 Ang CG(14) at -1.07479 17.2592 58.0812 in (null):D-9999 (2) and CZ3(43) at 0.23789 18.7365 56.9119 in (null):W-9999 (5) other bump:1.20025 Ang CB(13) at 0.00372958 17.5683 57.0568 in (null):D-9999 (2) and CZ3(43) at 0.23789 18.7365 56.9119 in (null):W-9999 (5) other bump:3.18976 Ang OD2(16) at -0.739017 16.6494 59.1173 in (null):D-9999 (2) and CZ3(43) at 0.23789 18.7365 56.9119 in (null):W-9999 (5) other bump:3.04363 Ang N(19) at 1.251 18.357 54.067 in (null):V-9999 (3) and CZ3(43) at 0.23789 18.7365 56.9119 in (null):W-9999 (5) other bump:1.46069 Ang CA(12) at -0.545 18.365 55.736 in (null):D-9999 (2) and CZ3(43) at 0.23789 18.7365 56.9119 in (null):W-9999 (5) other bump:2.1824 Ang O(17) at 0.999 20.139 55.423 in (null):D-9999 (2) and CZ3(43) at 0.23789 18.7365 56.9119 in (null):W-9999 (5) other bump:1.92862 Ang C(18) at 0.633 19.023 55.046 in (null):D-9999 (2) and CZ3(43) at 0.23789 18.7365 56.9119 in (null):W-9999 (5) other bump:3.18344 Ang CB(13) at 0.00372958 17.5683 57.0568 in (null):D-9999 (2) and CZ2(42) at 2.50491 19.4744 56.5615 in (null):W-9999 (5) other bump:3.00719 Ang N(19) at 1.251 18.357 54.067 in (null):V-9999 (3) and CZ2(42) at 2.50491 19.4744 56.5615 in (null):W-9999 (5) other bump:3.19199 Ang CA(20) at 2.399 18.985 53.409 in (null):V-9999 (3) and CZ2(42) at 2.50491 19.4744 56.5615 in (null):W-9999 (5) other bump:2.0014 Ang O(17) at 0.999 20.139 55.423 in (null):D-9999 (2) and CZ2(42) at 2.50491 19.4744 56.5615 in (null):W-9999 (5) other bump:2.45039 Ang C(18) at 0.633 19.023 55.046 in (null):D-9999 (2) and CZ2(42) at 2.50491 19.4744 56.5615 in (null):W-9999 (5) other bump:2.24665 Ang O(17) at 0.999 20.139 55.423 in (null):D-9999 (2) and NE1(41) at 2.61659 21.6979 55.3989 in (null):W-9999 (5) other bump:2.98903 Ang N(11) at -1.31 17.346 55.031 in (null):D-9999 (2) and CE3(40) at -0.301971 19.8453 56.3239 in (null):W-9999 (5) other bump:3.22082 Ang CG(14) at -1.07479 17.2592 58.0812 in (null):D-9999 (2) and CE3(40) at -0.301971 19.8453 56.3239 in (null):W-9999 (5) other bump:2.41154 Ang CB(13) at 0.00372958 17.5683 57.0568 in (null):D-9999 (2) and CE3(40) at -0.301971 19.8453 56.3239 in (null):W-9999 (5) other bump:3.11774 Ang N(19) at 1.251 18.357 54.067 in (null):V-9999 (3) and CE3(40) at -0.301971 19.8453 56.3239 in (null):W-9999 (5) other bump:1.61123 Ang CA(12) at -0.545 18.365 55.736 in (null):D-9999 (2) and CE3(40) at -0.301971 19.8453 56.3239 in (null):W-9999 (5) other bump:1.60944 Ang O(17) at 0.999 20.139 55.423 in (null):D-9999 (2) and CE3(40) at -0.301971 19.8453 56.3239 in (null):W-9999 (5) other bump:1.78419 Ang C(18) at 0.633 19.023 55.046 in (null):D-9999 (2) and CE3(40) at -0.301971 19.8453 56.3239 in (null):W-9999 (5) other bump:3.02353 Ang N(19) at 1.251 18.357 54.067 in (null):V-9999 (3) and CE2(39) at 1.97377 20.6009 55.9602 in (null):W-9999 (5) other bump:3.04968 Ang CA(20) at 2.399 18.985 53.409 in (null):V-9999 (3) and CE2(39) at 1.97377 20.6009 55.9602 in (null):W-9999 (5) other bump:1.20503 Ang O(17) at 0.999 20.139 55.423 in (null):D-9999 (2) and CE2(39) at 1.97377 20.6009 55.9602 in (null):W-9999 (5) other bump:2.26346 Ang C(18) at 0.633 19.023 55.046 in (null):D-9999 (2) and CE2(39) at 1.97377 20.6009 55.9602 in (null):W-9999 (5) other bump:2.72108 Ang CA(12) at -0.545 18.365 55.736 in (null):D-9999 (2) and CD2(38) at 0.588074 20.8354 55.8689 in (null):W-9999 (5) other bump:0.923396 Ang O(17) at 0.999 20.139 55.423 in (null):D-9999 (2) and CD2(38) at 0.588074 20.8354 55.8689 in (null):W-9999 (5) other bump:1.99097 Ang C(18) at 0.633 19.023 55.046 in (null):D-9999 (2) and CD2(38) at 0.588074 20.8354 55.8689 in (null):W-9999 (5) other bump:2.5551 Ang O(17) at 0.999 20.139 55.423 in (null):D-9999 (2) and CD1(37) at 1.65012 22.5707 54.9857 in (null):W-9999 (5) other bump:2.05477 Ang O(17) at 0.999 20.139 55.423 in (null):D-9999 (2) and CG(36) at 0.394959 22.0941 55.2369 in (null):W-9999 (5) other bump:3.08626 Ang C(18) at 0.633 19.023 55.046 in (null):D-9999 (2) and CG(36) at 0.394959 22.0941 55.2369 in (null):W-9999 (5) T0159 148 :ANYG 1cl2A 347 :ILAN Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 5 residues Number of specific fragments= 11 total=219 Number of alignments=43 # Reading fragments from alignment file # T0159 read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1cl2A/1cl2A-T0159-fssp-global-adpstyle5.pw.a2m.gz # 1cl2A read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1cl2A/1cl2A-T0159-fssp-global-adpstyle5.pw.a2m.gz # found chain 1cl2A in template set T0159 36 :KDPKIAKLFDTNGDGKADL 1cl2A 100 :QGDHVLMTNTAYEPSQDFC Fragment has 15 clashes (null) has 15 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 21 residues other bump:2.68035 Ang CG1(38) at -1.05687 -7.66695 49.8095 in (null):I-9999 (5) and CD1(141) at -3.4793 -6.5512 50.0764 in (null):L-9999 (19) other bump:2.30963 Ang CD1(40) at -1.34285 -6.28077 49.2416 in (null):I-9999 (5) and CD1(141) at -3.4793 -6.5512 50.0764 in (null):L-9999 (19) other bump:2.91568 Ang CG(51) at -2.79202 -3.16391 54.1916 in (null):K-9999 (7) and CG2(87) at -4.06951 -0.998666 55.6684 in (null):T-9999 (11) other bump:2.88668 Ang CE(53) at -3.06992 -1.03699 52.9606 in (null):K-9999 (7) and CG2(87) at -4.06951 -0.998666 55.6684 in (null):T-9999 (11) other bump:1.57463 Ang CG(60) at -3.75608 -1.60163 60.0533 in (null):L-9999 (8) and OD1(80) at -4.79658 -0.425874 60.1734 in (null):D-9999 (10) other bump:2.53801 Ang CD1(61) at -3.70032 -2.39128 61.3468 in (null):L-9999 (8) and OD1(80) at -4.79658 -0.425874 60.1734 in (null):D-9999 (10) other bump:1.56597 Ang CD2(62) at -3.25386 -0.175946 60.2725 in (null):L-9999 (8) and OD1(80) at -4.79658 -0.425874 60.1734 in (null):D-9999 (10) other bump:2.62944 Ang CG(60) at -3.75608 -1.60163 60.0533 in (null):L-9999 (8) and CG(79) at -5.53645 0.0642512 61.0378 in (null):D-9999 (10) other bump:2.41941 Ang CD2(62) at -3.25386 -0.175946 60.2725 in (null):L-9999 (8) and CG(79) at -5.53645 0.0642512 61.0378 in (null):D-9999 (10) other bump:2.63102 Ang C(10) at 3.144 -14.37 41.822 in (null):K-9999 (1) and CD(23) at 3.28467 -12.9485 44.0315 in (null):P-9999 (3) neighbor-bump: 2.47015 Ang N(11) at 2.247 -14.765 42.718 in (null):D-9999 (2) and CD(23) at 3.28467 -12.9485 44.0315 in (null):P-9999 (3) other bump:1.50555 Ang O(0) at 3.711 -11.96 42.979 in (null):G-9999 (0) and CD(23) at 3.28467 -12.9485 44.0315 in (null):P-9999 (3) other bump:2.65979 Ang C(1) at 4.129 -11.707 41.836 in (null):G-9999 (0) and CD(23) at 3.28467 -12.9485 44.0315 in (null):P-9999 (3) other bump:1.67986 Ang O(0) at 3.711 -11.96 42.979 in (null):G-9999 (0) and CG(22) at 4.30024 -11.9242 44.5517 in (null):P-9999 (3) other bump:2.72977 Ang C(1) at 4.129 -11.707 41.836 in (null):G-9999 (0) and CG(22) at 4.30024 -11.9242 44.5517 in (null):P-9999 (3) T0159 55 :TG 1cl2A 122 :LS Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues T0159 57 :CNPGW 1cl2A 127 :VTTSW Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 7 residues neighbor-bump: 1.99881 Ang C(15) at -2.84 -11.761 48.725 in (null):N-9999 (2) and CD(20) at -4.36844 -10.6017 48.1636 in (null):P-9999 (3) T0159 62 :GCEGA 1cl2A 139 :DIVKH Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 7 residues T0159 67 :INHQLAAYELTNTV 1cl2A 146 :PNTKIVFLESPGSI Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 16 residues other bump:2.30095 Ang OE2(73) at -4.682 5.043 56.93 in (null):E-9999 (9) and OG1(103) at -6.97451 5.00179 56.7375 in (null):T-9999 (13) neighbor-bump: 2.87967 Ang CG2(87) at -4.39491 4.24879 63.9993 in (null):T-9999 (11) and CA(92) at -5.285 3.81 61.296 in (null):N-9999 (12) neighbor-bump: 2.39155 Ang CB(86) at -3.34503 5.31538 64.2426 in (null):T-9999 (11) and N(91) at -4.486 4.397 62.352 in (null):N-9999 (12) neighbor-bump: 1.65643 Ang CG2(87) at -4.39491 4.24879 63.9993 in (null):T-9999 (11) and N(91) at -4.486 4.397 62.352 in (null):N-9999 (12) self-bump: 2.18122 Ang CB(86) at -3.34503 5.31538 64.2426 in (null):T-9999 (11) and C(90) at -3.56 5.307 62.072 in (null):T-9999 (11) self-bump: 2.35187 Ang CG2(87) at -4.39491 4.24879 63.9993 in (null):T-9999 (11) and C(90) at -3.56 5.307 62.072 in (null):T-9999 (11) self-bump: 1.27276 Ang CA(85) at -2.795 5.883 63.245 in (null):T-9999 (11) and CB(86) at -3.34503 5.31538 64.2426 in (null):T-9999 (11) T0159 81 :THNQ 1cl2A 161 :MEVH Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 6 residues T0159 87 :YAAMMADTISRYKEGKPVFYYT 1cl2A 165 :DVPAIVAAVRSVVPDAIIMIDN Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 24 residues other bump:2.14807 Ang CD2(158) at 3.78137 5.00925 58.6992 in (null):Y-9999 (20) and CG2(180) at 4.87685 6.65998 57.869 in (null):T-9999 (22) other bump:2.76726 Ang CE2(160) at 3.09566 5.64783 59.7293 in (null):Y-9999 (20) and CG2(180) at 4.87685 6.65998 57.869 in (null):T-9999 (22) other bump:2.32881 Ang CD1(65) at 8.86783 -6.4559 58.4198 in (null):I-9999 (9) and CG1(138) at 8.678 -4.609 57.014 in (null):V-9999 (18) other bump:2.96558 Ang CE(102) at 6.31075 -14.4 54.9072 in (null):K-9999 (13) and NZ(125) at 8.02902 -12.8021 53.0937 in (null):K-9999 (16) other bump:2.03291 Ang CD(101) at 7.71275 -13.8198 54.8249 in (null):K-9999 (13) and NZ(125) at 8.02902 -12.8021 53.0937 in (null):K-9999 (16) other bump:3.0843 Ang CB(99) at 9.2131 -12.3832 56.2341 in (null):K-9999 (13) and CG(122) at 8.30807 -10.0966 54.3726 in (null):K-9999 (16) T0159 109 :WT 1cl2A 188 :WA Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues neighbor-bump: 3.16886 Ang CE3(9) at -0.655 11.189 63.457 in (null):W-9999 (1) and CG2(19) at 2.36179 10.5342 62.7416 in (null):T-9999 (2) T0159 111 :PYWVS 1cl2A 191 :GVLFK Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 7 residues neighbor-bump: 0.731871 Ang C(1) at 4.609 13.903 57.777 in (null):G-9999 (0) and CD(6) at 4.97481 13.9015 57.1431 in (null):P-9999 (1) neighbor-bump: 1.0345 Ang O(0) at 5.438 14.768 57.467 in (null):G-9999 (0) and CD(6) at 4.97481 13.9015 57.1431 in (null):P-9999 (1) neighbor-bump: 2.15046 Ang C(1) at 4.609 13.903 57.777 in (null):G-9999 (0) and CG(5) at 5.36534 13.1105 55.9265 in (null):P-9999 (1) self-bump: 2.17621 Ang N(2) at 4.937 12.633 58.006 in (null):P-9999 (1) and CG(5) at 5.36534 13.1105 55.9265 in (null):P-9999 (1) neighbor-bump: 2.26401 Ang O(0) at 5.438 14.768 57.467 in (null):G-9999 (0) and CG(5) at 5.36534 13.1105 55.9265 in (null):P-9999 (1) T0159 117 :ELKPGKDVVWLQ 1cl2A 196 :ALDFGIDVSIQA Fragment has 22 clashes (null) has 22 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:2.43906 Ang CG1(59) at 7.938 3.393 50.47 in (null):V-9999 (8) and NE1(78) at 5.5634 3.15579 49.966 in (null):W-9999 (10) other bump:2.62522 Ang CD(6) at 7.30187 4.16572 56.8238 in (null):E-9999 (1) and CG2(67) at 8.81403 6.20339 56.1507 in (null):V-9999 (9) other bump:1.96073 Ang OE1(7) at 7.4471 4.83177 55.843 in (null):E-9999 (1) and CG2(67) at 8.81403 6.20339 56.1507 in (null):V-9999 (9) other bump:2.63788 Ang CB(4) at 8.38357 5.64024 58.6916 in (null):E-9999 (1) and CG2(67) at 8.81403 6.20339 56.1507 in (null):V-9999 (9) other bump:2.7604 Ang CG(5) at 8.29006 4.25626 58.0359 in (null):E-9999 (1) and CG2(67) at 8.81403 6.20339 56.1507 in (null):V-9999 (9) other bump:2.82795 Ang CD1(15) at 11.515 5.467 55.751 in (null):L-9999 (2) and CG2(67) at 8.81403 6.20339 56.1507 in (null):V-9999 (9) other bump:2.32107 Ang OE1(7) at 7.4471 4.83177 55.843 in (null):E-9999 (1) and CB(65) at 8.02335 6.91937 55.008 in (null):V-9999 (9) other bump:3.14422 Ang CD(6) at 7.30187 4.16572 56.8238 in (null):E-9999 (1) and CA(64) at 7.321 5.855 54.172 in (null):V-9999 (9) other bump:1.96348 Ang OE1(7) at 7.4471 4.83177 55.843 in (null):E-9999 (1) and CA(64) at 7.321 5.855 54.172 in (null):V-9999 (9) other bump:2.52905 Ang OE1(7) at 7.4471 4.83177 55.843 in (null):E-9999 (1) and N(63) at 8.3 5.037 53.471 in (null):V-9999 (9) other bump:2.76672 Ang OE1(7) at 7.4471 4.83177 55.843 in (null):E-9999 (1) and C(62) at 8.203 3.709 53.43 in (null):V-9999 (8) other bump:2.41441 Ang CG(5) at 8.29006 4.25626 58.0359 in (null):E-9999 (1) and CD(43) at 7.82781 2.66023 59.7876 in (null):K-9999 (6) other bump:3.05117 Ang CG(5) at 8.29006 4.25626 58.0359 in (null):E-9999 (1) and CG(42) at 8.56933 1.45983 59.224 in (null):K-9999 (6) other bump:2.73159 Ang CG(5) at 8.29006 4.25626 58.0359 in (null):E-9999 (1) and CB(41) at 9.55702 1.83784 58.1235 in (null):K-9999 (6) other bump:3.17821 Ang C(10) at 10.558 5.036 59.626 in (null):E-9999 (1) and CD(32) at 12.2096 4.69445 62.3198 in (null):P-9999 (4) other bump:2.3982 Ang O(0) at 11.207 6.795 61.742 in (null):G-9999 (0) and CD(32) at 12.2096 4.69445 62.3198 in (null):P-9999 (4) neighbor-bump: 2.17413 Ang N(19) at 13.467 5.518 60.749 in (null):K-9999 (3) and CD(32) at 12.2096 4.69445 62.3198 in (null):P-9999 (4) neighbor-bump: 2.22843 Ang CA(20) at 14.318 5.284 61.904 in (null):K-9999 (3) and CD(32) at 12.2096 4.69445 62.3198 in (null):P-9999 (4) neighbor-bump: 1.84578 Ang C(27) at 13.897 4.034 62.671 in (null):K-9999 (3) and CD(32) at 12.2096 4.69445 62.3198 in (null):P-9999 (4) self-bump: 1.28418 Ang N(28) at 12.706 3.512 62.387 in (null):P-9999 (4) and CD(32) at 12.2096 4.69445 62.3198 in (null):P-9999 (4) neighbor-bump: 2.66991 Ang CB(21) at 14.0427 6.58624 62.7549 in (null):K-9999 (3) and CD(32) at 12.2096 4.69445 62.3198 in (null):P-9999 (4) self-bump: 2.14371 Ang N(28) at 12.706 3.512 62.387 in (null):P-9999 (4) and CG(31) at 10.9486 4.48383 63.137 in (null):P-9999 (4) T0159 131 :FSALPG 1cl2A 212 :LVGHSD Fragment has 12 clashes (null) has 12 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 8 residues self-bump: 1.32648 Ang N(32) at -5.672 22.262 50.963 in (null):P-9999 (5) and CD(36) at -5.77925 23.0432 52.0296 in (null):P-9999 (5) neighbor-bump: 2.05129 Ang O(30) at -6.425 24.381 50.615 in (null):L-9999 (4) and CD(36) at -5.77925 23.0432 52.0296 in (null):P-9999 (5) neighbor-bump: 1.09326 Ang C(31) at -5.592 23.594 51.104 in (null):L-9999 (4) and CD(36) at -5.77925 23.0432 52.0296 in (null):P-9999 (5) neighbor-bump: 1.76552 Ang CA(25) at -4.411 24.153 51.914 in (null):L-9999 (4) and CD(36) at -5.77925 23.0432 52.0296 in (null):P-9999 (5) neighbor-bump: 2.42579 Ang N(24) at -3.377 23.202 52.327 in (null):L-9999 (4) and CD(36) at -5.77925 23.0432 52.0296 in (null):P-9999 (5) self-bump: 2.13836 Ang N(32) at -5.672 22.262 50.963 in (null):P-9999 (5) and CG(35) at -7.14407 23.6023 51.7435 in (null):P-9999 (5) neighbor-bump: 1.54821 Ang O(30) at -6.425 24.381 50.615 in (null):L-9999 (4) and CG(35) at -7.14407 23.6023 51.7435 in (null):P-9999 (5) neighbor-bump: 1.67868 Ang C(31) at -5.592 23.594 51.104 in (null):L-9999 (4) and CG(35) at -7.14407 23.6023 51.7435 in (null):P-9999 (5) neighbor-bump: 2.7932 Ang CA(25) at -4.411 24.153 51.914 in (null):L-9999 (4) and CG(35) at -7.14407 23.6023 51.7435 in (null):P-9999 (5) neighbor-bump: 2.57768 Ang C(31) at -5.592 23.594 51.104 in (null):L-9999 (4) and CB(34) at -7.88033 22.4128 51.2162 in (null):P-9999 (5) neighbor-bump: 2.59999 Ang C(18) at -0.416 21.965 51.943 in (null):S-9999 (2) and CB(21) at -0.374693 22.9511 54.3484 in (null):A-9999 (3) self-bump: 1.36988 Ang CA(14) at 0.273 20.992 50.951 in (null):S-9999 (2) and CB(15) at -0.611118 20.8429 49.9153 in (null):S-9999 (2) T0159 137 :DKNA 1cl2A 318 :KLNN Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 6 residues T0159 141 :DTKLPNG 1cl2A 324 :LANYLDN Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 9 residues other bump:1.92876 Ang CG2(13) at -30.6175 16.5467 56.7912 in (null):T-9999 (2) and ND2(45) at -29.2226 17.7947 56.3256 in (null):N-9999 (6) other bump:1.69243 Ang O(8) at -27.108 14.731 60.135 in (null):D-9999 (1) and CD(38) at -26.0915 15.778 60.9922 in (null):P-9999 (5) other bump:2.81727 Ang C(9) at -28.075 13.976 60.123 in (null):D-9999 (1) and CD(38) at -26.0915 15.778 60.9922 in (null):P-9999 (5) neighbor-bump: 2.6735 Ang CB(28) at -26.475 15.883 63.636 in (null):L-9999 (4) and CD(38) at -26.0915 15.778 60.9922 in (null):P-9999 (5) self-bump: 1.38293 Ang N(34) at -25.672 17.095 61.038 in (null):P-9999 (5) and CD(38) at -26.0915 15.778 60.9922 in (null):P-9999 (5) other bump:2.15937 Ang O(8) at -27.108 14.731 60.135 in (null):D-9999 (1) and CG(37) at -24.9858 15.1272 60.1822 in (null):P-9999 (5) T0159 148 :ANYG 1cl2A 347 :ILAN Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 5 residues Number of specific fragments= 14 total=233 Number of alignments=44 # Reading fragments from alignment file # T0159 read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1a4uA/T0159-1a4uA-2track-protein-EBGHSTL-local-adpstyle5.pw.a2m.gz # 1a4uA read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1a4uA/T0159-1a4uA-2track-protein-EBGHSTL-local-adpstyle5.pw.a2m.gz # found chain 1a4uA in template set T0159 48 :GDGKADLTGCNPGWGCEGAINHQLAAYELTNTVTHNQGNYAAMMADTI 1a4uA 2 :DLTNKNVIFVAALGGIGLDTSRELVKRNLKNFVILDRVENPTALAELK Fragment has 26 clashes (null) has 26 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 50 residues other bump:2.81877 Ang CA(81) at 12.524 -14.987 -4.597 in (null):G-9999 (13) and CE(310) at 10.8863 -15.3361 -6.86446 in (null):M-9999 (43) other bump:2.84447 Ang C(83) at 11.121 -14.611 -4.124 in (null):G-9999 (13) and CE(310) at 10.8863 -15.3361 -6.86446 in (null):M-9999 (43) other bump:3.26707 Ang CD2(288) at 9.22028 -19.9501 -7.23044 in (null):Y-9999 (40) and SD(309) at 9.98486 -16.8484 -6.54608 in (null):M-9999 (43) other bump:2.59464 Ang O(82) at 10.147 -15.265 -4.497 in (null):G-9999 (13) and SD(309) at 9.98486 -16.8484 -6.54608 in (null):M-9999 (43) other bump:2.60459 Ang CD2(288) at 9.22028 -19.9501 -7.23044 in (null):Y-9999 (40) and CG(308) at 10.1149 -17.6795 -8.14019 in (null):M-9999 (43) other bump:2.31057 Ang CG2(51) at 23.9885 -12.514 0.11064 in (null):T-9999 (8) and NE2(251) at 23.7429 -14.7728 0.530312 in (null):H-9999 (35) other bump:2.66161 Ang CG2(51) at 23.9885 -12.514 0.11064 in (null):T-9999 (8) and CD2(248) at 22.3892 -14.5772 0.629521 in (null):H-9999 (35) other bump:2.06087 Ang CG(76) at 17.0257 -14.1504 -3.50066 in (null):P-9999 (12) and CG2(240) at 17.7229 -16.0891 -3.55264 in (null):T-9999 (34) other bump:2.91775 Ang CD(77) at 16.7128 -13.783 -2.07791 in (null):P-9999 (12) and CG2(240) at 17.7229 -16.0891 -3.55264 in (null):T-9999 (34) other bump:2.83204 Ang CD1(204) at 23.479 -9.573 -10.197 in (null):L-9999 (29) and OG1(227) at 23.6104 -12.3329 -9.57571 in (null):T-9999 (32) other bump:2.66945 Ang CA(19) at 30.876 -8.51 -13.096 in (null):K-9999 (4) and CG2(211) at 31.3114 -10.9438 -12.0894 in (null):T-9999 (30) other bump:2.66723 Ang C(26) at 30.896 -8.359 -11.579 in (null):K-9999 (4) and CG2(211) at 31.3114 -10.9438 -12.0894 in (null):T-9999 (30) other bump:2.63806 Ang CD1(44) at 25.5945 -8.36617 -8.23537 in (null):L-9999 (7) and CD2(205) at 25.137 -7.791 -10.769 in (null):L-9999 (29) other bump:2.55186 Ang O(159) at 18.47 -6.449 -14.003 in (null):Q-9999 (23) and CE2(186) at 19.4265 -4.1147 -13.6181 in (null):Y-9999 (27) other bump:2.58275 Ang O(159) at 18.47 -6.449 -14.003 in (null):Q-9999 (23) and CD2(184) at 20.5345 -4.95004 -13.6012 in (null):Y-9999 (27) other bump:2.38533 Ang O(119) at 12.466 -10.797 -9.812 in (null):G-9999 (18) and CD2(146) at 11.4814 -11.3677 -11.9083 in (null):H-9999 (22) other bump:3.09134 Ang C(120) at 11.644 -10.552 -8.931 in (null):G-9999 (18) and CD2(146) at 11.4814 -11.3677 -11.9083 in (null):H-9999 (22) other bump:2.65582 Ang CB(67) at 13.9963 -12.3484 1.17652 in (null):N-9999 (11) and OE1(113) at 13.1813 -11.7039 -1.26763 in (null):E-9999 (17) other bump:0.541215 Ang O(71) at 13.653 -11.744 -1.53 in (null):N-9999 (11) and OE1(113) at 13.1813 -11.7039 -1.26763 in (null):E-9999 (17) other bump:1.61493 Ang C(72) at 14.564 -12.538 -1.29 in (null):N-9999 (11) and OE1(113) at 13.1813 -11.7039 -1.26763 in (null):E-9999 (17) other bump:2.52622 Ang CA(66) at 14.794 -13.062 0.124 in (null):N-9999 (11) and OE1(113) at 13.1813 -11.7039 -1.26763 in (null):E-9999 (17) other bump:1.50692 Ang O(71) at 13.653 -11.744 -1.53 in (null):N-9999 (11) and CD(112) at 12.9699 -10.4823 -1.06924 in (null):E-9999 (17) other bump:2.61071 Ang C(72) at 14.564 -12.538 -1.29 in (null):N-9999 (11) and CD(112) at 12.9699 -10.4823 -1.06924 in (null):E-9999 (17) other bump:2.46192 Ang O(71) at 13.653 -11.744 -1.53 in (null):N-9999 (11) and CG(111) at 12.7883 -9.55555 -2.2539 in (null):E-9999 (17) other bump:2.59534 Ang O(96) at 10.085 -10.835 -3.287 in (null):W-9999 (14) and CB(110) at 12.603 -10.2742 -3.5712 in (null):E-9999 (17) other bump:2.62997 Ang O(57) at 19.17 -13.097 -1.439 in (null):G-9999 (9) and CD(77) at 16.7128 -13.783 -2.07791 in (null):P-9999 (12) T0159 97 :RYKEGKPVFYYTWT 1a4uA 50 :AINPKVNITFHTYD Fragment has 22 clashes (null) has 22 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 16 residues other bump:2.96575 Ang CD1(74) at 25.5333 -22.0476 -4.73096 in (null):F-9999 (9) and OH(102) at 27.3226 -20.5892 -2.86895 in (null):Y-9999 (11) other bump:2.57808 Ang CZ(78) at 25.5425 -22.377 -2.33833 in (null):F-9999 (9) and OH(102) at 27.3226 -20.5892 -2.86895 in (null):Y-9999 (11) other bump:2.47472 Ang CD2(75) at 24.9059 -20.2517 -3.28133 in (null):F-9999 (9) and OH(102) at 27.3226 -20.5892 -2.86895 in (null):Y-9999 (11) other bump:2.35632 Ang CE2(77) at 25.1234 -21.0669 -2.17073 in (null):F-9999 (9) and OH(102) at 27.3226 -20.5892 -2.86895 in (null):Y-9999 (11) other bump:2.81605 Ang CE1(76) at 25.7498 -22.8687 -3.61451 in (null):F-9999 (9) and CZ(101) at 26.2173 -20.5729 -2.05208 in (null):Y-9999 (11) other bump:1.94728 Ang CZ(78) at 25.5425 -22.377 -2.33833 in (null):F-9999 (9) and CZ(101) at 26.2173 -20.5729 -2.05208 in (null):Y-9999 (11) other bump:2.75432 Ang CG(73) at 25.1149 -20.7282 -4.5714 in (null):F-9999 (9) and CZ(101) at 26.2173 -20.5729 -2.05208 in (null):Y-9999 (11) other bump:1.82593 Ang CD2(75) at 24.9059 -20.2517 -3.28133 in (null):F-9999 (9) and CZ(101) at 26.2173 -20.5729 -2.05208 in (null):Y-9999 (11) other bump:1.20613 Ang CE2(77) at 25.1234 -21.0669 -2.17073 in (null):F-9999 (9) and CZ(101) at 26.2173 -20.5729 -2.05208 in (null):Y-9999 (11) other bump:2.86176 Ang CZ(78) at 25.5425 -22.377 -2.33833 in (null):F-9999 (9) and CE2(100) at 25.3336 -19.5357 -2.06817 in (null):Y-9999 (11) other bump:2.78138 Ang CG(73) at 25.1149 -20.7282 -4.5714 in (null):F-9999 (9) and CE2(100) at 25.3336 -19.5357 -2.06817 in (null):Y-9999 (11) other bump:1.47219 Ang CD2(75) at 24.9059 -20.2517 -3.28133 in (null):F-9999 (9) and CE2(100) at 25.3336 -19.5357 -2.06817 in (null):Y-9999 (11) other bump:1.54899 Ang CE2(77) at 25.1234 -21.0669 -2.17073 in (null):F-9999 (9) and CE2(100) at 25.3336 -19.5357 -2.06817 in (null):Y-9999 (11) other bump:2.63498 Ang CE1(76) at 25.7498 -22.8687 -3.61451 in (null):F-9999 (9) and CE1(99) at 25.9843 -21.6866 -1.27124 in (null):Y-9999 (11) other bump:1.34556 Ang CZ(78) at 25.5425 -22.377 -2.33833 in (null):F-9999 (9) and CE1(99) at 25.9843 -21.6866 -1.27124 in (null):Y-9999 (11) other bump:2.69493 Ang CD2(75) at 24.9059 -20.2517 -3.28133 in (null):F-9999 (9) and CE1(99) at 25.9843 -21.6866 -1.27124 in (null):Y-9999 (11) other bump:1.39083 Ang CE2(77) at 25.1234 -21.0669 -2.17073 in (null):F-9999 (9) and CE1(99) at 25.9843 -21.6866 -1.27124 in (null):Y-9999 (11) other bump:2.27958 Ang CD2(75) at 24.9059 -20.2517 -3.28133 in (null):F-9999 (9) and CD2(98) at 24.2075 -19.5559 -1.22593 in (null):Y-9999 (11) other bump:2.00363 Ang CE2(77) at 25.1234 -21.0669 -2.17073 in (null):F-9999 (9) and CD2(98) at 24.2075 -19.5559 -1.22593 in (null):Y-9999 (11) other bump:2.11269 Ang CZ(78) at 25.5425 -22.377 -2.33833 in (null):F-9999 (9) and CD1(97) at 24.85 -21.6996 -0.460833 in (null):Y-9999 (11) other bump:1.84359 Ang CE2(77) at 25.1234 -21.0669 -2.17073 in (null):F-9999 (9) and CD1(97) at 24.85 -21.6996 -0.460833 in (null):Y-9999 (11) other bump:2.11859 Ang CE2(77) at 25.1234 -21.0669 -2.17073 in (null):F-9999 (9) and CG(96) at 23.9689 -20.6522 -0.443387 in (null):Y-9999 (11) Number of specific fragments= 2 total=235 Number of alignments=45 # Reading fragments from alignment file # T0159 read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1a4uA/T0159-1a4uA-2track-protein-EBGHSTL-local-adpstyle1.pw.a2m.gz # 1a4uA read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1a4uA/T0159-1a4uA-2track-protein-EBGHSTL-local-adpstyle1.pw.a2m.gz # found chain 1a4uA in template set T0159 48 :GDGKADLTGCNPGWGCEGAINHQLAAYELTNTVTHNQGNYAAMMADT 1a4uA 2 :DLTNKNVIFVAALGGIGLDTSRELVKRNLKNFVILDRVENPTALAEL Fragment has 26 clashes (null) has 26 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 49 residues other bump:2.81877 Ang CA(81) at 12.524 -14.987 -4.597 in (null):G-9999 (13) and CE(310) at 10.8863 -15.3361 -6.86446 in (null):M-9999 (43) other bump:2.84447 Ang C(83) at 11.121 -14.611 -4.124 in (null):G-9999 (13) and CE(310) at 10.8863 -15.3361 -6.86446 in (null):M-9999 (43) other bump:3.26707 Ang CD2(288) at 9.22028 -19.9501 -7.23044 in (null):Y-9999 (40) and SD(309) at 9.98486 -16.8484 -6.54608 in (null):M-9999 (43) other bump:2.59464 Ang O(82) at 10.147 -15.265 -4.497 in (null):G-9999 (13) and SD(309) at 9.98486 -16.8484 -6.54608 in (null):M-9999 (43) other bump:2.60459 Ang CD2(288) at 9.22028 -19.9501 -7.23044 in (null):Y-9999 (40) and CG(308) at 10.1149 -17.6795 -8.14019 in (null):M-9999 (43) other bump:2.31057 Ang CG2(51) at 23.9885 -12.514 0.11064 in (null):T-9999 (8) and NE2(251) at 23.7429 -14.7728 0.530312 in (null):H-9999 (35) other bump:2.66161 Ang CG2(51) at 23.9885 -12.514 0.11064 in (null):T-9999 (8) and CD2(248) at 22.3892 -14.5772 0.629521 in (null):H-9999 (35) other bump:2.06087 Ang CG(76) at 17.0257 -14.1504 -3.50066 in (null):P-9999 (12) and CG2(240) at 17.7229 -16.0891 -3.55264 in (null):T-9999 (34) other bump:2.91775 Ang CD(77) at 16.7128 -13.783 -2.07791 in (null):P-9999 (12) and CG2(240) at 17.7229 -16.0891 -3.55264 in (null):T-9999 (34) other bump:2.83204 Ang CD1(204) at 23.479 -9.573 -10.197 in (null):L-9999 (29) and OG1(227) at 23.6104 -12.3329 -9.57571 in (null):T-9999 (32) other bump:2.66945 Ang CA(19) at 30.876 -8.51 -13.096 in (null):K-9999 (4) and CG2(211) at 31.3114 -10.9438 -12.0894 in (null):T-9999 (30) other bump:2.66723 Ang C(26) at 30.896 -8.359 -11.579 in (null):K-9999 (4) and CG2(211) at 31.3114 -10.9438 -12.0894 in (null):T-9999 (30) other bump:2.63806 Ang CD1(44) at 25.5945 -8.36617 -8.23537 in (null):L-9999 (7) and CD2(205) at 25.137 -7.791 -10.769 in (null):L-9999 (29) other bump:2.55186 Ang O(159) at 18.47 -6.449 -14.003 in (null):Q-9999 (23) and CE2(186) at 19.4265 -4.1147 -13.6181 in (null):Y-9999 (27) other bump:2.58275 Ang O(159) at 18.47 -6.449 -14.003 in (null):Q-9999 (23) and CD2(184) at 20.5345 -4.95004 -13.6012 in (null):Y-9999 (27) other bump:2.38533 Ang O(119) at 12.466 -10.797 -9.812 in (null):G-9999 (18) and CD2(146) at 11.4814 -11.3677 -11.9083 in (null):H-9999 (22) other bump:3.09134 Ang C(120) at 11.644 -10.552 -8.931 in (null):G-9999 (18) and CD2(146) at 11.4814 -11.3677 -11.9083 in (null):H-9999 (22) other bump:2.65582 Ang CB(67) at 13.9963 -12.3484 1.17652 in (null):N-9999 (11) and OE1(113) at 13.1813 -11.7039 -1.26763 in (null):E-9999 (17) other bump:0.541215 Ang O(71) at 13.653 -11.744 -1.53 in (null):N-9999 (11) and OE1(113) at 13.1813 -11.7039 -1.26763 in (null):E-9999 (17) other bump:1.61493 Ang C(72) at 14.564 -12.538 -1.29 in (null):N-9999 (11) and OE1(113) at 13.1813 -11.7039 -1.26763 in (null):E-9999 (17) other bump:2.52622 Ang CA(66) at 14.794 -13.062 0.124 in (null):N-9999 (11) and OE1(113) at 13.1813 -11.7039 -1.26763 in (null):E-9999 (17) other bump:1.50692 Ang O(71) at 13.653 -11.744 -1.53 in (null):N-9999 (11) and CD(112) at 12.9699 -10.4823 -1.06924 in (null):E-9999 (17) other bump:2.61071 Ang C(72) at 14.564 -12.538 -1.29 in (null):N-9999 (11) and CD(112) at 12.9699 -10.4823 -1.06924 in (null):E-9999 (17) other bump:2.46192 Ang O(71) at 13.653 -11.744 -1.53 in (null):N-9999 (11) and CG(111) at 12.7883 -9.55555 -2.2539 in (null):E-9999 (17) other bump:2.59534 Ang O(96) at 10.085 -10.835 -3.287 in (null):W-9999 (14) and CB(110) at 12.603 -10.2742 -3.5712 in (null):E-9999 (17) other bump:2.62997 Ang O(57) at 19.17 -13.097 -1.439 in (null):G-9999 (9) and CD(77) at 16.7128 -13.783 -2.07791 in (null):P-9999 (12) T0159 96 :SRYKEGKPVFYYTW 1a4uA 49 :KAINPKVNITFHTY Fragment has 22 clashes (null) has 22 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 16 residues other bump:2.96575 Ang CD1(80) at 25.5333 -22.0476 -4.73096 in (null):F-9999 (10) and OH(108) at 27.3226 -20.5892 -2.86895 in (null):Y-9999 (12) other bump:2.57808 Ang CZ(84) at 25.5425 -22.377 -2.33833 in (null):F-9999 (10) and OH(108) at 27.3226 -20.5892 -2.86895 in (null):Y-9999 (12) other bump:2.47472 Ang CD2(81) at 24.9059 -20.2517 -3.28133 in (null):F-9999 (10) and OH(108) at 27.3226 -20.5892 -2.86895 in (null):Y-9999 (12) other bump:2.35632 Ang CE2(83) at 25.1234 -21.0669 -2.17073 in (null):F-9999 (10) and OH(108) at 27.3226 -20.5892 -2.86895 in (null):Y-9999 (12) other bump:2.81605 Ang CE1(82) at 25.7498 -22.8687 -3.61451 in (null):F-9999 (10) and CZ(107) at 26.2173 -20.5729 -2.05208 in (null):Y-9999 (12) other bump:1.94728 Ang CZ(84) at 25.5425 -22.377 -2.33833 in (null):F-9999 (10) and CZ(107) at 26.2173 -20.5729 -2.05208 in (null):Y-9999 (12) other bump:2.75432 Ang CG(79) at 25.1149 -20.7282 -4.5714 in (null):F-9999 (10) and CZ(107) at 26.2173 -20.5729 -2.05208 in (null):Y-9999 (12) other bump:1.82593 Ang CD2(81) at 24.9059 -20.2517 -3.28133 in (null):F-9999 (10) and CZ(107) at 26.2173 -20.5729 -2.05208 in (null):Y-9999 (12) other bump:1.20613 Ang CE2(83) at 25.1234 -21.0669 -2.17073 in (null):F-9999 (10) and CZ(107) at 26.2173 -20.5729 -2.05208 in (null):Y-9999 (12) other bump:2.86176 Ang CZ(84) at 25.5425 -22.377 -2.33833 in (null):F-9999 (10) and CE2(106) at 25.3336 -19.5357 -2.06817 in (null):Y-9999 (12) other bump:2.78138 Ang CG(79) at 25.1149 -20.7282 -4.5714 in (null):F-9999 (10) and CE2(106) at 25.3336 -19.5357 -2.06817 in (null):Y-9999 (12) other bump:1.47219 Ang CD2(81) at 24.9059 -20.2517 -3.28133 in (null):F-9999 (10) and CE2(106) at 25.3336 -19.5357 -2.06817 in (null):Y-9999 (12) other bump:1.54899 Ang CE2(83) at 25.1234 -21.0669 -2.17073 in (null):F-9999 (10) and CE2(106) at 25.3336 -19.5357 -2.06817 in (null):Y-9999 (12) other bump:2.63498 Ang CE1(82) at 25.7498 -22.8687 -3.61451 in (null):F-9999 (10) and CE1(105) at 25.9843 -21.6866 -1.27124 in (null):Y-9999 (12) other bump:1.34556 Ang CZ(84) at 25.5425 -22.377 -2.33833 in (null):F-9999 (10) and CE1(105) at 25.9843 -21.6866 -1.27124 in (null):Y-9999 (12) other bump:2.69493 Ang CD2(81) at 24.9059 -20.2517 -3.28133 in (null):F-9999 (10) and CE1(105) at 25.9843 -21.6866 -1.27124 in (null):Y-9999 (12) other bump:1.39083 Ang CE2(83) at 25.1234 -21.0669 -2.17073 in (null):F-9999 (10) and CE1(105) at 25.9843 -21.6866 -1.27124 in (null):Y-9999 (12) other bump:2.27958 Ang CD2(81) at 24.9059 -20.2517 -3.28133 in (null):F-9999 (10) and CD2(104) at 24.2075 -19.5559 -1.22593 in (null):Y-9999 (12) other bump:2.00363 Ang CE2(83) at 25.1234 -21.0669 -2.17073 in (null):F-9999 (10) and CD2(104) at 24.2075 -19.5559 -1.22593 in (null):Y-9999 (12) other bump:2.11269 Ang CZ(84) at 25.5425 -22.377 -2.33833 in (null):F-9999 (10) and CD1(103) at 24.85 -21.6996 -0.460833 in (null):Y-9999 (12) other bump:1.84359 Ang CE2(83) at 25.1234 -21.0669 -2.17073 in (null):F-9999 (10) and CD1(103) at 24.85 -21.6996 -0.460833 in (null):Y-9999 (12) other bump:2.11859 Ang CE2(83) at 25.1234 -21.0669 -2.17073 in (null):F-9999 (10) and CG(102) at 23.9689 -20.6522 -0.443387 in (null):Y-9999 (12) Number of specific fragments= 2 total=237 Number of alignments=46 # Reading fragments from alignment file # T0159 read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1cl1A/T0159-1cl1A-2track-protein-EBGHSTL-local-adpstyle1.pw.a2m.gz # 1cl1A read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1cl1A/T0159-1cl1A-2track-protein-EBGHSTL-local-adpstyle1.pw.a2m.gz # found chain 1cl1A in template set T0159 48 :GDGKADLTGCNPGWGCEGAINHQLAAYELTNTVTHNQGNYAAMMADTISRYKEGKPVFYY 1cl1A 48 :NRANGELFYGRRGTLTHFSLQQAMCELEGGAGCVLFPCGAAAVANSILAFIEQGDHVLMT Fragment has 45 clashes (null) has 45 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 62 residues other bump:2.1093 Ang CG1(419) at 0.014 -6.549 51 in (null):V-9999 (57) and OH(443) at 0.778562 -4.88599 49.9517 in (null):Y-9999 (59) other bump:1.74085 Ang CG1(419) at 0.014 -6.549 51 in (null):V-9999 (57) and CZ(442) at -0.0605636 -4.81028 51.0431 in (null):Y-9999 (59) other bump:3.03784 Ang CG1(419) at 0.014 -6.549 51 in (null):V-9999 (57) and CE2(441) at -0.29582 -3.60009 51.6606 in (null):Y-9999 (59) other bump:2.39121 Ang CB(418) at 0.042 -7.927 50.318 in (null):V-9999 (57) and CE1(440) at -0.655893 -5.96729 51.4971 in (null):Y-9999 (59) other bump:1.017 Ang CG1(419) at 0.014 -6.549 51 in (null):V-9999 (57) and CE1(440) at -0.655893 -5.96729 51.4971 in (null):Y-9999 (59) other bump:2.28968 Ang CG1(419) at 0.014 -6.549 51 in (null):V-9999 (57) and CD1(438) at -1.5015 -5.91191 52.5937 in (null):Y-9999 (59) neighbor-bump: 2.03116 Ang C(408) at 2.171 -13.008 47.581 in (null):K-9999 (55) and CD(413) at 3.12743 -14.0036 49.0709 in (null):P-9999 (56) other bump:0.77655 Ang CD1(346) at 0.303735 -3.63133 41.6233 in (null):I-9999 (48) and OH(375) at 0.975101 -3.79047 41.267 in (null):Y-9999 (51) other bump:1.76857 Ang CG1(344) at 0.784284 -2.21858 42.0548 in (null):I-9999 (48) and OH(375) at 0.975101 -3.79047 41.267 in (null):Y-9999 (51) other bump:2.82983 Ang CA(342) at 3.081 -2.854 42.909 in (null):I-9999 (48) and OH(375) at 0.975101 -3.79047 41.267 in (null):Y-9999 (51) other bump:2.56065 Ang CG2(345) at 2.72453 -2.10159 40.4644 in (null):I-9999 (48) and OH(375) at 0.975101 -3.79047 41.267 in (null):Y-9999 (51) other bump:2.35969 Ang CB(343) at 2.27117 -1.92127 41.895 in (null):I-9999 (48) and OH(375) at 0.975101 -3.79047 41.267 in (null):Y-9999 (51) other bump:1.76187 Ang CD1(346) at 0.303735 -3.63133 41.6233 in (null):I-9999 (48) and CZ(374) at 1.62769 -4.70993 42.0569 in (null):Y-9999 (51) other bump:2.63024 Ang CG1(344) at 0.784284 -2.21858 42.0548 in (null):I-9999 (48) and CZ(374) at 1.62769 -4.70993 42.0569 in (null):Y-9999 (51) other bump:2.50653 Ang CA(342) at 3.081 -2.854 42.909 in (null):I-9999 (48) and CZ(374) at 1.62769 -4.70993 42.0569 in (null):Y-9999 (51) other bump:2.86651 Ang CB(343) at 2.27117 -1.92127 41.895 in (null):I-9999 (48) and CZ(374) at 1.62769 -4.70993 42.0569 in (null):Y-9999 (51) other bump:2.59265 Ang CD1(346) at 0.303735 -3.63133 41.6233 in (null):I-9999 (48) and CE2(373) at 2.23111 -4.2849 43.2295 in (null):Y-9999 (51) other bump:2.78264 Ang CG1(344) at 0.784284 -2.21858 42.0548 in (null):I-9999 (48) and CE2(373) at 2.23111 -4.2849 43.2295 in (null):Y-9999 (51) other bump:1.69486 Ang CA(342) at 3.081 -2.854 42.909 in (null):I-9999 (48) and CE2(373) at 2.23111 -4.2849 43.2295 in (null):Y-9999 (51) other bump:2.7662 Ang C(348) at 4.563 -2.97 42.533 in (null):I-9999 (48) and CE2(373) at 2.23111 -4.2849 43.2295 in (null):Y-9999 (51) other bump:2.8722 Ang C(340) at 3.424 -2.731 45.33 in (null):T-9999 (47) and CE2(373) at 2.23111 -4.2849 43.2295 in (null):Y-9999 (51) other bump:2.35461 Ang N(341) at 2.87 -2.247 44.221 in (null):I-9999 (48) and CE2(373) at 2.23111 -4.2849 43.2295 in (null):Y-9999 (51) other bump:2.71464 Ang CB(343) at 2.27117 -1.92127 41.895 in (null):I-9999 (48) and CE2(373) at 2.23111 -4.2849 43.2295 in (null):Y-9999 (51) other bump:2.782 Ang CD1(346) at 0.303735 -3.63133 41.6233 in (null):I-9999 (48) and CE1(372) at 1.6921 -6.04154 41.6768 in (null):Y-9999 (51) other bump:2.36566 Ang O(339) at 4.192 -3.704 45.329 in (null):T-9999 (47) and CD2(371) at 2.90337 -5.19851 44.0243 in (null):Y-9999 (51) other bump:2.60234 Ang CA(342) at 3.081 -2.854 42.909 in (null):I-9999 (48) and CD2(371) at 2.90337 -5.19851 44.0243 in (null):Y-9999 (51) other bump:3.15351 Ang C(348) at 4.563 -2.97 42.533 in (null):I-9999 (48) and CD2(371) at 2.90337 -5.19851 44.0243 in (null):Y-9999 (51) other bump:2.83981 Ang C(340) at 3.424 -2.731 45.33 in (null):T-9999 (47) and CD2(371) at 2.90337 -5.19851 44.0243 in (null):Y-9999 (51) other bump:3.08106 Ang CG(257) at 1.58495 8.58009 43.1014 in (null):N-9999 (36) and N(300) at 0.56 6.735 45.346 in (null):A-9999 (42) other bump:3.18698 Ang CG(257) at 1.58495 8.58009 43.1014 in (null):N-9999 (36) and C(299) at 0.148 6.004 44.308 in (null):A-9999 (41) other bump:2.92532 Ang CD(266) at -1.04913 9.27327 40.2464 in (null):Q-9999 (37) and CB(297) at -0.861 7.51 42.573 in (null):A-9999 (41) other bump:2.90919 Ang OE1(267) at 0.177967 9.11626 40.3812 in (null):Q-9999 (37) and CB(297) at -0.861 7.51 42.573 in (null):A-9999 (41) other bump:2.72158 Ang CG(257) at 1.58495 8.58009 43.1014 in (null):N-9999 (36) and CB(297) at -0.861 7.51 42.573 in (null):A-9999 (41) other bump:2.0389 Ang OD1(259) at 0.439878 9.01053 43.0348 in (null):N-9999 (36) and CB(297) at -0.861 7.51 42.573 in (null):A-9999 (41) other bump:2.57665 Ang CG(137) at 12.3443 14.2522 44.6608 in (null):N-9999 (21) and NE2(251) at 9.79961 14.6513 44.7268 in (null):H-9999 (35) other bump:1.61263 Ang OD1(139) at 11.2225 13.9986 45.1139 in (null):N-9999 (21) and NE2(251) at 9.79961 14.6513 44.7268 in (null):H-9999 (35) other bump:2.75489 Ang OD1(139) at 11.2225 13.9986 45.1139 in (null):N-9999 (21) and CE1(250) at 8.734 15.1658 45.2989 in (null):H-9999 (35) other bump:2.2547 Ang OD1(139) at 11.2225 13.9986 45.1139 in (null):N-9999 (21) and CD2(248) at 9.40846 13.7015 43.8082 in (null):H-9999 (35) other bump:2.92997 Ang CG(155) at 12.0202 20.0357 52.2275 in (null):Q-9999 (23) and CZ(187) at 12.5393 20.436 55.0832 in (null):Y-9999 (27) other bump:2.10072 Ang CG(155) at 12.0202 20.0357 52.2275 in (null):Q-9999 (23) and CE1(185) at 12.5663 19.4039 54.1551 in (null):Y-9999 (27) other bump:2.59264 Ang O(159) at 13.343 17.107 53.237 in (null):Q-9999 (23) and CE1(185) at 12.5663 19.4039 54.1551 in (null):Y-9999 (27) other bump:3.09508 Ang C(160) at 13.177 17.247 52.021 in (null):Q-9999 (23) and CE1(185) at 12.5663 19.4039 54.1551 in (null):Y-9999 (27) other bump:1.93429 Ang O(159) at 13.343 17.107 53.237 in (null):Q-9999 (23) and CD1(183) at 12.3587 18.0922 54.5794 in (null):Y-9999 (27) other bump:2.83094 Ang CD1(88) at 12.0853 22.8478 37.3783 in (null):W-9999 (14) and N(102) at 12.622 21.959 40.012 in (null):C-9999 (16) neighbor-bump: 2.47222 Ang C(26) at 20.743 12.675 39.72 in (null):K-9999 (4) and CB(29) at 20.5515 14.7296 41.0815 in (null):A-9999 (5) Number of specific fragments= 1 total=238 Number of alignments=47 # Reading fragments from alignment file # T0159 read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1cl1A/T0159-1cl1A-2track-protein-EBGHSTL-local-adpstyle5.pw.a2m.gz # 1cl1A read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1cl1A/T0159-1cl1A-2track-protein-EBGHSTL-local-adpstyle5.pw.a2m.gz # found chain 1cl1A in template set T0159 46 :TNGDGKADLTGCNPGWGCEGAINHQLAAYELTNTVTHNQGNYAAMMADTISRYKEGKPVFYY 1cl1A 46 :TRNRANGELFYGRRGTLTHFSLQQAMCELEGGAGCVLFPCGAAAVANSILAFIEQGDHVLMT Fragment has 45 clashes (null) has 45 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 64 residues other bump:2.1093 Ang CG1(434) at 0.014 -6.549 51 in (null):V-9999 (59) and OH(458) at 0.778562 -4.88599 49.9517 in (null):Y-9999 (61) other bump:1.74085 Ang CG1(434) at 0.014 -6.549 51 in (null):V-9999 (59) and CZ(457) at -0.0605636 -4.81028 51.0431 in (null):Y-9999 (61) other bump:3.03784 Ang CG1(434) at 0.014 -6.549 51 in (null):V-9999 (59) and CE2(456) at -0.29582 -3.60009 51.6606 in (null):Y-9999 (61) other bump:2.39121 Ang CB(433) at 0.042 -7.927 50.318 in (null):V-9999 (59) and CE1(455) at -0.655893 -5.96729 51.4971 in (null):Y-9999 (61) other bump:1.017 Ang CG1(434) at 0.014 -6.549 51 in (null):V-9999 (59) and CE1(455) at -0.655893 -5.96729 51.4971 in (null):Y-9999 (61) other bump:2.28968 Ang CG1(434) at 0.014 -6.549 51 in (null):V-9999 (59) and CD1(453) at -1.5015 -5.91191 52.5937 in (null):Y-9999 (61) neighbor-bump: 2.03116 Ang C(423) at 2.171 -13.008 47.581 in (null):K-9999 (57) and CD(428) at 3.12743 -14.0036 49.0709 in (null):P-9999 (58) other bump:0.77655 Ang CD1(361) at 0.303735 -3.63133 41.6233 in (null):I-9999 (50) and OH(390) at 0.975101 -3.79047 41.267 in (null):Y-9999 (53) other bump:1.76857 Ang CG1(359) at 0.784284 -2.21858 42.0548 in (null):I-9999 (50) and OH(390) at 0.975101 -3.79047 41.267 in (null):Y-9999 (53) other bump:2.82983 Ang CA(357) at 3.081 -2.854 42.909 in (null):I-9999 (50) and OH(390) at 0.975101 -3.79047 41.267 in (null):Y-9999 (53) other bump:2.56065 Ang CG2(360) at 2.72453 -2.10159 40.4644 in (null):I-9999 (50) and OH(390) at 0.975101 -3.79047 41.267 in (null):Y-9999 (53) other bump:2.35969 Ang CB(358) at 2.27117 -1.92127 41.895 in (null):I-9999 (50) and OH(390) at 0.975101 -3.79047 41.267 in (null):Y-9999 (53) other bump:1.76187 Ang CD1(361) at 0.303735 -3.63133 41.6233 in (null):I-9999 (50) and CZ(389) at 1.62769 -4.70993 42.0569 in (null):Y-9999 (53) other bump:2.63024 Ang CG1(359) at 0.784284 -2.21858 42.0548 in (null):I-9999 (50) and CZ(389) at 1.62769 -4.70993 42.0569 in (null):Y-9999 (53) other bump:2.50653 Ang CA(357) at 3.081 -2.854 42.909 in (null):I-9999 (50) and CZ(389) at 1.62769 -4.70993 42.0569 in (null):Y-9999 (53) other bump:2.86651 Ang CB(358) at 2.27117 -1.92127 41.895 in (null):I-9999 (50) and CZ(389) at 1.62769 -4.70993 42.0569 in (null):Y-9999 (53) other bump:2.59265 Ang CD1(361) at 0.303735 -3.63133 41.6233 in (null):I-9999 (50) and CE2(388) at 2.23111 -4.2849 43.2295 in (null):Y-9999 (53) other bump:2.78264 Ang CG1(359) at 0.784284 -2.21858 42.0548 in (null):I-9999 (50) and CE2(388) at 2.23111 -4.2849 43.2295 in (null):Y-9999 (53) other bump:1.69486 Ang CA(357) at 3.081 -2.854 42.909 in (null):I-9999 (50) and CE2(388) at 2.23111 -4.2849 43.2295 in (null):Y-9999 (53) other bump:2.7662 Ang C(363) at 4.563 -2.97 42.533 in (null):I-9999 (50) and CE2(388) at 2.23111 -4.2849 43.2295 in (null):Y-9999 (53) other bump:2.35461 Ang N(356) at 2.87 -2.247 44.221 in (null):I-9999 (50) and CE2(388) at 2.23111 -4.2849 43.2295 in (null):Y-9999 (53) other bump:2.71464 Ang CB(358) at 2.27117 -1.92127 41.895 in (null):I-9999 (50) and CE2(388) at 2.23111 -4.2849 43.2295 in (null):Y-9999 (53) other bump:2.8722 Ang C(355) at 3.424 -2.731 45.33 in (null):T-9999 (49) and CE2(388) at 2.23111 -4.2849 43.2295 in (null):Y-9999 (53) other bump:2.782 Ang CD1(361) at 0.303735 -3.63133 41.6233 in (null):I-9999 (50) and CE1(387) at 1.6921 -6.04154 41.6768 in (null):Y-9999 (53) other bump:2.60234 Ang CA(357) at 3.081 -2.854 42.909 in (null):I-9999 (50) and CD2(386) at 2.90337 -5.19851 44.0243 in (null):Y-9999 (53) other bump:3.15351 Ang C(363) at 4.563 -2.97 42.533 in (null):I-9999 (50) and CD2(386) at 2.90337 -5.19851 44.0243 in (null):Y-9999 (53) other bump:2.36566 Ang O(354) at 4.192 -3.704 45.329 in (null):T-9999 (49) and CD2(386) at 2.90337 -5.19851 44.0243 in (null):Y-9999 (53) other bump:2.83981 Ang C(355) at 3.424 -2.731 45.33 in (null):T-9999 (49) and CD2(386) at 2.90337 -5.19851 44.0243 in (null):Y-9999 (53) other bump:3.08106 Ang CG(272) at 1.58495 8.58009 43.1014 in (null):N-9999 (38) and N(315) at 0.56 6.735 45.346 in (null):A-9999 (44) other bump:3.18698 Ang CG(272) at 1.58495 8.58009 43.1014 in (null):N-9999 (38) and C(314) at 0.148 6.004 44.308 in (null):A-9999 (43) other bump:2.92532 Ang CD(281) at -1.04913 9.27327 40.2464 in (null):Q-9999 (39) and CB(312) at -0.861 7.51 42.573 in (null):A-9999 (43) other bump:2.90919 Ang OE1(282) at 0.177967 9.11626 40.3812 in (null):Q-9999 (39) and CB(312) at -0.861 7.51 42.573 in (null):A-9999 (43) other bump:2.0389 Ang OD1(274) at 0.439878 9.01053 43.0348 in (null):N-9999 (38) and CB(312) at -0.861 7.51 42.573 in (null):A-9999 (43) other bump:2.72158 Ang CG(272) at 1.58495 8.58009 43.1014 in (null):N-9999 (38) and CB(312) at -0.861 7.51 42.573 in (null):A-9999 (43) other bump:2.57665 Ang CG(152) at 12.3443 14.2522 44.6608 in (null):N-9999 (23) and NE2(266) at 9.79961 14.6513 44.7268 in (null):H-9999 (37) other bump:1.61263 Ang OD1(154) at 11.2225 13.9986 45.1139 in (null):N-9999 (23) and NE2(266) at 9.79961 14.6513 44.7268 in (null):H-9999 (37) other bump:2.75489 Ang OD1(154) at 11.2225 13.9986 45.1139 in (null):N-9999 (23) and CE1(265) at 8.734 15.1658 45.2989 in (null):H-9999 (37) other bump:2.2547 Ang OD1(154) at 11.2225 13.9986 45.1139 in (null):N-9999 (23) and CD2(263) at 9.40846 13.7015 43.8082 in (null):H-9999 (37) other bump:2.92997 Ang CG(170) at 12.0202 20.0357 52.2275 in (null):Q-9999 (25) and CZ(202) at 12.5393 20.436 55.0832 in (null):Y-9999 (29) other bump:2.10072 Ang CG(170) at 12.0202 20.0357 52.2275 in (null):Q-9999 (25) and CE1(200) at 12.5663 19.4039 54.1551 in (null):Y-9999 (29) other bump:2.59264 Ang O(174) at 13.343 17.107 53.237 in (null):Q-9999 (25) and CE1(200) at 12.5663 19.4039 54.1551 in (null):Y-9999 (29) other bump:3.09508 Ang C(175) at 13.177 17.247 52.021 in (null):Q-9999 (25) and CE1(200) at 12.5663 19.4039 54.1551 in (null):Y-9999 (29) other bump:1.93429 Ang O(174) at 13.343 17.107 53.237 in (null):Q-9999 (25) and CD1(198) at 12.3587 18.0922 54.5794 in (null):Y-9999 (29) other bump:2.83094 Ang CD1(103) at 12.0853 22.8478 37.3783 in (null):W-9999 (16) and N(117) at 12.622 21.959 40.012 in (null):C-9999 (18) neighbor-bump: 2.47222 Ang C(41) at 20.743 12.675 39.72 in (null):K-9999 (6) and CB(44) at 20.5515 14.7296 41.0815 in (null):A-9999 (7) T0159 108 :TW 1cl1A 130 :SW Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues T0159 110 :TP 1cl1A 133 :DP Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues T0159 112 :YWVSNELKPGKDVVWLQVPFSALPGDKNA 1cl1A 138 :ADIVKHLQPNTKIVFLESPGSITMEVHDV Fragment has 23 clashes (null) has 23 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 31 residues other bump:2.77746 Ang CG2(152) at 0.645959 2.1581 63.1957 in (null):V-9999 (18) and CG(214) at 0.140418 -0.493342 63.8503 in (null):K-9999 (27) other bump:1.99908 Ang CG1(151) at 0.477368 4.01863 64.8127 in (null):V-9999 (18) and OD1(207) at 0.680959 4.85176 66.6184 in (null):D-9999 (26) other bump:2.98518 Ang CG1(151) at 0.477368 4.01863 64.8127 in (null):V-9999 (18) and CG(206) at 0.364698 4.46616 67.762 in (null):D-9999 (26) other bump:3.27604 Ang CG1(151) at 0.477368 4.01863 64.8127 in (null):V-9999 (18) and CA(204) at -1.69 3.138 67.106 in (null):D-9999 (26) neighbor-bump: 2.17799 Ang O(190) at -9.387 4.831 66.357 in (null):L-9999 (23) and CD(196) at -9.08132 6.6396 65.1826 in (null):P-9999 (24) neighbor-bump: 1.67711 Ang C(191) at -9.386 4.991 65.138 in (null):L-9999 (23) and CD(196) at -9.08132 6.6396 65.1826 in (null):P-9999 (24) self-bump: 2.11423 Ang CA(193) at -7.105 5.889 65.156 in (null):P-9999 (24) and CD(196) at -9.08132 6.6396 65.1826 in (null):P-9999 (24) self-bump: 2.21117 Ang N(192) at -8.313 5.409 64.472 in (null):P-9999 (24) and CG(195) at -8.30584 7.61647 64.3443 in (null):P-9999 (24) other bump:1.04939 Ang O(56) at 0.732 -14.199 57.798 in (null):E-9999 (6) and NZ(92) at 1.01981 -14.5272 56.8437 in (null):K-9999 (11) other bump:2.16516 Ang C(57) at 1.084 -14.213 58.985 in (null):E-9999 (6) and NZ(92) at 1.01981 -14.5272 56.8437 in (null):K-9999 (11) other bump:2.81656 Ang C(65) at 3.503 -15.621 57.599 in (null):L-9999 (7) and NZ(92) at 1.01981 -14.5272 56.8437 in (null):K-9999 (11) other bump:2.68051 Ang CG(69) at 1.3458 -17.0307 54.8542 in (null):K-9999 (8) and CE(91) at 2.26786 -14.8446 56.1016 in (null):K-9999 (11) other bump:2.3777 Ang O(56) at 0.732 -14.199 57.798 in (null):E-9999 (6) and CE(91) at 2.26786 -14.8446 56.1016 in (null):K-9999 (11) other bump:2.51227 Ang CA(67) at 3.805 -16.718 55.439 in (null):K-9999 (8) and CE(91) at 2.26786 -14.8446 56.1016 in (null):K-9999 (11) other bump:2.55253 Ang CB(68) at 2.73628 -16.6576 54.3669 in (null):K-9999 (8) and CE(91) at 2.26786 -14.8446 56.1016 in (null):K-9999 (11) other bump:2.59366 Ang CA(59) at 3.429 -14.296 58.355 in (null):L-9999 (7) and CE(91) at 2.26786 -14.8446 56.1016 in (null):K-9999 (11) other bump:2.0906 Ang C(65) at 3.503 -15.621 57.599 in (null):L-9999 (7) and CE(91) at 2.26786 -14.8446 56.1016 in (null):K-9999 (11) other bump:1.61572 Ang N(66) at 3.715 -15.538 56.29 in (null):K-9999 (8) and CE(91) at 2.26786 -14.8446 56.1016 in (null):K-9999 (11) other bump:3.21108 Ang CA(67) at 3.805 -16.718 55.439 in (null):K-9999 (8) and CD(90) at 3.11818 -13.6072 55.8414 in (null):K-9999 (11) other bump:2.62476 Ang CA(59) at 3.429 -14.296 58.355 in (null):L-9999 (7) and CD(90) at 3.11818 -13.6072 55.8414 in (null):K-9999 (11) other bump:2.70053 Ang C(65) at 3.503 -15.621 57.599 in (null):L-9999 (7) and CD(90) at 3.11818 -13.6072 55.8414 in (null):K-9999 (11) other bump:2.07018 Ang N(66) at 3.715 -15.538 56.29 in (null):K-9999 (8) and CD(90) at 3.11818 -13.6072 55.8414 in (null):K-9999 (11) other bump:2.95949 Ang N(66) at 3.715 -15.538 56.29 in (null):K-9999 (8) and CG(89) at 3.27136 -13.3452 54.3527 in (null):K-9999 (11) Number of specific fragments= 4 total=242 Number of alignments=48 # Reading fragments from alignment file # T0159 read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1qo7A/1qo7A-T0159-fssp-global-adpstyle1.pw.a2m.gz # 1qo7A read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1qo7A/1qo7A-T0159-fssp-global-adpstyle1.pw.a2m.gz # found chain 1qo7A in template set T0159 29 :ITNIAQLKDPKIAKLFDTNGDGKADLTGCNPGWGCEGA 1qo7A 85 :PQFTTEIEGLTIHFAALFSEREDAVPIALLHGWPGSFV Fragment has 16 clashes (null) has 16 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 40 residues other bump:2.72113 Ang OE2(264) at 21.1547 23.1474 50.5449 in (null):E-9999 (36) and CB(273) at 19.904 24.079 48.315 in (null):A-9999 (38) other bump:2.63785 Ang O(232) at 24.634 30.746 54.057 in (null):G-9999 (32) and CB(254) at 22.207 30.0019 53.3398 in (null):C-9999 (35) other bump:3.03023 Ang CG2(6) at 24.0104 24.3644 34.2994 in (null):I-9999 (1) and CZ(126) at 25.8553 26.6919 33.6983 in (null):F-9999 (16) other bump:2.32251 Ang ND2(21) at 27.4219 25.8228 35.1762 in (null):N-9999 (3) and CZ(126) at 25.8553 26.6919 33.6983 in (null):F-9999 (16) other bump:2.76222 Ang CG(20) at 28.3055 24.8454 35.2874 in (null):N-9999 (3) and CE2(125) at 26.2834 26.7083 35.0224 in (null):F-9999 (16) other bump:1.45059 Ang ND2(21) at 27.4219 25.8228 35.1762 in (null):N-9999 (3) and CE2(125) at 26.2834 26.7083 35.0224 in (null):F-9999 (16) other bump:2.58895 Ang ND2(21) at 27.4219 25.8228 35.1762 in (null):N-9999 (3) and CD2(123) at 25.6262 27.518 35.9535 in (null):F-9999 (16) other bump:2.70388 Ang OG1(14) at 24.2665 21.8997 39.8765 in (null):T-9999 (2) and CD2(115) at 23.2696 23.9087 41.3868 in (null):L-9999 (15) other bump:2.24866 Ang CD1(51) at 35.398 31.2462 41.9093 in (null):L-9999 (7) and CG1(91) at 35.215 29.495 43.308 in (null):I-9999 (12) other bump:2.8646 Ang CD1(51) at 35.398 31.2462 41.9093 in (null):L-9999 (7) and CB(90) at 34.066 28.799 42.575 in (null):I-9999 (12) other bump:2.01744 Ang O(53) at 40.062 30.473 43.162 in (null):L-9999 (7) and CD(76) at 41.0268 29.4351 44.5979 in (null):P-9999 (10) other bump:3.03413 Ang C(54) at 40.327 30.935 42.055 in (null):L-9999 (7) and CD(76) at 41.0268 29.4351 44.5979 in (null):P-9999 (10) other bump:3.25165 Ang CA(56) at 42.526 31.675 42.779 in (null):K-9999 (8) and CD(76) at 41.0268 29.4351 44.5979 in (null):P-9999 (10) other bump:2.34691 Ang C(63) at 42.871 30.367 43.485 in (null):K-9999 (8) and CD(76) at 41.0268 29.4351 44.5979 in (null):P-9999 (10) neighbor-bump: 2.58554 Ang N(64) at 42.823 29.264 42.746 in (null):D-9999 (9) and CD(76) at 41.0268 29.4351 44.5979 in (null):P-9999 (10) other bump:2.34154 Ang O(62) at 43.179 30.354 44.679 in (null):K-9999 (8) and CD(76) at 41.0268 29.4351 44.5979 in (null):P-9999 (10) T0159 67 :INHQLAAYELT 1qo7A 140 :LPFHLVVPSLP Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 13 residues other bump:1.92849 Ang CE1(61) at 29.4607 33.5218 46.3387 in (null):Y-9999 (8) and CD2(81) at 29.555 33.818 48.242 in (null):L-9999 (10) other bump:2.54615 Ang CZ(63) at 28.9919 34.7633 45.9459 in (null):Y-9999 (8) and CD2(81) at 29.555 33.818 48.242 in (null):L-9999 (10) other bump:2.50421 Ang OH(64) at 29.1227 35.8267 46.8105 in (null):Y-9999 (8) and CD2(81) at 29.555 33.818 48.242 in (null):L-9999 (10) T0159 78 :NTVTHNQGNYAAMMADTISR 1qo7A 164 :FGLMDNARVVDQLMKDLGFG Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 22 residues neighbor-bump: 2.86417 Ang C(127) at 30.617 34.963 31.643 in (null):T-9999 (17) and CG1(131) at 31.653 34.8781 28.9741 in (null):I-9999 (18) neighbor-bump: 1.99859 Ang O(126) at 29.636 34.786 30.916 in (null):T-9999 (17) and CB(130) at 30.5121 35.8135 29.4426 in (null):I-9999 (18) neighbor-bump: 2.36142 Ang C(127) at 30.617 34.963 31.643 in (null):T-9999 (17) and CB(130) at 30.5121 35.8135 29.4426 in (null):I-9999 (18) other bump:2.85157 Ang N(10) at 38.641 36.854 54.087 in (null):T-9999 (2) and CD2(35) at 40.4326 37.9629 52.1655 in (null):H-9999 (5) other bump:2.7216 Ang OG1(14) at 38.6287 39.5781 53.4082 in (null):T-9999 (2) and CD2(35) at 40.4326 37.9629 52.1655 in (null):H-9999 (5) other bump:2.61181 Ang OD1(7) at 39.8839 34.8213 51.1283 in (null):N-9999 (1) and CB(33) at 38.91 37.082 50.2551 in (null):H-9999 (5) T0159 98 :YKEGKPVFYYTWT 1qo7A 306 :SFPRAIHTYRETT Fragment has 9 clashes (null) has 9 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues other bump:2.18881 Ang O(57) at 35.892 34.688 58.992 in (null):V-9999 (7) and CE2(89) at 37.9642 35.1359 59.5365 in (null):Y-9999 (10) other bump:2.45642 Ang O(57) at 35.892 34.688 58.992 in (null):V-9999 (7) and CD2(87) at 37.4043 35.4074 60.789 in (null):Y-9999 (10) neighbor-bump: 2.29043 Ang N(36) at 33.006 27.386 56.531 in (null):K-9999 (5) and CD(49) at 32.2589 28.1906 58.5411 in (null):P-9999 (6) neighbor-bump: 2.35582 Ang CA(37) at 32.136 28.508 56.21 in (null):K-9999 (5) and CD(49) at 32.2589 28.1906 58.5411 in (null):P-9999 (6) other bump:2.29295 Ang O(21) at 32.029 26.082 59.412 in (null):K-9999 (2) and CD(49) at 32.2589 28.1906 58.5411 in (null):P-9999 (6) self-bump: 1.26461 Ang N(45) at 32.443 29.438 58.444 in (null):P-9999 (6) and CD(49) at 32.2589 28.1906 58.5411 in (null):P-9999 (6) neighbor-bump: 2.02191 Ang C(44) at 32.11 29.682 57.184 in (null):K-9999 (5) and CD(49) at 32.2589 28.1906 58.5411 in (null):P-9999 (6) other bump:2.1334 Ang O(21) at 32.029 26.082 59.412 in (null):K-9999 (2) and CG(48) at 31.7846 28.1236 59.9808 in (null):P-9999 (6) self-bump: 2.12674 Ang N(45) at 32.443 29.438 58.444 in (null):P-9999 (6) and CG(48) at 31.7846 28.1236 59.9808 in (null):P-9999 (6) T0159 120 :PGKD 1qo7A 330 :LQKE Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 6 residues self-bump: 1.38537 Ang N(2) at 28.682 52.699 57.432 in (null):P-9999 (1) and CD(6) at 28.5411 52.121 58.6831 in (null):P-9999 (1) T0159 125 :VWLQVPFSALPGDK 1qo7A 334 :LYIHKPFGFSFFPK Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 16 residues neighbor-bump: 2.86002 Ang CG2(44) at 24.9185 50.3728 41.6022 in (null):V-9999 (5) and CD(51) at 22.841 52.183 40.836 in (null):P-9999 (6) other bump:2.10731 Ang CZ3(19) at 26.6889 57.057 47.3177 in (null):W-9999 (2) and CG(34) at 28.3601 56.398 46.2161 in (null):Q-9999 (4) other bump:2.55509 Ang CE3(16) at 27.1855 56.4781 48.4838 in (null):W-9999 (2) and CG(34) at 28.3601 56.398 46.2161 in (null):Q-9999 (4) other bump:2.84819 Ang CZ3(19) at 26.6889 57.057 47.3177 in (null):W-9999 (2) and CB(33) at 27.7021 55.5584 45.1178 in (null):Q-9999 (4) other bump:2.78397 Ang CZ3(19) at 26.6889 57.057 47.3177 in (null):W-9999 (2) and CA(32) at 26.345 54.915 45.573 in (null):Q-9999 (4) T0159 139 :NADTKLPNGANYG 1qo7A 363 :LVFFRDHAEGGHF Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:2.83632 Ang OD1(7) at 15.7371 51.9042 48.6186 in (null):N-9999 (1) and CG2(26) at 13.5503 50.9039 50.1226 in (null):T-9999 (4) Number of specific fragments= 7 total=249 Number of alignments=49 # Reading fragments from alignment file # T0159 read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1qo7A/1qo7A-T0159-fssp-global-adpstyle5.pw.a2m.gz # 1qo7A read from /projects/compbio/experiments/casp5/t0159/t0159-80-230/1qo7A/1qo7A-T0159-fssp-global-adpstyle5.pw.a2m.gz # found chain 1qo7A in template set T0159 1 :KKFY 1qo7A 3 :KAFA Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 5 residues other bump:2.23241 Ang N(0) at 19.817 19.751 30.128 in (null):K-9999 (0) and CE2(36) at 20.7857 20.8089 31.8386 in (null):Y-9999 (3) other bump:2.42908 Ang CA(1) at 20.757 20.664 29.414 in (null):K-9999 (0) and CE2(36) at 20.7857 20.8089 31.8386 in (null):Y-9999 (3) other bump:3.08655 Ang C(8) at 20.095 22.002 29.077 in (null):K-9999 (0) and CE2(36) at 20.7857 20.8089 31.8386 in (null):Y-9999 (3) other bump:2.80933 Ang N(0) at 19.817 19.751 30.128 in (null):K-9999 (0) and CD2(34) at 21.7204 21.5534 31.1384 in (null):Y-9999 (3) other bump:2.16624 Ang CA(1) at 20.757 20.664 29.414 in (null):K-9999 (0) and CD2(34) at 21.7204 21.5534 31.1384 in (null):Y-9999 (3) other bump:2.66314 Ang C(8) at 20.095 22.002 29.077 in (null):K-9999 (0) and CD2(34) at 21.7204 21.5534 31.1384 in (null):Y-9999 (3) other bump:3.21486 Ang C(8) at 20.095 22.002 29.077 in (null):K-9999 (0) and CG(32) at 22.0285 22.8717 31.4937 in (null):Y-9999 (3) T0159 5 :REG 1qo7A 86 :QFT Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 5 residues T0159 8 :VFVNGA 1qo7A 112 :ALLHGW Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 8 residues T0159 14 :AQGYLID 1qo7A 119 :GSFVEFY Fragment has 11 clashes (null) has 11 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 9 residues other bump:2.22309 Ang OE1(12) at 21.3391 23.8334 52.4207 in (null):Q-9999 (2) and CZ(28) at 19.1271 24.0135 52.5509 in (null):Y-9999 (4) other bump:2.46045 Ang CG(10) at 22.0734 25.3997 50.8 in (null):Q-9999 (2) and CE2(27) at 20.399 24.1791 52.1268 in (null):Y-9999 (4) other bump:1.72581 Ang CD(11) at 21.9459 24.0249 51.3773 in (null):Q-9999 (2) and CE2(27) at 20.399 24.1791 52.1268 in (null):Y-9999 (4) other bump:2.81248 Ang NE2(13) at 22.5566 23.0542 50.7163 in (null):Q-9999 (2) and CE2(27) at 20.399 24.1791 52.1268 in (null):Y-9999 (4) other bump:1.04381 Ang OE1(12) at 21.3391 23.8334 52.4207 in (null):Q-9999 (2) and CE2(27) at 20.399 24.1791 52.1268 in (null):Y-9999 (4) other bump:1.83087 Ang CG(10) at 22.0734 25.3997 50.8 in (null):Q-9999 (2) and CD2(25) at 20.689 24.2025 50.752 in (null):Y-9999 (4) other bump:1.41507 Ang CD(11) at 21.9459 24.0249 51.3773 in (null):Q-9999 (2) and CD2(25) at 20.689 24.2025 50.752 in (null):Y-9999 (4) other bump:2.19272 Ang NE2(13) at 22.5566 23.0542 50.7163 in (null):Q-9999 (2) and CD2(25) at 20.689 24.2025 50.752 in (null):Y-9999 (4) other bump:1.82847 Ang OE1(12) at 21.3391 23.8334 52.4207 in (null):Q-9999 (2) and CD2(25) at 20.689 24.2025 50.752 in (null):Y-9999 (4) other bump:2.91571 Ang CG(10) at 22.0734 25.3997 50.8 in (null):Q-9999 (2) and CG(23) at 19.6856 24.048 49.8139 in (null):Y-9999 (4) other bump:2.74845 Ang CD(11) at 21.9459 24.0249 51.3773 in (null):Q-9999 (2) and CG(23) at 19.6856 24.048 49.8139 in (null):Y-9999 (4) T0159 31 :NIAQL 1qo7A 126 :PILQL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 7 residues T0159 38 :PKIAKLF 1qo7A 175 :QLMKDLG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 9 residues T0159 48 :GDGKADLTGCNPG 1qo7A 182 :FGSGYIIQGGDIG Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues neighbor-bump: 2.36129 Ang CB(67) at 22.5724 35.8416 55.7606 in (null):N-9999 (11) and CD(77) at 24.9004 35.4462 55.7586 in (null):P-9999 (12) neighbor-bump: 3.30249 Ang SG(62) at 18.8578 36.8993 53.7592 in (null):C-9999 (10) and ND2(69) at 20.4707 34.645 55.5545 in (null):N-9999 (11) neighbor-bump: 2.19706 Ang O(16) at 28.397 46.25 32.101 in (null):G-9999 (3) and CB(20) at 26.9337 45.823 33.6833 in (null):K-9999 (4) neighbor-bump: 2.61198 Ang C(17) at 28.977 45.163 32.196 in (null):G-9999 (3) and CB(20) at 26.9337 45.823 33.6833 in (null):K-9999 (4) T0159 70 :QLAAYELTNTVTHNQGNYAAMMADT 1qo7A 237 :GIARMEKFMTDGLAYAMEHSTRPST Fragment has 16 clashes (null) has 16 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 27 residues other bump:2.48778 Ang CE2(140) at 32.3661 27.2692 68.7395 in (null):Y-9999 (18) and CA(192) at 33.259 25.312 67.49 in (null):G-9999 (26) other bump:2.90407 Ang CZ(141) at 33.2106 27.0591 69.8093 in (null):Y-9999 (18) and CA(192) at 33.259 25.312 67.49 in (null):G-9999 (26) other bump:2.55809 Ang OH(142) at 34.0269 25.9416 69.8475 in (null):Y-9999 (18) and CA(192) at 33.259 25.312 67.49 in (null):G-9999 (26) other bump:2.89123 Ang CE2(140) at 32.3661 27.2692 68.7395 in (null):Y-9999 (18) and N(191) at 34.615 25.672 67.873 in (null):G-9999 (26) other bump:2.76505 Ang CZ(141) at 33.2106 27.0591 69.8093 in (null):Y-9999 (18) and N(191) at 34.615 25.672 67.873 in (null):G-9999 (26) other bump:2.07778 Ang OH(142) at 34.0269 25.9416 69.8475 in (null):Y-9999 (18) and N(191) at 34.615 25.672 67.873 in (null):G-9999 (26) other bump:2.46906 Ang OH(142) at 34.0269 25.9416 69.8475 in (null):Y-9999 (18) and C(190) at 35.459 24.717 68.252 in (null):T-9999 (25) other bump:2.74696 Ang OH(142) at 34.0269 25.9416 69.8475 in (null):Y-9999 (18) and CB(186) at 36.767 25.879 70.031 in (null):T-9999 (25) other bump:2.16862 Ang ND2(69) at 22.0672 42.539 66.7105 in (null):N-9999 (9) and CE1(100) at 23.0114 40.5872 66.6655 in (null):H-9999 (13) other bump:3.03373 Ang CA(66) at 21.888 41.519 69.325 in (null):N-9999 (9) and CE1(100) at 23.0114 40.5872 66.6655 in (null):H-9999 (13) other bump:3.14043 Ang CA(66) at 21.888 41.519 69.325 in (null):N-9999 (9) and ND1(99) at 23.9338 40.0663 67.4364 in (null):H-9999 (13) other bump:2.85847 Ang CA(59) at 18.749 39.476 68.644 in (null):T-9999 (8) and CB(89) at 19.1847 36.694 69.1354 in (null):T-9999 (12) other bump:2.99237 Ang CG(53) at 15.2696 39.3372 71.9465 in (null):L-9999 (7) and CG2(84) at 17.5316 37.695 73.0146 in (null):V-9999 (11) other bump:2.55369 Ang CD1(54) at 15.6189 39.3344 73.4329 in (null):L-9999 (7) and CG2(84) at 17.5316 37.695 73.0146 in (null):V-9999 (11) other bump:2.68494 Ang CD1(33) at 19.3772 45.7779 66.2048 in (null):Y-9999 (5) and OD1(70) at 21.5591 44.6528 67.2922 in (null):N-9999 (9) other bump:2.0136 Ang CE1(35) at 20.7219 45.908 65.9588 in (null):Y-9999 (5) and OD1(70) at 21.5591 44.6528 67.2922 in (null):N-9999 (9) T0159 96 :S 1qo7A 295 :L Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 3 residues T0159 97 :RYKEGKPVFYYTWT 1qo7A 305 :ESFPRAIHTYRETT Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 16 residues other bump:2.18881 Ang O(68) at 35.892 34.688 58.992 in (null):V-9999 (8) and CE2(100) at 37.9642 35.1359 59.5365 in (null):Y-9999 (11) other bump:2.45642 Ang O(68) at 35.892 34.688 58.992 in (null):V-9999 (8) and CD2(98) at 37.4043 35.4074 60.789 in (null):Y-9999 (11) other bump:2.29295 Ang O(32) at 32.029 26.082 59.412 in (null):K-9999 (3) and CD(60) at 32.2589 28.1906 58.5411 in (null):P-9999 (7) neighbor-bump: 2.29043 Ang N(47) at 33.006 27.386 56.531 in (null):K-9999 (6) and CD(60) at 32.2589 28.1906 58.5411 in (null):P-9999 (7) neighbor-bump: 2.35582 Ang CA(48) at 32.136 28.508 56.21 in (null):K-9999 (6) and CD(60) at 32.2589 28.1906 58.5411 in (null):P-9999 (7) neighbor-bump: 2.02191 Ang C(55) at 32.11 29.682 57.184 in (null):K-9999 (6) and CD(60) at 32.2589 28.1906 58.5411 in (null):P-9999 (7) self-bump: 1.26461 Ang N(56) at 32.443 29.438 58.444 in (null):P-9999 (7) and CD(60) at 32.2589 28.1906 58.5411 in (null):P-9999 (7) other bump:2.1334 Ang O(32) at 32.029 26.082 59.412 in (null):K-9999 (3) and CG(59) at 31.7846 28.1236 59.9808 in (null):P-9999 (7) self-bump: 2.12674 Ang N(56) at 32.443 29.438 58.444 in (null):P-9999 (7) and CG(59) at 31.7846 28.1236 59.9808 in (null):P-9999 (7) other bump:2.87773 Ang CD1(17) at 28.1968 25.0468 55.957 in (null):Y-9999 (2) and CD(51) at 28.2412 27.9018 55.5989 in (null):K-9999 (6) T0159 120 :PGKDV 1qo7A 330 :LQKEL Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 7 residues other bump:2.89969 Ang CA(3) at 27.677 52.431 56.408 in (null):P-9999 (1) and CG2(34) at 29.6959 50.798 55.1175 in (null):V-9999 (5) other bump:3.04505 Ang C(1) at 29.906 53.098 57.102 in (null):G-9999 (0) and CG2(34) at 29.6959 50.798 55.1175 in (null):V-9999 (5) self-bump: 1.38537 Ang N(2) at 28.682 52.699 57.432 in (null):P-9999 (1) and CD(6) at 28.5411 52.121 58.6831 in (null):P-9999 (1) T0159 126 :WLQVPFSALPGDK 1qo7A 335 :YIHKPFGFSFFPK Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues neighbor-bump: 2.86003 Ang CG2(37) at 24.9185 50.3728 41.6022 in (null):V-9999 (4) and CD(44) at 22.841 52.183 40.836 in (null):P-9999 (5) other bump:2.1636 Ang CZ3(12) at 26.7101 56.9432 47.505 in (null):W-9999 (1) and CG(27) at 28.3601 56.398 46.2161 in (null):Q-9999 (3) other bump:2.74162 Ang CE3(9) at 27.1736 56.3912 48.6876 in (null):W-9999 (1) and CG(27) at 28.3601 56.398 46.2161 in (null):Q-9999 (3) other bump:2.93269 Ang CZ3(12) at 26.7101 56.9432 47.505 in (null):W-9999 (1) and CB(26) at 27.7021 55.5584 45.1178 in (null):Q-9999 (3) other bump:2.82478 Ang CZ3(12) at 26.7101 56.9432 47.505 in (null):W-9999 (1) and CA(25) at 26.345 54.915 45.573 in (null):Q-9999 (3) T0159 139 :NADTKLPNGANYG 1qo7A 363 :LVFFRDHAEGGHF Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:2.83632 Ang OD1(7) at 15.7371 51.9042 48.6186 in (null):N-9999 (1) and CG2(26) at 13.5503 50.9039 50.1226 in (null):T-9999 (4) Number of specific fragments= 13 total=262 Number of alignments=50 # command:superimposing iter= 0 total_weight= 242 weighted rmsd= 0 superimposing iter= 1 total_weight= 2420 weighted rmsd= 0 superimposing iter= 2 total_weight= 2420 weighted rmsd= 0 superimposing iter= 3 total_weight= 2420 weighted rmsd= 0 superimposing iter= 4 total_weight= 2420 weighted rmsd= 0 superimposing iter= 5 total_weight= 2420 weighted rmsd= 0 superimposing iter= 0 total_weight= 242 weighted rmsd= 0.0601691 superimposing iter= 1 total_weight= 2390.1 weighted rmsd= 0.00217014 superimposing iter= 2 total_weight= 2390 weighted rmsd= 7.69048e-05 superimposing iter= 3 total_weight= 2390 weighted rmsd= 3.57039e-06 superimposing iter= 4 total_weight= 886.228 weighted rmsd= 1.47717e-06 superimposing iter= 5 total_weight= 714.405 weighted rmsd= 1.90941e-06 superimposing iter= 0 total_weight= 236 weighted rmsd= 5.82826 superimposing iter= 1 total_weight= 693.334 weighted rmsd= 3.1687 superimposing iter= 2 total_weight= 419.125 weighted rmsd= 2.29856 superimposing iter= 3 total_weight= 310.072 weighted rmsd= 1.95802 superimposing iter= 4 total_weight= 268.965 weighted rmsd= 1.79616 superimposing iter= 5 total_weight= 249.417 weighted rmsd= 1.7133 superimposing iter= 0 total_weight= 234 weighted rmsd= 5.83557 superimposing iter= 1 total_weight= 673.422 weighted rmsd= 3.202 superimposing iter= 2 total_weight= 415.253 weighted rmsd= 2.31682 superimposing iter= 3 total_weight= 313.328 weighted rmsd= 1.95186 superimposing iter= 4 total_weight= 269.973 weighted rmsd= 1.77856 superimposing iter= 5 total_weight= 248.581 weighted rmsd= 1.69178 superimposing iter= 0 total_weight= 198 weighted rmsd= 6.02329 superimposing iter= 1 total_weight= 396.883 weighted rmsd= 4.18649 superimposing iter= 2 total_weight= 223.774 weighted rmsd= 3.91684 superimposing iter= 3 total_weight= 202.526 weighted rmsd= 3.85349 superimposing iter= 4 total_weight= 204.132 weighted rmsd= 3.77492 superimposing iter= 5 total_weight= 209.256 weighted rmsd= 3.65167 superimposing iter= 0 total_weight= 0 weighted rmsd= nan superimposing iter= 1 total_weight= 0 weighted rmsd= nan superimposing iter= 2 total_weight= 0 weighted rmsd= nan superimposing iter= 3 total_weight= 0 weighted rmsd= nan superimposing iter= 4 total_weight= 0 weighted rmsd= nan superimposing iter= 5 total_weight= 0 weighted rmsd= nan superimposing iter= 0 total_weight= 236 weighted rmsd= 5.701 superimposing iter= 1 total_weight= 713.689 weighted rmsd= 3.0494 superimposing iter= 2 total_weight= 430.892 weighted rmsd= 2.17814 superimposing iter= 3 total_weight= 319.603 weighted rmsd= 1.82668 superimposing iter= 4 total_weight= 274.71 weighted rmsd= 1.65812 superimposing iter= 5 total_weight= 255.163 weighted rmsd= 1.56445 superimposing iter= 0 total_weight= 234 weighted rmsd= 5.68948 superimposing iter= 1 total_weight= 699.542 weighted rmsd= 3.06195 superimposing iter= 2 total_weight= 425.488 weighted rmsd= 2.18837 superimposing iter= 3 total_weight= 319.124 weighted rmsd= 1.82624 superimposing iter= 4 total_weight= 274.056 weighted rmsd= 1.65126 superimposing iter= 5 total_weight= 253.855 weighted rmsd= 1.55459 superimposing iter= 0 total_weight= 235 weighted rmsd= 7.78237 superimposing iter= 1 total_weight= 824.067 weighted rmsd= 3.58778 superimposing iter= 2 total_weight= 741.246 weighted rmsd= 1.81496 superimposing iter= 3 total_weight= 575.902 weighted rmsd= 1.09141 superimposing iter= 4 total_weight= 409.27 weighted rmsd= 0.807297 superimposing iter= 5 total_weight= 303.152 weighted rmsd= 0.701581 superimposing iter= 0 total_weight= 235 weighted rmsd= 7.78237 superimposing iter= 1 total_weight= 824.067 weighted rmsd= 3.58778 superimposing iter= 2 total_weight= 741.246 weighted rmsd= 1.81496 superimposing iter= 3 total_weight= 575.902 weighted rmsd= 1.09141 superimposing iter= 4 total_weight= 409.27 weighted rmsd= 0.807297 superimposing iter= 5 total_weight= 303.152 weighted rmsd= 0.701581 superimposing iter= 0 total_weight= 235 weighted rmsd= 7.85015 superimposing iter= 1 total_weight= 818.321 weighted rmsd= 3.6363 superimposing iter= 2 total_weight= 726.64 weighted rmsd= 1.86298 superimposing iter= 3 total_weight= 559.925 weighted rmsd= 1.13903 superimposing iter= 4 total_weight= 406.002 weighted rmsd= 0.849245 superimposing iter= 5 total_weight= 289.829 weighted rmsd= 0.755437 superimposing iter= 0 total_weight= 242 weighted rmsd= 7.37727 superimposing iter= 1 total_weight= 740.188 weighted rmsd= 3.9998 superimposing iter= 2 total_weight= 351.921 weighted rmsd= 3.2701 superimposing iter= 3 total_weight= 296.249 weighted rmsd= 2.92231 superimposing iter= 4 total_weight= 295.367 weighted rmsd= 2.61181 superimposing iter= 5 total_weight= 285.712 weighted rmsd= 2.36933 superimposing iter= 0 total_weight= 132 weighted rmsd= 5.08153 superimposing iter= 1 total_weight= 388.866 weighted rmsd= 2.8443 superimposing iter= 2 total_weight= 194.029 weighted rmsd= 2.32326 superimposing iter= 3 total_weight= 147.282 weighted rmsd= 2.18669 superimposing iter= 4 total_weight= 137.457 weighted rmsd= 2.13085 superimposing iter= 5 total_weight= 132.835 weighted rmsd= 2.11061 superimposing iter= 0 total_weight= 126 weighted rmsd= 4.91642 superimposing iter= 1 total_weight= 384.138 weighted rmsd= 2.71543 superimposing iter= 2 total_weight= 179.766 weighted rmsd= 2.25283 superimposing iter= 3 total_weight= 141.401 weighted rmsd= 2.11327 superimposing iter= 4 total_weight= 131.131 weighted rmsd= 2.05754 superimposing iter= 5 total_weight= 127.887 weighted rmsd= 2.02746 superimposing iter= 0 total_weight= 173 weighted rmsd= 5.4856 superimposing iter= 1 total_weight= 412.127 weighted rmsd= 3.47228 superimposing iter= 2 total_weight= 230.772 weighted rmsd= 2.98248 superimposing iter= 3 total_weight= 199.903 weighted rmsd= 2.76177 superimposing iter= 4 total_weight= 188.022 weighted rmsd= 2.63572 superimposing iter= 5 total_weight= 183.334 weighted rmsd= 2.54348 superimposing iter= 0 total_weight= 173 weighted rmsd= 5.4856 superimposing iter= 1 total_weight= 412.127 weighted rmsd= 3.47228 superimposing iter= 2 total_weight= 230.772 weighted rmsd= 2.98248 superimposing iter= 3 total_weight= 199.903 weighted rmsd= 2.76177 superimposing iter= 4 total_weight= 188.022 weighted rmsd= 2.63572 superimposing iter= 5 total_weight= 183.334 weighted rmsd= 2.54348 superimposing iter= 0 total_weight= 242 weighted rmsd= 0.0601691 superimposing iter= 1 total_weight= 2390.1 weighted rmsd= 0.00217014 superimposing iter= 2 total_weight= 2390 weighted rmsd= 7.69048e-05 superimposing iter= 3 total_weight= 2390 weighted rmsd= 3.57039e-06 superimposing iter= 4 total_weight= 886.228 weighted rmsd= 1.47717e-06 superimposing iter= 5 total_weight= 714.405 weighted rmsd= 1.90941e-06 superimposing iter= 0 total_weight= 242 weighted rmsd= 0.0601691 superimposing iter= 1 total_weight= 2390.1 weighted rmsd= 0.00217014 superimposing iter= 2 total_weight= 2390 weighted rmsd= 7.69048e-05 superimposing iter= 3 total_weight= 2390 weighted rmsd= 3.57039e-06 superimposing iter= 4 total_weight= 886.228 weighted rmsd= 1.47717e-06 superimposing iter= 5 total_weight= 714.405 weighted rmsd= 1.90941e-06 superimposing iter= 0 total_weight= 234 weighted rmsd= 5.83557 superimposing iter= 1 total_weight= 673.422 weighted rmsd= 3.202 superimposing iter= 2 total_weight= 415.253 weighted rmsd= 2.31682 superimposing iter= 3 total_weight= 313.328 weighted rmsd= 1.95186 superimposing iter= 4 total_weight= 269.973 weighted rmsd= 1.77856 superimposing iter= 5 total_weight= 248.581 weighted rmsd= 1.69178 superimposing iter= 0 total_weight= 236 weighted rmsd= 5.82826 superimposing iter= 1 total_weight= 693.334 weighted rmsd= 3.1687 superimposing iter= 2 total_weight= 419.125 weighted rmsd= 2.29856 superimposing iter= 3 total_weight= 310.072 weighted rmsd= 1.95802 superimposing iter= 4 total_weight= 268.965 weighted rmsd= 1.79616 superimposing iter= 5 total_weight= 249.417 weighted rmsd= 1.7133 superimposing iter= 0 total_weight= 198 weighted rmsd= 6.02329 superimposing iter= 1 total_weight= 396.883 weighted rmsd= 4.18649 superimposing iter= 2 total_weight= 223.774 weighted rmsd= 3.91684 superimposing iter= 3 total_weight= 202.526 weighted rmsd= 3.85349 superimposing iter= 4 total_weight= 204.132 weighted rmsd= 3.77492 superimposing iter= 5 total_weight= 209.256 weighted rmsd= 3.65167 superimposing iter= 0 total_weight= 224 weighted rmsd= 12.7714 superimposing iter= 1 total_weight= 429.534 weighted rmsd= 8.7232 superimposing iter= 2 total_weight= 383.057 weighted rmsd= 6.31504 superimposing iter= 3 total_weight= 456.938 weighted rmsd= 4.10168 superimposing iter= 4 total_weight= 552.24 weighted rmsd= 2.40069 superimposing iter= 5 total_weight= 501.504 weighted rmsd= 1.51068 superimposing iter= 0 total_weight= 236 weighted rmsd= 5.701 superimposing iter= 1 total_weight= 713.689 weighted rmsd= 3.0494 superimposing iter= 2 total_weight= 430.892 weighted rmsd= 2.17814 superimposing iter= 3 total_weight= 319.603 weighted rmsd= 1.82668 superimposing iter= 4 total_weight= 274.71 weighted rmsd= 1.65812 superimposing iter= 5 total_weight= 255.163 weighted rmsd= 1.56445 superimposing iter= 0 total_weight= 234 weighted rmsd= 5.68948 superimposing iter= 1 total_weight= 699.542 weighted rmsd= 3.06195 superimposing iter= 2 total_weight= 425.488 weighted rmsd= 2.18837 superimposing iter= 3 total_weight= 319.124 weighted rmsd= 1.82624 superimposing iter= 4 total_weight= 274.056 weighted rmsd= 1.65126 superimposing iter= 5 total_weight= 253.855 weighted rmsd= 1.55459 superimposing iter= 0 total_weight= 242 weighted rmsd= 8.09993 superimposing iter= 1 total_weight= 811.556 weighted rmsd= 3.78763 superimposing iter= 2 total_weight= 738.74 weighted rmsd= 1.97035 superimposing iter= 3 total_weight= 555.321 weighted rmsd= 1.21687 superimposing iter= 4 total_weight= 437.79 weighted rmsd= 0.874435 superimposing iter= 5 total_weight= 334.541 weighted rmsd= 0.731803 superimposing iter= 0 total_weight= 242 weighted rmsd= 8.09993 superimposing iter= 1 total_weight= 811.556 weighted rmsd= 3.78763 superimposing iter= 2 total_weight= 738.74 weighted rmsd= 1.97035 superimposing iter= 3 total_weight= 555.321 weighted rmsd= 1.21687 superimposing iter= 4 total_weight= 437.79 weighted rmsd= 0.874435 superimposing iter= 5 total_weight= 334.541 weighted rmsd= 0.731803 superimposing iter= 0 total_weight= 242 weighted rmsd= 8.16318 superimposing iter= 1 total_weight= 802.853 weighted rmsd= 3.84077 superimposing iter= 2 total_weight= 728.721 weighted rmsd= 2.01471 superimposing iter= 3 total_weight= 544.802 weighted rmsd= 1.26049 superimposing iter= 4 total_weight= 435.127 weighted rmsd= 0.91232 superimposing iter= 5 total_weight= 319.565 weighted rmsd= 0.782641 superimposing iter= 0 total_weight= 242 weighted rmsd= 8.16318 superimposing iter= 1 total_weight= 802.853 weighted rmsd= 3.84077 superimposing iter= 2 total_weight= 728.721 weighted rmsd= 2.01471 superimposing iter= 3 total_weight= 544.802 weighted rmsd= 1.26049 superimposing iter= 4 total_weight= 435.127 weighted rmsd= 0.91232 superimposing iter= 5 total_weight= 319.565 weighted rmsd= 0.782641 superimposing iter= 0 total_weight= 212 weighted rmsd= 9.58656 superimposing iter= 1 total_weight= 375.269 weighted rmsd= 7.06168 superimposing iter= 2 total_weight= 250.973 weighted rmsd= 6.40545 superimposing iter= 3 total_weight= 238.5 weighted rmsd= 5.98576 superimposing iter= 4 total_weight= 230.947 weighted rmsd= 5.70014 superimposing iter= 5 total_weight= 222.671 weighted rmsd= 5.53514 superimposing iter= 0 total_weight= 242 weighted rmsd= 5.59812 superimposing iter= 1 total_weight= 760.611 weighted rmsd= 3.03122 superimposing iter= 2 total_weight= 345.161 weighted rmsd= 2.51309 superimposing iter= 3 total_weight= 261.093 weighted rmsd= 2.4072 superimposing iter= 4 total_weight= 243.653 weighted rmsd= 2.38975 superimposing iter= 5 total_weight= 239.652 weighted rmsd= 2.39245 superimposing iter= 0 total_weight= 228 weighted rmsd= 8.45418 superimposing iter= 1 total_weight= 487.972 weighted rmsd= 5.66603 superimposing iter= 2 total_weight= 269.11 weighted rmsd= 5.19028 superimposing iter= 3 total_weight= 239.942 weighted rmsd= 5.03894 superimposing iter= 4 total_weight= 240.391 weighted rmsd= 4.88925 superimposing iter= 5 total_weight= 239.981 weighted rmsd= 4.74431 superimposing iter= 0 total_weight= 242 weighted rmsd= 9.08266 superimposing iter= 1 total_weight= 475.145 weighted rmsd= 6.37828 superimposing iter= 2 total_weight= 273.877 weighted rmsd= 5.96848 superimposing iter= 3 total_weight= 247.976 weighted rmsd= 5.87877 superimposing iter= 4 total_weight= 244.071 weighted rmsd= 5.8405 superimposing iter= 5 total_weight= 243.14 weighted rmsd= 5.81634 superimposing iter= 0 total_weight= 232 weighted rmsd= 6.67747 superimposing iter= 1 total_weight= 734.112 weighted rmsd= 3.25795 superimposing iter= 2 total_weight= 463.157 weighted rmsd= 2.24134 superimposing iter= 3 total_weight= 324.828 weighted rmsd= 1.87025 superimposing iter= 4 total_weight= 285.958 weighted rmsd= 1.66841 superimposing iter= 5 total_weight= 263.089 weighted rmsd= 1.55119 superimposing iter= 0 total_weight= 242 weighted rmsd= 21.3943 superimposing iter= 1 total_weight= 1714.48 weighted rmsd= 5.92174 superimposing iter= 2 total_weight= 754.159 weighted rmsd= 3.2296 superimposing iter= 3 total_weight= 341.829 weighted rmsd= 2.68858 superimposing iter= 4 total_weight= 268.749 weighted rmsd= 2.53285 superimposing iter= 5 total_weight= 257.04 weighted rmsd= 2.44454 superimposing iter= 0 total_weight= 235 weighted rmsd= 1.62959 superimposing iter= 1 total_weight= 1989.61 weighted rmsd= 0.215011 superimposing iter= 2 total_weight= 2050.7 weighted rmsd= 0.0263732 superimposing iter= 3 total_weight= 2040.2 weighted rmsd= 0.00325159 superimposing iter= 4 total_weight= 2040 weighted rmsd= 0.000400853 superimposing iter= 5 total_weight= 2040 weighted rmsd= 4.95226e-05 superimposing iter= 0 total_weight= 242 weighted rmsd= 0.0601691 superimposing iter= 1 total_weight= 2390.1 weighted rmsd= 0.00217014 superimposing iter= 2 total_weight= 2390 weighted rmsd= 7.69048e-05 superimposing iter= 3 total_weight= 2390 weighted rmsd= 3.57039e-06 superimposing iter= 4 total_weight= 886.228 weighted rmsd= 1.47717e-06 superimposing iter= 5 total_weight= 714.405 weighted rmsd= 1.90941e-06 superimposing iter= 0 total_weight= 224 weighted rmsd= 8.48263 superimposing iter= 1 total_weight= 604.144 weighted rmsd= 4.84811 superimposing iter= 2 total_weight= 322.323 weighted rmsd= 3.95671 superimposing iter= 3 total_weight= 271 weighted rmsd= 3.55984 superimposing iter= 4 total_weight= 249.805 weighted rmsd= 3.34628 superimposing iter= 5 total_weight= 242.94 weighted rmsd= 3.19408 superimposing iter= 0 total_weight= 224 weighted rmsd= 8.62746 superimposing iter= 1 total_weight= 673.101 weighted rmsd= 4.65405 superimposing iter= 2 total_weight= 336.409 weighted rmsd= 3.73526 superimposing iter= 3 total_weight= 262.494 weighted rmsd= 3.42412 superimposing iter= 4 total_weight= 243.675 weighted rmsd= 3.26525 superimposing iter= 5 total_weight= 240.627 weighted rmsd= 3.1365 superimposing iter= 0 total_weight= 235 weighted rmsd= 0.0610522 superimposing iter= 1 total_weight= 2320.11 weighted rmsd= 0.00223551 superimposing iter= 2 total_weight= 2320 weighted rmsd= 8.04356e-05 superimposing iter= 3 total_weight= 2320 weighted rmsd= 3.81311e-06 superimposing iter= 4 total_weight= 866.624 weighted rmsd= 1.82005e-06 superimposing iter= 5 total_weight= 344.627 weighted rmsd= 2.33529e-06 superimposing iter= 0 total_weight= 235 weighted rmsd= 0.0610522 superimposing iter= 1 total_weight= 2320.11 weighted rmsd= 0.00223551 superimposing iter= 2 total_weight= 2320 weighted rmsd= 8.04356e-05 superimposing iter= 3 total_weight= 2320 weighted rmsd= 3.81311e-06 superimposing iter= 4 total_weight= 866.624 weighted rmsd= 1.82005e-06 superimposing iter= 5 total_weight= 344.627 weighted rmsd= 2.33529e-06 superimposing iter= 0 total_weight= 236 weighted rmsd= 5.82826 superimposing iter= 1 total_weight= 693.334 weighted rmsd= 3.1687 superimposing iter= 2 total_weight= 419.125 weighted rmsd= 2.29856 superimposing iter= 3 total_weight= 310.072 weighted rmsd= 1.95802 superimposing iter= 4 total_weight= 268.965 weighted rmsd= 1.79616 superimposing iter= 5 total_weight= 249.417 weighted rmsd= 1.7133 superimposing iter= 0 total_weight= 234 weighted rmsd= 5.83557 superimposing iter= 1 total_weight= 673.422 weighted rmsd= 3.202 superimposing iter= 2 total_weight= 415.253 weighted rmsd= 2.31682 superimposing iter= 3 total_weight= 313.328 weighted rmsd= 1.95186 superimposing iter= 4 total_weight= 269.973 weighted rmsd= 1.77856 superimposing iter= 5 total_weight= 248.581 weighted rmsd= 1.69178 superimposing iter= 0 total_weight= 235 weighted rmsd= 8.58029 superimposing iter= 1 total_weight= 682.032 weighted rmsd= 4.54654 superimposing iter= 2 total_weight= 495.426 weighted rmsd= 2.96803 superimposing iter= 3 total_weight= 363.512 weighted rmsd= 2.32959 superimposing iter= 4 total_weight= 285.343 weighted rmsd= 2.08491 superimposing iter= 5 total_weight= 252.344 weighted rmsd= 1.98976 superimposing iter= 0 total_weight= 230 weighted rmsd= 8.67196 superimposing iter= 1 total_weight= 579.697 weighted rmsd= 5.03024 superimposing iter= 2 total_weight= 418.154 weighted rmsd= 3.54463 superimposing iter= 3 total_weight= 338.982 weighted rmsd= 2.8115 superimposing iter= 4 total_weight= 297.092 weighted rmsd= 2.41319 superimposing iter= 5 total_weight= 263.078 weighted rmsd= 2.21759 superimposing iter= 0 total_weight= 236 weighted rmsd= 5.701 superimposing iter= 1 total_weight= 713.689 weighted rmsd= 3.0494 superimposing iter= 2 total_weight= 430.892 weighted rmsd= 2.17814 superimposing iter= 3 total_weight= 319.603 weighted rmsd= 1.82668 superimposing iter= 4 total_weight= 274.71 weighted rmsd= 1.65812 superimposing iter= 5 total_weight= 255.163 weighted rmsd= 1.56445 superimposing iter= 0 total_weight= 234 weighted rmsd= 5.68948 superimposing iter= 1 total_weight= 699.542 weighted rmsd= 3.06195 superimposing iter= 2 total_weight= 425.488 weighted rmsd= 2.18837 superimposing iter= 3 total_weight= 319.124 weighted rmsd= 1.82624 superimposing iter= 4 total_weight= 274.056 weighted rmsd= 1.65126 superimposing iter= 5 total_weight= 253.855 weighted rmsd= 1.55459 superimposing iter= 0 total_weight= 235 weighted rmsd= 7.78237 superimposing iter= 1 total_weight= 824.067 weighted rmsd= 3.58778 superimposing iter= 2 total_weight= 741.246 weighted rmsd= 1.81496 superimposing iter= 3 total_weight= 575.902 weighted rmsd= 1.09141 superimposing iter= 4 total_weight= 409.27 weighted rmsd= 0.807297 superimposing iter= 5 total_weight= 303.152 weighted rmsd= 0.701581 superimposing iter= 0 total_weight= 242 weighted rmsd= 8.20938 superimposing iter= 1 total_weight= 820.59 weighted rmsd= 3.81283 superimposing iter= 2 total_weight= 741.924 weighted rmsd= 1.97693 superimposing iter= 3 total_weight= 559.092 weighted rmsd= 1.21651 superimposing iter= 4 total_weight= 438.599 weighted rmsd= 0.873712 superimposing iter= 5 total_weight= 334.419 weighted rmsd= 0.731542 superimposing iter= 0 total_weight= 242 weighted rmsd= 10.6921 superimposing iter= 1 total_weight= 741.14 weighted rmsd= 5.75693 superimposing iter= 2 total_weight= 361.25 weighted rmsd= 4.63266 superimposing iter= 3 total_weight= 268.893 weighted rmsd= 4.34725 superimposing iter= 4 total_weight= 251.812 weighted rmsd= 4.22477 superimposing iter= 5 total_weight= 250.744 weighted rmsd= 4.12402 superimposing iter= 0 total_weight= 234 weighted rmsd= 8.90582 superimposing iter= 1 total_weight= 545.206 weighted rmsd= 5.55348 superimposing iter= 2 total_weight= 313.451 weighted rmsd= 4.71515 superimposing iter= 3 total_weight= 268.644 weighted rmsd= 4.35548 superimposing iter= 4 total_weight= 265.076 weighted rmsd= 4.0669 superimposing iter= 5 total_weight= 255.68 weighted rmsd= 3.87409 # command: