CASP5 Target T0155
-
1. Protein Name
- Probable dihydroneopterin aldolase (DHNA)
-
2. Organism Name
- Mycobacterium tuberculosis
-
3. Number of amino acids (approx)
- 133
-
4. Accession number
- gi3023784
-
5. Sequence Database
- Genbank
-
6. Amino acid sequence
-
MADRIELRGLTVHGRHGVYDHERVAGQRFVIDVTVWIDLAEAANSDDLADTYDYVRLASR
AAEIVAGPPRKLIETVGAEIADHVMDDQRVHAVEVAVHKPQAPIPQTFDDVAVVIRRSRR
GGRGWVVPAGGAV
-
7. Additional Information
-
This protein is a target of Mycobacterium tuberculosis
structural genomics consortium (Rv3607c)
-
8. X-ray structure
- yes
-
9. Current state of the experimental work
- Structure is solved
-
10. Interpretable map?
- yes
-
11. Estimated date of chain tracing completion
- Completed
-
12. Estimated date of public release of structure
- September 2002
-
13. Name
- unavailable until after public release of structure
Related Files
Template Sequence file
Template PDB file