CASP5 Target T0144
-
1. Protein Name
- Cyp
-
2. Organism Name
- Yellow lupine
-
3. Number of amino acids (approx)
- 172
-
4. Accession number
- Y16088
-
5. Sequence Database
- EMBL
-
6. Amino acid sequence
-
MSNPKVFFDMAIAGNPAGRIVMELYADTTPRTAENF
RALCTGEKGVGRSGKPLHYKGSTFHRVIPNFMCQGGDFTAGNGTGAESIYGAKFADENFIKRHTGPGI
LSMANAGAGTNGSQFFICTEKTEWLDGKHVVFGKVIEGMNVVRDIEKVGSGSGKTSRPVTIADCGQLS
-
7. Additional Information
-
8. X-ray structure
- yes
-
9. Current state of the experimental work
-
This is cyclophilin
-
10. Interpretable map?
- no
-
11. Estimated date of chain tracing completion
- 20.07.2002
-
12. Estimated date of public release of structure
- 26.10.2002
-
13. Name
- unavailable until after public release of structure
Related Files
Template Sequence file
Template PDB file