CASP5 Target T0140

1. Protein Name: 1b11
2. Organism Name: Synthetic protein
3. Number of amino acids (approx): 103
4. Accession number
5. Sequence Database
6. Amino acid sequence: MRGSHHHHHHGSRLQSGKMTGIVKWFNADKGFGFITPDDGSKDVFVHFSAGSSGA
AVRGNPQQGDRVEGKIKSITDFGIFIGLDGGIDGLVHLSDISWAQAEA
7. Additional Information: 1b11 is a synthetic protein constructed by non-homologous recombination. The N-terminal part derives from cold shock protein A (CspA), while the C-terminal segment comes from the E.coli 30S ribosomal subunit protein S1. (Riechmann L, Winter G. Novel folded protein domains generated by combinatorial shuffling of polypeptide segments. Proc Natl Acad Sci U S A. 2000 Aug 29;97(18):10068-73.)
Crystallization conditions: include MES pH5.6
The protein is a tetramer under native conditions, but after denaturation, elutes at approximately the molecular weight of dimer on gel filtration.
8. X-ray structure: yes
9. Current state of the experimental work: Completed
10. Interpretable map?: yes
11. Estimated date of chain tracing completion: June
12. Estimated date of public release of structure: September
13. Name: unavailable until after public release of structure