CASP5 Target T0137

1. Protein Name: EgFABP1
2. Organism Name: Echinococcus granulosus
3. Number of amino acids (approx): 133
4. Accession number: Q02970
5. Sequence Database: Swiss-prot
6. Amino acid sequence: MEAFLGTWKMEKSEGFDKIMERLGVDFVTRKMGNLVKPNLIVTDLGGGKYKMRSESTFKT
TECSFKLGEKFKEVTPDSREVASLITVENGVMKHEQDDKTKVTYIERVVEGNELKATVKV
DEVVCVRTYSKVA
7. Additional Information: The protein is included in the heart fatty acid binding group (H-FABP) whose members are believed to be related to lipid oxidation.
The protein is a monomer and there are no disulfide linkages. There is a fatty acid bound to the protein. Unfortunately we are not sure of which fatty acid it is since it is something that was picked up from E.coli during the expression. In the density it looks like a 14C fatty acid.
8. X-ray structure: yes
9. Current state of the experimental work: The structure is solved by MR and refined( R = 18%, Rfree 22% ). The resolution is 1.6Å.
10. Interpretable map?: yes
11. Estimated date of chain tracing completion: Done
12. Estimated date of public release of structure: Sept.2002
13. Name: unavailable until after public release of structure