# command:# Seed set to 1029934156 # command:# Prefix for input files set to # command:# reading script from file define-score.script # Prefix for input files set to /projects/kestrel/users/karplus/burial/undertaker/atoms-inputs/ # reading monomeric-50pc.atoms # After reading monomeric-50pc.atoms have 448 chains in training database # 111547 residues have no bad marker # 670 residues lack atoms needed to compute omega # 322 residues have cis peptide # number of each bad type: # NON_STANDARD_RESIDUE 6 # HAS_OXT 325 # TOO_MANY_ATOMS 1 # TOO_FEW_ATOMS 523 # HAS_UNKNOWN_ATOMS 2 # HAS_DUPLICATE_ATOMS 0 # CHAIN_BREAK_BEFORE 208 # NON_PLANAR_PEPTIDE 28 # Note: may sum to more than number of residues, # because one residue may have multiple problems # Reading rotamer library from monomeric-50pc.rot # Prefix for input files set to /projects/kestrel/users/karplus/burial/undertaker/spots/ # ReadAtomType pdb-name.types Read AtomType pdb-name with 37 types. # ReadClashTable pdb-atom-name.clash # Read ClashTable pdb-atom-name Reading spots from monomeric-50pc-dry-5.spot. Read prototypes from /projects/kestrel/users/karplus/burial/undertaker/spots/../normalize_prototypes/prototypes # reading histogram from smoothed-monomeric-50pc-dry-5.hist # created burial cost function dry5 with radius 5 Reading spots from monomeric-50pc-wet-6.5.spot. Read prototypes from /projects/kestrel/users/karplus/burial/undertaker/spots/../normalize_prototypes/prototypes # reading histogram from smoothed-monomeric-50pc-wet-6.5.hist # created burial cost function wet6.5 with radius 6.5 Reading spots from monomeric-50pc-dry-6.5.spot. Read prototypes from /projects/kestrel/users/karplus/burial/undertaker/spots/../normalize_prototypes/prototypes # reading histogram from smoothed-monomeric-50pc-dry-6.5.hist # created burial cost function dry6.5 with radius 6.5 Reading spots from monomeric-50pc-generic-6.5.spot. Read prototypes from /projects/kestrel/users/karplus/burial/undertaker/spots/../normalize_prototypes/prototypes # reading histogram from smoothed-monomeric-50pc-generic-6.5.hist # created burial cost function gen6.5 with radius 6.5 Reading spots from monomeric-50pc-dry-8.spot. Read prototypes from /projects/kestrel/users/karplus/burial/undertaker/spots/../normalize_prototypes/prototypes # reading histogram from smoothed-monomeric-50pc-dry-8.hist # created burial cost function dry8 with radius 8 Reading spots from monomeric-50pc-dry-10.spot. Read prototypes from /projects/kestrel/users/karplus/burial/undertaker/spots/../normalize_prototypes/prototypes # reading histogram from smoothed-monomeric-50pc-dry-10.hist # created burial cost function dry10 with radius 10 Reading spots from monomeric-50pc-dry-12.spot. Read prototypes from /projects/kestrel/users/karplus/burial/undertaker/spots/../normalize_prototypes/prototypes # reading histogram from smoothed-monomeric-50pc-dry-12.hist # created burial cost function dry12 with radius 12 # reading histogram from monomeric-smoothed-alpha.hist # created alpha cost function alpha with offset 0 and 360 bins # reading histogram from monomeric-smoothed-alpha-1.hist # created alpha cost function alpha_prev with offset -1 and 360 bins CPU_time= 10770 msec, elapsed time= 11979.1 msec) # Prefix for input files set to # Reading target chain from PDB file T0129.blank.pdb Read PDB file T0129.blank.pdb as target. Have 182 residues and 1430 atoms. # No conformations to remove in PopConform # Prefix for input files set to /projects/compbio/lib/alphabet/ # Read 3 alphabets from alpha.alphabet # Prefix for input files set to # reading predictions from T0129.t2k.alpha.rdb # created predicted alpha cost function pred_alpha2 with 360 bins Couldn't open file try42-constraints or try42-constraints.gz for input Trying try42-constraints Couldn't open file try42-constraints or try42-constraints.gz for input # command:# Making generic fragment library # fragment library contains # type length num_fragments num_indexes_used # n-terminus 1 407 20 (100%) # n-terminus 2 408 196 (49%) # middle 1 109496 20 (100%) # middle 2 108592 400 (100%) # middle 3 107719 7822 (97.775%) # middle 4 106865 64233 (40.1456%) # c-terminus 1 408 20 (100%) # c-terminus 2 406 227 (56.75%) # ss-bonds 409 # command:CPU_time= 20970 msec, elapsed time= 22196 msec) # command:# Prefix for input files set to # command:# reading Template.atoms # After reading Template.atoms have 100 chains in template library # command:# reading script from file T0129-undertaker-align.script # Reading fragments from alignment file # T0129 read from /projects/compbio/experiments/casp5/t0129/1iapA/T0129-1iapA-2track-global-adpstyle5.pw.a2m.gz # 1iapA read from /projects/compbio/experiments/casp5/t0129/1iapA/T0129-1iapA-2track-global-adpstyle5.pw.a2m.gz # found chain 1iapA in template set T0129 4 :SHSDLNQ 1iapA 45 :QFQSLEQ Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 9 residues other bump:2.58014 Ang D5.OD1 and Q8.CG T0129 11 :QLKSAGIGFNATELHGFLSGLLCGGLKD 1iapA 62 :LLQHVALQFEPGPLLCCLHADMLGSLGP Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 30 residues T0129 39 :QSWLPLLYQFSNDN 1iapA 94 :KAFLDFYHSFLEKT Fragment has 19 clashes (null) has 19 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 16 residues neighbor-bump: 2.00124 Ang Q10.CD and F11.CZ neighbor-bump: 1.75299 Ang Q10.OE1 and F11.CZ neighbor-bump: 1.83883 Ang Q10.NE2 and F11.CZ neighbor-bump: 2.37591 Ang Q10.CD and F11.CE2 neighbor-bump: 1.54673 Ang Q10.OE1 and F11.CE2 neighbor-bump: 2.72488 Ang Q10.NE2 and F11.CE2 neighbor-bump: 2.35422 Ang Q10.CD and F11.CE1 neighbor-bump: 2.10621 Ang Q10.OE1 and F11.CE1 neighbor-bump: 2.43206 Ang Q10.NE2 and F11.CE1 neighbor-bump: 2.97155 Ang Q10.CD and F11.CD2 neighbor-bump: 1.75743 Ang Q10.OE1 and F11.CD2 neighbor-bump: 2.95267 Ang Q10.CD and F11.CD1 neighbor-bump: 2.26036 Ang Q10.OE1 and F11.CD1 neighbor-bump: 2.12049 Ang Q10.OE1 and F11.CG other bump:2.57011 Ang L5.O and Y9.CD2 other bump:3.09431 Ang S3.C and P6.CD other bump:1.85349 Ang Q2.O and P6.CD other bump:2.9974 Ang Q2.C and P6.CD other bump:2.55214 Ang Q2.O and P6.CG T0129 53 :HAYPTGLVQPV 1iapA 112 :VPVPPNVAFEL Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 13 residues other bump:2.23232 Ang H2.O and Y4.CE1 other bump:3.2237 Ang H2.C and Y4.CE1 other bump:2.158 Ang H2.O and Y4.CD1 T0129 64 :TELYEQISQTLSDVE 1iapA 132 :EDVQRRFVQEVVQSQ Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 17 residues T0129 92 :VFTQADSLSDWANQFLLGIGLAQPELAKEK 1iapA 147 :QVAVGRQLEDFRSKRLMGMTPWEQELAQLE Fragment has 18 clashes (null) has 18 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 32 residues other bump:2.06659 Ang E26.O and E30.OE2 other bump:2.66233 Ang E26.C and E30.OE2 other bump:1.12893 Ang E26.O and E30.OE1 other bump:1.96701 Ang E26.C and E30.OE1 other bump:2.35042 Ang L27.CA and E30.OE1 other bump:2.59787 Ang L27.C and E30.OE1 other bump:1.71891 Ang E26.O and E30.CD other bump:2.63897 Ang E26.C and E30.CD other bump:2.74011 Ang F16.CE1 and Q24.NE2 other bump:2.32825 Ang F16.CZ and Q24.NE2 other bump:2.18679 Ang F16.CD1 and Q24.OE1 other bump:1.29549 Ang F16.CE1 and Q24.OE1 other bump:2.17348 Ang F16.CZ and Q24.OE1 other bump:2.25831 Ang F16.CE1 and Q24.CD other bump:2.50319 Ang F16.CZ and Q24.CD other bump:2.88793 Ang L18.CB and I20.CD1 other bump:1.84537 Ang Q15.NE2 and I20.CG2 other bump:2.94897 Ang Q15.CD and I20.CG2 T0129 122 :GEIGEAVDDLQDICQLGYDEDDNEEELAEALEEIIEYVRTI 1iapA 189 :RERHVAERLLMHLEEMQHTISTDEEKSAAVVNAIGLYMRHL Fragment has 28 clashes (null) has 28 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 43 residues other bump:2.9096 Ang Y38.CD2 and I42.CD1 other bump:2.59161 Ang Y38.CE2 and I42.CD1 other bump:2.23687 Ang I36.CG2 and R40.NH2 other bump:2.00174 Ang E26.O and E30.OE2 other bump:2.29725 Ang E26.CG and E30.OE2 other bump:2.59848 Ang E26.C and E30.OE2 other bump:0.792543 Ang E26.O and E30.OE1 other bump:1.73901 Ang E26.C and E30.OE1 other bump:2.49412 Ang E27.CA and E30.OE1 other bump:1.48505 Ang E26.O and E30.CD other bump:2.47316 Ang E26.C and E30.CD other bump:2.94899 Ang G18.CA and L28.CD2 other bump:2.64269 Ang Y19.N and L28.CD2 other bump:3.04687 Ang Y19.CA and L28.CD2 other bump:1.82918 Ang G18.O and L28.CD2 other bump:2.06507 Ang G18.C and L28.CD2 other bump:2.05929 Ang G18.O and L28.CD1 other bump:2.50787 Ang E21.CB and L28.CD1 other bump:2.3162 Ang E21.CG and L28.CD1 other bump:2.1468 Ang E21.CD and L28.CD1 other bump:1.5717 Ang E21.OE1 and L28.CD1 other bump:2.33808 Ang G18.O and L28.CG other bump:2.99292 Ang G18.C and L28.CG other bump:2.60114 Ang E21.OE1 and L28.CG other bump:2.35576 Ang D22.OD2 and E27.CD other bump:2.19167 Ang D22.OD2 and E27.CG other bump:2.33616 Ang D22.OD2 and E27.CB neighbor-bump: 2.84165 Ang Y19.CD1 and D20.OD2 Number of specific fragments= 7 total=7 Number of alignments=1 # Reading fragments from alignment file # T0129 read from /projects/compbio/experiments/casp5/t0129/1ljrA/1ljrA-T0129-fssp-global-adpstyle5.pw.a2m.gz # 1ljrA read from /projects/compbio/experiments/casp5/t0129/1ljrA/1ljrA-T0129-fssp-global-adpstyle5.pw.a2m.gz # found chain 1ljrA in template set T0129 1 :M 1ljrA 3 :L Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 2 residues T0129 2 :LISHSDLNQQLKSAGIGFNATELHG 1ljrA 18 :YIFAKKNGIPLELRTVDLVKGQHKS Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 27 residues other bump:2.09681 Ang F19.CE2 and L24.CD2 other bump:3.19591 Ang I17.CG1 and E23.C other bump:2.73405 Ang I17.CD1 and E23.O other bump:2.80257 Ang I17.CG1 and E23.CB neighbor-bump: 2.09232 Ang A21.O and T22.OG1 neighbor-bump: 2.50354 Ang A21.C and T22.OG1 neighbor-bump: 1.83626 Ang A21.O and T22.CB neighbor-bump: 2.31105 Ang A21.C and T22.CB other bump:2.58942 Ang H5.ND1 and L12.CD1 neighbor-bump: 2.68373 Ang L8.C and N9.CB T0129 27 :FLS 1ljrA 45 :FLQ Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 5 residues T0129 30 :GLLCGGLKDQSWLPLLYQFSNDNHAYPTG 1ljrA 83 :HWYPSDLQARARVHEYLGWHADCIRGTFG Fragment has 14 clashes (null) has 14 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 31 residues other bump:2.19089 Ang A26.O and P28.CD other bump:2.46405 Ang A26.C and P28.CD neighbor-bump: 2.63756 Ang Y27.N and P28.CD self-bump: 1.3867 Ang H25.CA and H25.CB other bump:2.40687 Ang F20.CE1 and N24.ND2 other bump:2.37684 Ang F20.CZ and N24.ND2 other bump:3.10545 Ang F20.CE2 and N24.ND2 other bump:2.24388 Ang L17.O and S21.OG other bump:2.60635 Ang L17.CD2 and S21.OG other bump:3.16402 Ang S12.C and P15.CD other bump:1.56725 Ang Q11.O and P15.CD other bump:2.77953 Ang Q11.C and P15.CD other bump:2.41554 Ang Q11.O and P15.CG other bump:2.48274 Ang K9.O and W13.CD1 T0129 59 :LVQPVTELYEQISQTLSDVEGF 1ljrA 128 :PEEKVERNRTAMDQALQWLEDK Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 24 residues other bump:2.95946 Ang L9.CD2 and I13.CD1 T0129 81 :TFE 1ljrA 151 :LGD Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 5 residues neighbor-bump: 2.61918 Ang F3.CG and E4.N neighbor-bump: 2.56972 Ang F3.CD2 and E4.N self-bump: 1.29389 Ang F3.CA and F3.CB T0129 91 :NVFTQADSLSDWANQFLLGIGL 1ljrA 160 :QQVTLADLMALEELMQPVALGY Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 24 residues other bump:2.42026 Ang F17.CZ and I21.CD1 other bump:2.97757 Ang F17.CD2 and I21.CD1 other bump:2.36888 Ang F17.CE2 and I21.CD1 other bump:3.01456 Ang W13.CE3 and Q16.OE1 other bump:2.57718 Ang S9.O and W13.CD1 other bump:2.86113 Ang T5.CG2 and D8.OD1 T0129 113 :AQPELAKEKGEIGEA 1ljrA 186 :GRPRLAAWRGRVEAF Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 17 residues T0129 130 :DLQDICQL 1ljrA 201 :LGAELCQE Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 10 residues T0129 138 :GYDEDDN 1ljrA 215 :SILEQAA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 9 residues T0129 145 :EEELAEAL 1ljrA 226 :PTPSPEAY Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 10 residues Number of specific fragments= 11 total=18 Number of alignments=2 # Reading fragments from alignment file # T0129 read from /projects/compbio/experiments/casp5/t0129/1ekbB/T0129-1ekbB-vit-adpstyle5.pw.a2m.gz # 1ekbB read from /projects/compbio/experiments/casp5/t0129/1ekbB/T0129-1ekbB-vit-adpstyle5.pw.a2m.gz # found chain 1ekbB in template set T0129 29 :SGLLCGGLKDQSWLPLLY 1ekbB 178 :ENMVCAGYEAGGVDSCQG Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 20 residues neighbor-bump: 2.57977 Ang L18.O and Y19.CD1 self-bump: 2.2047 Ang L18.CB and L18.C self-bump: 1.25941 Ang L18.CA and L18.CB self-bump: 1.39889 Ang S13.CA and S13.CB neighbor-bump: 2.35683 Ang D11.O and Q12.OE1 neighbor-bump: 2.07547 Ang D11.O and Q12.CD neighbor-bump: 1.18008 Ang D11.O and Q12.CG neighbor-bump: 2.22918 Ang D11.C and Q12.CG neighbor-bump: 2.13569 Ang D11.O and Q12.CB neighbor-bump: 2.52083 Ang D11.C and Q12.CB T0129 52 :NHAYPTGL 1ekbB 194 :DSGGPLMC Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 10 residues other bump:3.0823 Ang N2.CA and Y5.CE2 other bump:2.59768 Ang G1.O and Y5.CE2 other bump:2.68727 Ang N2.CA and Y5.CD2 other bump:2.71716 Ang N2.C and Y5.CD2 other bump:2.3741 Ang N2.O and Y5.CD2 neighbor-bump: 2.29533 Ang H3.O and A4.CB neighbor-bump: 2.64701 Ang H3.C and A4.CB T0129 67 :YEQISQTLSDVEGFTFELGLTEDENVFTQADSLSDWANQFL 1ekbB 202 :QENNRWLLAGVTSFGYQCALPNRPGVYARVPRFTEWIQSFL Fragment has 36 clashes (null) has 36 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 43 residues other bump:2.56583 Ang D11.OD2 and F28.CG other bump:2.83547 Ang D11.CB and F28.CB other bump:2.96578 Ang T16.CG2 and N26.OD1 other bump:2.4435 Ang F17.CB and D24.OD2 other bump:2.84831 Ang E18.CB and L21.CD1 other bump:2.66895 Ang E18.CG and L21.CD1 other bump:1.6856 Ang E18.CD and L21.CD1 other bump:0.671136 Ang E18.OE1 and L21.CD1 other bump:2.62484 Ang E18.OE2 and L21.CD1 other bump:2.1714 Ang E18.OE1 and L21.CG other bump:2.95287 Ang E18.OE1 and L21.CB neighbor-bump: 2.47894 Ang F17.CE2 and E18.OE2 neighbor-bump: 2.96281 Ang F17.CE2 and E18.CD neighbor-bump: 2.28479 Ang F17.O and E18.CB neighbor-bump: 2.60687 Ang F17.C and E18.CB other bump:3.02003 Ang Y2.CE1 and S6.CA other bump:2.09543 Ang Y2.CE1 and S6.N other bump:2.75993 Ang Y2.CZ and S6.N other bump:2.16949 Ang Y2.OH and I5.C other bump:2.77938 Ang Y2.CD1 and I5.C other bump:1.52665 Ang Y2.CE1 and I5.C other bump:2.08621 Ang Y2.CZ and I5.C other bump:1.96304 Ang Y2.CE1 and I5.O other bump:2.25948 Ang Y2.OH and I5.CG1 other bump:1.73954 Ang Y2.OH and I5.CB other bump:0.670978 Ang Y2.OH and I5.CA other bump:2.04562 Ang Y2.CE1 and I5.CA other bump:2.68037 Ang Y2.CE2 and I5.CA other bump:1.42835 Ang Y2.CZ and I5.CA other bump:1.28508 Ang Y2.OH and I5.N other bump:2.48507 Ang Y2.CE1 and I5.N other bump:2.04876 Ang Y2.CE2 and I5.N other bump:1.46091 Ang Y2.CZ and I5.N other bump:2.41238 Ang Y2.OH and Q4.C other bump:3.15092 Ang Y2.CE2 and Q4.C other bump:2.72449 Ang Y2.CZ and Q4.C Number of specific fragments= 3 total=21 Number of alignments=3 # Reading fragments from alignment file # T0129 read from /projects/compbio/experiments/casp5/t0129/1ekbB/T0129-1ekbB-vit-adpstyle1.pw.a2m.gz # 1ekbB read from /projects/compbio/experiments/casp5/t0129/1ekbB/T0129-1ekbB-vit-adpstyle1.pw.a2m.gz # found chain 1ekbB in template set T0129 74 :LSDVEGFTFELGLTEDENVFTQADSLSDWANQFL 1ekbB 209 :LAGVTSFGYQCALPNRPGVYARVPRFTEWIQSFL Fragment has 15 clashes (null) has 15 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 36 residues other bump:2.56583 Ang D4.OD2 and F21.CG other bump:2.83547 Ang D4.CB and F21.CB other bump:2.96578 Ang T9.CG2 and N19.OD1 other bump:2.4435 Ang F10.CB and D17.OD2 other bump:2.84831 Ang E11.CB and L14.CD1 other bump:2.66895 Ang E11.CG and L14.CD1 other bump:1.6856 Ang E11.CD and L14.CD1 other bump:0.671136 Ang E11.OE1 and L14.CD1 other bump:2.62484 Ang E11.OE2 and L14.CD1 other bump:2.1714 Ang E11.OE1 and L14.CG other bump:2.95287 Ang E11.OE1 and L14.CB neighbor-bump: 2.47894 Ang F10.CE2 and E11.OE2 neighbor-bump: 2.96281 Ang F10.CE2 and E11.CD neighbor-bump: 2.28479 Ang F10.O and E11.CB neighbor-bump: 2.60687 Ang F10.C and E11.CB Number of specific fragments= 1 total=22 Number of alignments=4 # Reading fragments from alignment file # T0129 read from /projects/compbio/experiments/casp5/t0129/1brwA/1brwA-T0129-fssp-global-adpstyle5.pw.a2m.gz # 1brwA read from /projects/compbio/experiments/casp5/t0129/1brwA/1brwA-T0129-fssp-global-adpstyle5.pw.a2m.gz # found chain 1brwA in template set T0129 1 :MLISH 1brwA 1 :MRMVD Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 6 residues T0129 8 :L 1brwA 6 :L Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 3 residues T0129 10 :QQLKSAGIGFNATELHGFLSGLLCGGLKDQSWLPLLYQFSND 1brwA 7 :IAKKRDGKALTKEEIEWIVRGYTNGDIPDYQMSALAMAIYFR Fragment has 33 clashes (null) has 33 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 44 residues other bump:2.28516 Ang K5.O and D43.OD2 other bump:2.89097 Ang Y38.CE2 and N42.ND2 other bump:2.52369 Ang L36.CG and F40.CZ other bump:2.54778 Ang L36.CD1 and F40.CZ other bump:2.75177 Ang L36.CD2 and F40.CZ other bump:2.69204 Ang L36.CD1 and F40.CE2 other bump:2.80975 Ang L36.CG and F40.CE1 other bump:3.04516 Ang K5.CG and F40.CD2 other bump:2.56813 Ang S6.CA and Q39.NE2 other bump:2.44384 Ang S6.CB and Q39.NE2 other bump:3.19871 Ang W33.CE3 and L37.CD2 other bump:3.00279 Ang W33.CZ3 and L37.CD2 other bump:2.93258 Ang W33.CH2 and L37.CD2 other bump:3.06154 Ang W33.CZ2 and L37.CD2 other bump:2.6151 Ang Q2.NE2 and P35.C other bump:2.17019 Ang Q31.O and P35.CD other bump:2.95447 Ang Q31.C and P35.CD other bump:3.13787 Ang S32.C and P35.CD other bump:2.23195 Ang Q31.O and P35.CG other bump:3.11389 Ang Q2.CD and P35.CB other bump:1.95311 Ang Q2.NE2 and P35.CB other bump:2.712 Ang Q2.NE2 and P35.CA other bump:2.36288 Ang K29.CD and Q31.NE2 other bump:2.54092 Ang K29.CB and Q31.OE1 other bump:3.1247 Ang K29.CD and Q31.CD other bump:2.85348 Ang N12.OD1 and E15.CD other bump:2.28032 Ang N12.OD1 and E15.CG other bump:2.4375 Ang N12.OD1 and E15.CB other bump:2.68278 Ang K5.CB and F11.CZ other bump:2.62862 Ang G1.O and F11.CE2 other bump:2.41348 Ang K5.CE and F11.CE1 other bump:2.83821 Ang K5.CB and F11.CE1 other bump:2.96882 Ang K5.CE and F11.CD1 T0129 52 :NHAYPTGLVQPVTELYE 1brwA 79 :VDKHSTGGVGDTTTLVL Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 19 residues other bump:3.12692 Ang V10.CA and P12.CD other bump:2.52217 Ang V10.C and P12.CD neighbor-bump: 2.54342 Ang Q11.N and P12.CD other bump:3.18751 Ang V10.C and P12.CG other bump:3.07418 Ang V10.N and P12.CG other bump:2.3159 Ang L9.CB and P12.CG other bump:2.75369 Ang L9.CD1 and P12.CB T0129 69 :QIS 1brwA 108 :KMS Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 5 residues T0129 72 :QTLSDVEGFTFELGLTEDENVF 1brwA 122 :DKLESVPGFHVEISKDEFIRLV Fragment has 14 clashes (null) has 14 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 24 residues other bump:3.02949 Ang L4.C and F12.CZ other bump:2.91205 Ang L4.CA and F12.CZ other bump:1.83122 Ang L4.CB and F12.CZ other bump:2.9867 Ang L4.CG and F12.CZ other bump:2.91149 Ang G1.O and F12.CE2 other bump:2.90145 Ang S5.N and F12.CE2 other bump:2.80886 Ang S5.OG and F12.CE2 other bump:2.99196 Ang L4.CB and F12.CE2 other bump:2.51853 Ang L4.CB and F12.CE1 other bump:2.4652 Ang L4.CD1 and F12.CE1 other bump:2.61148 Ang F10.CE1 and F12.CE1 other bump:1.22911 Ang T3.O and D6.OD1 other bump:2.42658 Ang T3.C and D6.OD1 other bump:2.44203 Ang T3.O and D6.CG T0129 94 :TQA 1brwA 152 :GQT Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 5 residues T0129 97 :DSL 1brwA 175 :NSI Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 5 residues T0129 100 :SDWANQFLLG 1brwA 190 :AAGADAIVLD Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 12 residues other bump:2.92443 Ang D3.OD1 and F8.CZ T0129 110 :IGLAQPE 1brwA 204 :AGAFMKK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 9 residues T0129 117 :LAKE 1brwA 243 :LGYA Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 6 residues self-bump: 2.19761 Ang A3.CB and A3.C self-bump: 1.2487 Ang A3.CA and A3.CB T0129 121 :KGEIGEAVDDL 1brwA 250 :ALEVKEAIETL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 13 residues T0129 132 :QDICQL 1brwA 269 :TELCLT Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 8 residues other bump:2.68151 Ang Q2.CD and Q6.OE1 other bump:1.86028 Ang Q2.OE1 and Q6.OE1 T0129 138 :GYDEDDNEEELAEALEEIIEYVRT 1brwA 282 :LAEKAPSLDEARRLLEEAIRSGAA Fragment has 39 clashes (null) has 39 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 26 residues other bump:2.30955 Ang I19.CG2 and T25.OG1 neighbor-bump: 2.07527 Ang Y22.O and V23.CG2 neighbor-bump: 2.65541 Ang Y22.C and V23.CG2 neighbor-bump: 1.89747 Ang Y22.O and V23.CB neighbor-bump: 2.39574 Ang Y22.C and V23.CB other bump:2.43372 Ang E18.CD and Y22.OH other bump:1.98633 Ang E18.CD and Y22.CZ other bump:2.29873 Ang E18.OE2 and Y22.CZ other bump:1.62941 Ang E18.OE1 and Y22.CZ other bump:1.4251 Ang E18.CD and Y22.CE2 other bump:2.34788 Ang E18.OE2 and Y22.CE2 other bump:2.52252 Ang E18.CG and Y22.CE2 other bump:0.351167 Ang E18.OE1 and Y22.CE2 other bump:2.59551 Ang E18.OE1 and Y22.CE1 other bump:2.53207 Ang E18.O and Y22.CD2 other bump:2.42874 Ang E18.CD and Y22.CD2 other bump:1.28997 Ang E18.OE1 and Y22.CD2 other bump:2.41216 Ang E18.OE1 and Y22.CG self-bump: 1.37146 Ang Y22.CA and Y22.CB other bump:2.28829 Ang D6.OD2 and L12.CB other bump:2.95108 Ang D6.CG and L12.CA other bump:1.75125 Ang D6.OD2 and L12.CA other bump:2.56755 Ang D6.CG and L12.N other bump:1.43025 Ang D6.OD2 and L12.N other bump:3.16014 Ang D6.CG and E11.C other bump:2.29757 Ang D6.OD2 and E11.C other bump:2.52069 Ang D6.OD1 and E11.CB other bump:2.25612 Ang N8.OD1 and E11.N other bump:3.00847 Ang Y3.CD1 and E5.OE2 other bump:2.51617 Ang Y3.CD1 and E5.CD other bump:2.56107 Ang Y3.CG and E5.CG other bump:1.18423 Ang Y3.CD1 and E5.CG other bump:1.07379 Ang Y3.CE1 and E5.CG other bump:2.59137 Ang Y3.OH and E5.CB other bump:3.09043 Ang Y3.CE2 and E5.CB other bump:1.99925 Ang Y3.CZ and E5.CB other bump:2.16929 Ang Y3.CD1 and E5.CB other bump:1.23726 Ang Y3.CE1 and E5.CB other bump:2.87141 Ang Y3.CE1 and E5.CA T0129 162 :IAMLFYSH 1brwA 394 :LATIHSNR Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 10 residues other bump:2.95426 Ang Y7.CD1 and H9.C other bump:1.93502 Ang Y7.CD1 and H9.O other bump:2.40357 Ang Y7.CE1 and H9.O other bump:2.54365 Ang M4.SD and F6.CZ other bump:0.797814 Ang M4.CE and F6.CZ other bump:1.87368 Ang M4.CE and F6.CE2 other bump:2.89566 Ang M4.SD and F6.CE1 other bump:1.79368 Ang M4.CE and F6.CE1 other bump:2.99296 Ang M4.CE and F6.CD2 other bump:2.94391 Ang M4.CE and F6.CD1 T0129 170 :FNEGEIESKPVLH 1brwA 417 :LSPQPVARPPLIY Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues self-bump: 1.39854 Ang V12.CA and V12.CB other bump:2.74264 Ang N3.CG and I7.CG2 other bump:1.81233 Ang N3.ND2 and I7.CG2 other bump:2.96794 Ang N3.OD1 and I7.CG2 Number of specific fragments= 16 total=38 Number of alignments=5 # Reading fragments from alignment file # T0129 read from /projects/compbio/experiments/casp5/t0129/1ekbB/T0129-1ekbB-local-adpstyle5.pw.a2m.gz # 1ekbB read from /projects/compbio/experiments/casp5/t0129/1ekbB/T0129-1ekbB-local-adpstyle5.pw.a2m.gz # found chain 1ekbB in template set T0129 29 :SGLLCGGLKDQSWLPLLY 1ekbB 178 :ENMVCAGYEAGGVDSCQG Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 20 residues neighbor-bump: 2.57977 Ang L18.O and Y19.CD1 self-bump: 2.2047 Ang L18.CB and L18.C self-bump: 1.25941 Ang L18.CA and L18.CB self-bump: 1.39889 Ang S13.CA and S13.CB neighbor-bump: 2.35683 Ang D11.O and Q12.OE1 neighbor-bump: 2.07547 Ang D11.O and Q12.CD neighbor-bump: 1.18008 Ang D11.O and Q12.CG neighbor-bump: 2.22918 Ang D11.C and Q12.CG neighbor-bump: 2.13569 Ang D11.O and Q12.CB neighbor-bump: 2.52083 Ang D11.C and Q12.CB T0129 52 :NHAYPTGL 1ekbB 194 :DSGGPLMC Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 10 residues other bump:3.0823 Ang N2.CA and Y5.CE2 other bump:2.59768 Ang G1.O and Y5.CE2 other bump:2.68727 Ang N2.CA and Y5.CD2 other bump:2.71716 Ang N2.C and Y5.CD2 other bump:2.3741 Ang N2.O and Y5.CD2 neighbor-bump: 2.29533 Ang H3.O and A4.CB neighbor-bump: 2.64701 Ang H3.C and A4.CB T0129 67 :YEQISQTLSDVEGFTFELGLTEDENVFTQADSLSDWANQFL 1ekbB 202 :QENNRWLLAGVTSFGYQCALPNRPGVYARVPRFTEWIQSFL Fragment has 36 clashes (null) has 36 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 43 residues other bump:2.56583 Ang D11.OD2 and F28.CG other bump:2.83547 Ang D11.CB and F28.CB other bump:2.96578 Ang T16.CG2 and N26.OD1 other bump:2.4435 Ang F17.CB and D24.OD2 other bump:2.84831 Ang E18.CB and L21.CD1 other bump:2.66895 Ang E18.CG and L21.CD1 other bump:1.6856 Ang E18.CD and L21.CD1 other bump:0.671136 Ang E18.OE1 and L21.CD1 other bump:2.62484 Ang E18.OE2 and L21.CD1 other bump:2.1714 Ang E18.OE1 and L21.CG other bump:2.95287 Ang E18.OE1 and L21.CB neighbor-bump: 2.47894 Ang F17.CE2 and E18.OE2 neighbor-bump: 2.96281 Ang F17.CE2 and E18.CD neighbor-bump: 2.28479 Ang F17.O and E18.CB neighbor-bump: 2.60687 Ang F17.C and E18.CB other bump:3.02003 Ang Y2.CE1 and S6.CA other bump:2.09543 Ang Y2.CE1 and S6.N other bump:2.75993 Ang Y2.CZ and S6.N other bump:2.16949 Ang Y2.OH and I5.C other bump:2.77938 Ang Y2.CD1 and I5.C other bump:1.52665 Ang Y2.CE1 and I5.C other bump:2.08621 Ang Y2.CZ and I5.C other bump:1.96304 Ang Y2.CE1 and I5.O other bump:2.25948 Ang Y2.OH and I5.CG1 other bump:1.73954 Ang Y2.OH and I5.CB other bump:0.670978 Ang Y2.OH and I5.CA other bump:2.04562 Ang Y2.CE1 and I5.CA other bump:2.68037 Ang Y2.CE2 and I5.CA other bump:1.42835 Ang Y2.CZ and I5.CA other bump:1.28508 Ang Y2.OH and I5.N other bump:2.48507 Ang Y2.CE1 and I5.N other bump:2.04876 Ang Y2.CE2 and I5.N other bump:1.46091 Ang Y2.CZ and I5.N other bump:2.41238 Ang Y2.OH and Q4.C other bump:3.15092 Ang Y2.CE2 and Q4.C other bump:2.72449 Ang Y2.CZ and Q4.C Number of specific fragments= 3 total=41 Number of alignments=6 # Reading fragments from alignment file # T0129 read from /projects/compbio/experiments/casp5/t0129/1ekbB/T0129-1ekbB-local-adpstyle1.pw.a2m.gz # 1ekbB read from /projects/compbio/experiments/casp5/t0129/1ekbB/T0129-1ekbB-local-adpstyle1.pw.a2m.gz # found chain 1ekbB in template set T0129 74 :LSDVEGFTFELGLTEDENVFTQADSLSDWANQFL 1ekbB 209 :LAGVTSFGYQCALPNRPGVYARVPRFTEWIQSFL Fragment has 15 clashes (null) has 15 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 36 residues other bump:2.56583 Ang D4.OD2 and F21.CG other bump:2.83547 Ang D4.CB and F21.CB other bump:2.96578 Ang T9.CG2 and N19.OD1 other bump:2.4435 Ang F10.CB and D17.OD2 other bump:2.84831 Ang E11.CB and L14.CD1 other bump:2.66895 Ang E11.CG and L14.CD1 other bump:1.6856 Ang E11.CD and L14.CD1 other bump:0.671136 Ang E11.OE1 and L14.CD1 other bump:2.62484 Ang E11.OE2 and L14.CD1 other bump:2.1714 Ang E11.OE1 and L14.CG other bump:2.95287 Ang E11.OE1 and L14.CB neighbor-bump: 2.47894 Ang F10.CE2 and E11.OE2 neighbor-bump: 2.96281 Ang F10.CE2 and E11.CD neighbor-bump: 2.28479 Ang F10.O and E11.CB neighbor-bump: 2.60687 Ang F10.C and E11.CB Number of specific fragments= 1 total=42 Number of alignments=7 # Reading fragments from alignment file # T0129 read from /projects/compbio/experiments/casp5/t0129/1cll/1cll-T0129-fssp-global-adpstyle5.pw.a2m.gz # 1cll read from /projects/compbio/experiments/casp5/t0129/1cll/1cll-T0129-fssp-global-adpstyle5.pw.a2m.gz # found chain 1cll in template set T0129 2 :LISHSDLNQQLKSAGIGFNATELHGFLSGLLCGGLKDQSWLPLLYQFSNDN 1cll 26 :TITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKM Fragment has 67 clashes (null) has 67 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 53 residues other bump:1.87813 Ang L31.CD2 and Q47.NE2 other bump:2.27433 Ang L31.CG and Q47.NE2 other bump:2.54169 Ang L31.CD1 and Q47.NE2 other bump:2.61492 Ang L31.CB and Q47.OE1 other bump:0.78885 Ang L31.CD2 and Q47.OE1 other bump:1.88214 Ang L31.CG and Q47.OE1 other bump:1.0024 Ang L31.CD2 and Q47.CD other bump:2.25566 Ang L31.CG and Q47.CD other bump:3.00019 Ang L31.CD1 and Q47.CD other bump:2.19362 Ang L31.CD2 and Q47.CG other bump:2.71843 Ang L31.CD2 and Q47.CB other bump:2.79212 Ang L31.CA and Q39.OE1 other bump:1.65492 Ang L31.CB and Q39.OE1 other bump:2.76881 Ang L31.CB and Q39.CD other bump:2.52603 Ang L32.CD2 and Q39.CG other bump:3.1173 Ang L32.CD2 and Q39.CB other bump:2.56863 Ang L32.CD2 and Q39.CA other bump:2.89754 Ang L32.CD2 and Q39.N other bump:3.22161 Ang L32.CG and D38.C other bump:2.58652 Ang L32.CD2 and D38.C other bump:2.73979 Ang L32.CD1 and D38.C other bump:2.11703 Ang L32.CD2 and D38.O other bump:2.7476 Ang L32.CD1 and D38.O other bump:2.63 Ang L2.CD2 and D38.OD2 other bump:3.02437 Ang L32.CD1 and D38.CA other bump:2.76008 Ang L32.CD1 and D38.N other bump:1.77022 Ang H5.CD2 and L28.CD1 other bump:2.57327 Ang H5.NE2 and L28.CD1 other bump:2.78072 Ang H5.CD2 and L28.CG other bump:3.00888 Ang H5.ND1 and H25.CE1 other bump:2.8598 Ang H5.CE1 and H25.CE1 other bump:2.44927 Ang H5.CE1 and H25.ND1 other bump:2.70529 Ang H5.ND1 and H25.CD2 other bump:2.88755 Ang H5.CE1 and H25.CA other bump:1.67422 Ang N9.CG and L24.CD2 other bump:1.1624 Ang N9.OD1 and L24.CD2 other bump:1.50111 Ang F19.CE1 and L24.CD2 other bump:2.58888 Ang F19.CZ and L24.CD2 other bump:1.92074 Ang N9.ND2 and L24.CD2 other bump:2.33269 Ang F19.CD1 and L24.CD2 other bump:2.10326 Ang N9.OD1 and L24.CD1 other bump:1.34186 Ang F19.CE1 and L24.CD1 other bump:1.79861 Ang F19.CZ and L24.CD1 other bump:2.69736 Ang F19.CG and L24.CD1 other bump:1.94636 Ang F19.CD1 and L24.CD1 other bump:2.93312 Ang F19.CD2 and L24.CD1 other bump:2.57432 Ang F19.CE2 and L24.CD1 other bump:2.64142 Ang N9.CG and L24.CG other bump:1.69878 Ang N9.OD1 and L24.CG other bump:1.56233 Ang F19.CE1 and L24.CG other bump:2.464 Ang F19.CD1 and L24.CG other bump:2.8335 Ang F19.CE1 and L24.CB other bump:2.74895 Ang N20.OD1 and E23.CB other bump:2.46325 Ang N9.CG and F19.CZ other bump:1.55691 Ang N9.OD1 and F19.CZ other bump:2.94571 Ang N9.N and F19.CZ other bump:2.39894 Ang N9.CA and F19.CZ other bump:2.88892 Ang N9.CB and F19.CZ other bump:3.05892 Ang N9.CA and F19.CE2 other bump:2.90726 Ang L12.CG and F19.CE2 other bump:2.27283 Ang L12.CD1 and F19.CE2 other bump:2.81006 Ang L12.CB and F19.CE2 other bump:2.2762 Ang N9.CG and F19.CE1 other bump:1.08703 Ang N9.OD1 and F19.CE1 other bump:2.30067 Ang L12.CD1 and F19.CD2 other bump:3.07059 Ang L12.CB and F19.CD2 other bump:2.39265 Ang N9.OD1 and F19.CD1 T0129 144 :NEEELAEALEEI 1cll 81 :SEEEIREAFRVF Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues T0129 156 :IEYVRTIAMLFYSHFNEGEIES 1cll 102 :AAELRHVMTNLGEKLTDEEVDE Fragment has 23 clashes (null) has 23 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 24 residues other bump:1.31436 Ang I2.CD1 and E22.OE2 other bump:2.25941 Ang I2.CG1 and E22.OE2 other bump:2.8047 Ang I2.CD1 and E22.OE1 other bump:2.33045 Ang I2.CD1 and E22.CD other bump:3.28747 Ang I2.CG1 and E22.CD other bump:2.34037 Ang R6.CG and I21.CD1 other bump:2.3789 Ang R6.CD and I21.CD1 other bump:2.41463 Ang R6.CB and I21.CD1 other bump:2.27793 Ang N17.OD1 and E20.CG other bump:3.08607 Ang N17.CG and E20.CG other bump:2.61715 Ang N17.OD1 and E20.CB other bump:2.75431 Ang S14.CB and F16.CE2 other bump:2.62031 Ang M10.CE and H15.CE1 other bump:3.13654 Ang M10.SD and H15.ND1 other bump:1.47361 Ang M10.CE and H15.ND1 other bump:2.24742 Ang M10.CE and H15.CG other bump:2.6138 Ang M10.CE and H15.CB other bump:2.65094 Ang M10.SD and H15.CA neighbor-bump: 2.56453 Ang F12.O and Y13.CD1 other bump:2.28525 Ang I8.CG2 and F12.CZ other bump:1.98397 Ang I8.CG2 and F12.CE2 other bump:2.42867 Ang I8.O and F12.CD2 other bump:3.0266 Ang I8.C and F12.CD2 T0129 178 :KPVLH 1cll 143 :QMMTA Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 6 residues self-bump: 1.39008 Ang H6.CA and H6.CB Number of specific fragments= 4 total=46 Number of alignments=8 # Reading fragments from alignment file # T0129 read from /projects/compbio/experiments/casp5/t0129/1g4yR/T0129-1g4yR-2track-global-adpstyle5.pw.a2m.gz # 1g4yR read from /projects/compbio/experiments/casp5/t0129/1g4yR/T0129-1g4yR-2track-global-adpstyle5.pw.a2m.gz # found chain 1g4yR in template set T0129 1 :MLISHSDLNQQLKSA 1g4yR 1 :ADQLTEEQIAEFKEA Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 16 residues other bump:1.84932 Ang M1.N and H5.NE2 other bump:1.73501 Ang M1.N and H5.CE1 T0129 16 :GIGFNATELHGFLSGLLCGGLKDQSWLPLLYQFSNDNHA 1g4yR 23 :GDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNG Fragment has 48 clashes (null) has 48 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 41 residues neighbor-bump: 2.09206 Ang H39.O and A40.CB neighbor-bump: 2.46462 Ang H39.C and A40.CB other bump:2.33743 Ang D37.OD2 and H39.CE1 other bump:2.7253 Ang D37.CG and H39.ND1 other bump:1.82055 Ang D37.OD2 and H39.ND1 other bump:2.47019 Ang L28.O and Y32.CD1 other bump:2.01466 Ang H11.NE2 and L30.CD2 other bump:2.54933 Ang Q25.C and P29.CD other bump:3.29925 Ang S26.CA and P29.CD other bump:1.4201 Ang Q25.O and P29.CD other bump:2.98204 Ang S26.C and P29.CD neighbor-bump: 2.67958 Ang L28.N and P29.CD other bump:2.93407 Ang Q25.C and P29.CG other bump:1.82801 Ang Q25.O and P29.CG other bump:2.9214 Ang G12.N and W27.CH2 other bump:3.30673 Ang S15.CB and W27.CH2 other bump:2.8805 Ang H11.CA and W27.CH2 other bump:2.91566 Ang H11.CB and W27.CH2 other bump:2.44006 Ang H11.CG and W27.CH2 other bump:3.0003 Ang H11.ND1 and W27.CH2 other bump:1.85847 Ang H11.O and W27.CH2 other bump:2.16907 Ang H11.C and W27.CH2 other bump:2.5067 Ang S15.OG and W27.CH2 other bump:3.28782 Ang H11.CE1 and W27.CH2 other bump:2.44735 Ang H11.CD2 and W27.CH2 other bump:2.98655 Ang H11.NE2 and W27.CH2 other bump:2.79936 Ang H11.CA and W27.CZ3 other bump:2.08925 Ang H11.CB and W27.CZ3 other bump:1.35386 Ang H11.CG and W27.CZ3 other bump:2.33519 Ang H11.ND1 and W27.CZ3 other bump:2.74287 Ang H11.C and W27.CZ3 other bump:2.69381 Ang H11.CE1 and W27.CZ3 other bump:1.20947 Ang H11.CD2 and W27.CZ3 other bump:2.18281 Ang H11.NE2 and W27.CZ3 other bump:2.57307 Ang G12.CA and W27.CZ2 other bump:2.67169 Ang G12.N and W27.CZ2 other bump:2.93957 Ang S15.CB and W27.CZ2 other bump:2.20728 Ang H11.O and W27.CZ2 other bump:2.5141 Ang H11.C and W27.CZ2 other bump:2.69683 Ang S15.OG and W27.CZ2 other bump:2.99852 Ang G12.CA and W27.NE1 other bump:2.52086 Ang H11.CB and W27.CE3 other bump:2.24242 Ang H11.CG and W27.CE3 other bump:1.60911 Ang H11.CD2 and W27.CE3 other bump:2.83057 Ang H11.NE2 and W27.CE3 other bump:2.75888 Ang G12.CA and W27.CE2 other bump:2.94291 Ang G12.N and W27.CE2 other bump:2.63489 Ang F13.CE2 and L17.CD1 T0129 55 :YPTGLVQPVTEL 1g4yR 65 :FPEFLTMMARKM Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:2.64895 Ang P9.O and L13.CD1 other bump:3.13492 Ang L6.C and P9.CD T0129 67 :YEQISQTLSDVE 1g4yR 82 :EEEIREAFRVFD Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues T0129 87 :TEDENVFT 1g4yR 94 :KDGNGYIS Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 10 residues other bump:2.97848 Ang G1.C and F8.CE2 T0129 100 :SDWANQFLLGIGLAQP 1g4yR 102 :AAELRHVMTNLGEKLT Fragment has 9 clashes (null) has 9 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 18 residues other bump:2.58285 Ang L10.CD2 and Q16.O neighbor-bump: 2.79642 Ang I12.CG2 and G13.CA neighbor-bump: 2.3888 Ang I12.CB and G13.N neighbor-bump: 1.58573 Ang I12.CG2 and G13.N self-bump: 2.31308 Ang I12.CG2 and I12.C self-bump: 1.35841 Ang I12.CA and I12.CB other bump:2.67865 Ang N6.CG and L10.CD1 other bump:2.02726 Ang N6.ND2 and L10.CD1 other bump:2.91412 Ang N6.OD1 and L10.CD1 T0129 125 :GEAVDDLQDICQLGYDEDDNEEELAEALE 1g4yR 118 :DEEVDEMIREADIDGDGQVNYEEFVQMMT Fragment has 18 clashes (null) has 18 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 31 residues other bump:2.95918 Ang C12.SG and L25.CD2 other bump:2.4047 Ang Q13.CG and D20.OD1 other bump:2.36837 Ang Q13.CD and D20.OD1 other bump:1.98861 Ang Q13.OE1 and D20.OD1 other bump:3.00011 Ang Q13.CD and D20.CG other bump:2.09226 Ang Q13.OE1 and D20.CG other bump:2.9166 Ang Q13.OE1 and D20.CB other bump:2.82626 Ang Q13.OE1 and D20.CA other bump:2.32922 Ang Q13.OE1 and D20.N other bump:2.41761 Ang Q13.NE2 and D19.C other bump:2.59121 Ang Q13.CD and D19.C other bump:2.20355 Ang Q13.OE1 and D19.C other bump:2.44959 Ang Q13.CD and D19.O other bump:2.66509 Ang Q13.NE2 and D19.CA other bump:3.1804 Ang Q13.CD and D19.CA other bump:2.93475 Ang Q13.OE1 and D19.CA other bump:1.97069 Ang Q13.NE2 and D19.N other bump:2.85681 Ang Q13.CD and D19.N Number of specific fragments= 7 total=53 Number of alignments=9 # Reading fragments from alignment file # T0129 read from /projects/compbio/experiments/casp5/t0129/1e70M/1e70M-T0129-fssp-global-adpstyle5.pw.a2m.gz # 1e70M read from /projects/compbio/experiments/casp5/t0129/1e70M/1e70M-T0129-fssp-global-adpstyle5.pw.a2m.gz # found chain 1e70M in template set T0129 2 :LISH 1e70M 31 :FGVA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 6 residues T0129 6 :SDLNQQLKSAGIGFNATELHGFLSGLLC 1e70M 78 :YWQKDIDVLDELNATGYRFSIAWSRIIP Fragment has 27 clashes (null) has 27 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 30 residues other bump:2.7133 Ang F23.CD1 and G26.N other bump:3.0165 Ang F23.CD1 and S25.C other bump:3.03421 Ang F23.CE1 and S25.C other bump:2.88067 Ang F23.CZ and S25.OG other bump:2.5799 Ang F23.CZ and S25.CB other bump:2.79965 Ang F23.CD1 and S25.CB other bump:1.8339 Ang F23.CE1 and S25.CB other bump:3.0364 Ang F23.CD1 and S25.CA other bump:2.74879 Ang F23.CE1 and S25.CA neighbor-bump: 2.35319 Ang A17.CB and T18.N self-bump: 2.18567 Ang A17.CB and A17.C self-bump: 1.24072 Ang A17.CA and A17.CB other bump:2.6893 Ang I13.CG1 and F15.CZ other bump:2.70761 Ang I13.CG2 and F15.CZ other bump:2.79199 Ang I13.CB and F15.CZ other bump:1.73281 Ang I13.CD1 and F15.CZ other bump:2.21425 Ang I13.CG1 and F15.CE1 other bump:2.50569 Ang I13.CG2 and F15.CE1 other bump:1.95922 Ang I13.CB and F15.CE1 other bump:2.88201 Ang S10.CA and F15.CE1 other bump:1.8302 Ang I13.CD1 and F15.CE1 other bump:2.36176 Ang S10.O and F15.CD1 other bump:2.7654 Ang S10.C and F15.CD1 other bump:2.70553 Ang I13.CG2 and F15.CD1 other bump:2.37064 Ang I13.CB and F15.CD1 other bump:2.49386 Ang S10.CA and F15.CD1 other bump:3.04195 Ang I13.CG2 and F15.CG T0129 34 :GGLKDQSWLPLLYQ 1e70M 117 :GIDYYHGLISGLIK Fragment has 9 clashes (null) has 9 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 16 residues other bump:2.91126 Ang W9.CZ3 and L13.CD1 other bump:2.60713 Ang W9.CH2 and L13.CD1 other bump:2.49906 Ang W9.CZ2 and L13.CD1 other bump:3.10479 Ang W9.CE3 and L13.CD1 other bump:2.67776 Ang W9.CE2 and L13.CD1 other bump:1.36765 Ang Q7.O and P11.CD other bump:2.5606 Ang Q7.C and P11.CD other bump:1.9457 Ang Q7.O and P11.CG other bump:3.07255 Ang Q7.C and P11.CG T0129 50 :NDNHAYPTGL 1e70M 131 :KGITPFVTLF Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 12 residues T0129 60 :VQ 1e70M 149 :QD Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues T0129 62 :PVTELYEQISQTLSD 1e70M 163 :DFKDYADLCFEEFGD Fragment has 8 clashes (null) has 8 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 17 residues other bump:2.26618 Ang S11.CA and S15.OG other bump:2.63154 Ang S11.C and S15.OG other bump:2.30429 Ang S11.O and S15.CB other bump:3.20623 Ang S11.C and S15.CB other bump:1.0025 Ang G1.O and E5.OE1 other bump:2.01824 Ang G1.C and E5.OE1 other bump:2.01192 Ang G1.O and E5.CD other bump:2.97025 Ang G1.C and E5.CD T0129 79 :G 1e70M 178 :S Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 3 residues T0129 80 :FTFELG 1e70M 180 :KYWLTI Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 8 residues self-bump: 1.36501 Ang L6.CA and L6.CB T0129 86 :L 1e70M 188 :L Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 3 residues T0129 87 :TEDENVFTQADSLSDWANQ 1e70M 225 :IVAHHQLLAHAKVVDLYRK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 21 residues T0129 106 :FLLGIGLAQ 1e70M 250 :GKIGPTMIT Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues T0129 116 :ELAK 1e70M 289 :PLTN Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 6 residues T0129 120 :EKG 1e70M 319 :KGS Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 5 residues T0129 123 :EIGEAVDDL 1e70M 392 :VMDYFKNKY Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues T0129 132 :Q 1e70M 402 :N Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 3 residues T0129 135 :CQLGY 1e70M 403 :PLIYV Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 7 residues other bump:3.24444 Ang C2.SG and L4.CD2 neighbor-bump: 2.41291 Ang C2.SG and Q3.O T0129 140 :D 1e70M 409 :E Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 3 residues neighbor-bump: 2.35135 Ang G1.O and D2.CG T0129 141 :EDDNEEELAEALEEIIEYV 1e70M 426 :DYTRIDYLCSHLCFLNKVI Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 21 residues other bump:2.49441 Ang E15.O and Y19.CD1 T0129 160 :RTIAMLFYSHFNE 1e70M 450 :NVKGYLAWALGDN Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues other bump:2.61007 Ang Y9.CZ and E14.OE2 other bump:1.65965 Ang Y9.OH and E14.OE2 other bump:2.85786 Ang Y9.OH and E14.CD neighbor-bump: 2.29567 Ang A5.CB and M6.N self-bump: 2.1786 Ang A5.CB and A5.C self-bump: 1.24975 Ang A5.CA and A5.CB T0129 173 :GEIE 1e70M 474 :GLSY Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 6 residues T0129 177 :SKPVLH 1e70M 495 :YQSFIS Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 7 residues other bump:3.08743 Ang G1.C and P4.CD Number of specific fragments= 21 total=74 Number of alignments=10 # Reading fragments from alignment file # T0129 read from /projects/compbio/experiments/casp5/t0129/1cll/T0129-1cll-2track-global-adpstyle5.pw.a2m.gz # 1cll read from /projects/compbio/experiments/casp5/t0129/1cll/T0129-1cll-2track-global-adpstyle5.pw.a2m.gz # found chain 1cll in template set T0129 5 :HSDLNQQLKSA 1cll 5 :TEEQIAEFKEA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 13 residues T0129 16 :GIG 1cll 23 :GDG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 5 residues T0129 19 :FNATEL 1cll 27 :ITTKEL Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 8 residues other bump:2.71979 Ang N3.OD1 and E6.CB T0129 26 :GFLSGLLCGGLKDQSWLPLLYQFSNDNHA 1cll 33 :GTVMRSLGQNPTEAELQDMINEVDADGNG Fragment has 15 clashes (null) has 15 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 31 residues neighbor-bump: 2.02488 Ang H29.O and A30.CB neighbor-bump: 2.41181 Ang H29.C and A30.CB other bump:2.13659 Ang D27.OD1 and H29.CE1 other bump:2.31886 Ang D27.CG and H29.ND1 other bump:1.47321 Ang D27.OD1 and H29.ND1 other bump:2.38176 Ang L18.CG and Y22.CE1 other bump:2.2639 Ang L18.CD1 and Y22.CE1 other bump:2.36964 Ang L18.O and Y22.CD1 other bump:1.73886 Ang Q15.O and P19.CD other bump:2.89449 Ang Q15.C and P19.CD other bump:3.06202 Ang S16.C and P19.CD other bump:2.34179 Ang Q15.O and P19.CG other bump:2.44862 Ang L12.CB and W17.NE1 other bump:2.85276 Ang L12.CB and W17.CD1 self-bump: 2.33905 Ang D14.CA and D14.OD1 T0129 55 :YPTGLVQPVTELY 1cll 65 :FPEFLTMMARKMK Fragment has 9 clashes (null) has 9 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues other bump:3.06481 Ang V10.CG1 and Y14.CZ other bump:2.27082 Ang V10.CG1 and Y14.CE1 self-bump: 1.3951 Ang L13.CA and L13.CB neighbor-bump: 2.56685 Ang Q8.N and P9.CD other bump:1.34826 Ang G5.O and P9.CD other bump:2.46738 Ang G5.C and P9.CD other bump:2.96791 Ang L6.C and P9.CD other bump:1.49692 Ang G5.O and P9.CG other bump:2.59247 Ang G5.C and P9.CG T0129 68 :EQISQTLSDVE 1cll 83 :EEIREAFRVFD Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 13 residues T0129 87 :TEDENVFTQAD 1cll 94 :KDGNGYISAAE Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 13 residues T0129 103 :ANQFLLGIGLAQ 1cll 105 :LRHVMTNLGEKL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues T0129 124 :IGEAVDDLQDICQLGYDEDDNEEELAEALE 1cll 117 :TDEEVDEMIREADIDGDGQVNYEEFVQMMT Fragment has 23 clashes (null) has 23 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 32 residues other bump:2.76861 Ang L15.CD1 and E28.OE2 other bump:2.45888 Ang L15.CD1 and E28.OE1 other bump:2.94984 Ang L15.CD1 and E28.CD other bump:3.24815 Ang Q10.CD and D20.CA other bump:2.42841 Ang Q10.NE2 and D20.CA other bump:2.23522 Ang Q10.NE2 and D20.N other bump:3.16324 Ang Q14.CD and D20.N other bump:2.36927 Ang Q14.NE2 and D20.N other bump:3.01974 Ang Q10.CD and E19.C other bump:1.69838 Ang Q10.NE2 and E19.C other bump:2.30247 Ang Q10.CD and E19.O other bump:1.12523 Ang Q10.NE2 and E19.O other bump:2.99047 Ang Q10.NE2 and E19.CA other bump:2.52674 Ang Q14.OE1 and E19.CA other bump:2.72705 Ang Q14.CD and E19.CA other bump:2.27994 Ang Q14.NE2 and E19.CA other bump:2.28184 Ang Q14.CD and E19.N other bump:1.44966 Ang Q14.NE2 and E19.N other bump:2.29246 Ang Q14.NE2 and D18.C other bump:2.81606 Ang Q14.NE2 and D18.CA other bump:2.9801 Ang Q14.CD and D18.N other bump:2.44072 Ang Q14.NE2 and D18.N other bump:2.75187 Ang Q14.OE1 and Y17.CD1 Number of specific fragments= 9 total=83 Number of alignments=11 # Reading fragments from alignment file # T0129 read from /projects/compbio/experiments/casp5/t0129/1brwA/T0129-1brwA-2track-local-adpstyle1.pw.a2m.gz # 1brwA read from /projects/compbio/experiments/casp5/t0129/1brwA/T0129-1brwA-2track-local-adpstyle1.pw.a2m.gz # found chain 1brwA in template set T0129 13 :KSAGIGFNATELHGFLSGLLCGGLKDQSWLPLLYQFSNDNHAYPTGLVQPVTELY 1brwA 10 :KRDGKALTKEEIEWIVRGYTNGDIPDYQMSALAMAIYFRGMTEEETAALTMAMVQ Fragment has 48 clashes (null) has 48 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 57 residues other bump:2.57859 Ang V52.CG1 and Y56.OH other bump:2.5473 Ang V52.CG1 and Y56.CZ other bump:3.07767 Ang V52.C and Y56.CE2 other bump:2.74386 Ang V52.O and Y56.CE2 other bump:1.92961 Ang V52.CG1 and Y56.CE2 other bump:2.8426 Ang V52.C and Y56.CD2 other bump:2.15709 Ang V52.O and Y56.CD2 other bump:3.04231 Ang V52.CG1 and Y56.CD2 other bump:2.54037 Ang L17.CD2 and E54.OE2 other bump:2.77343 Ang L17.CG and T53.CG2 other bump:2.10688 Ang L17.CD1 and T53.CG2 other bump:2.6437 Ang L17.CB and T53.CG2 other bump:2.29702 Ang L17.CD1 and T53.CB other bump:1.61302 Ang G47.O and P51.CD other bump:2.69728 Ang G47.C and P51.CD other bump:2.89998 Ang L48.C and P51.CD other bump:2.04928 Ang G47.O and P51.CG other bump:3.1854 Ang G47.C and P51.CG neighbor-bump: 1.69632 Ang D40.O and N41.CG neighbor-bump: 2.66016 Ang D40.C and N41.CG other bump:2.07558 Ang K2.O and D40.OD2 other bump:2.89097 Ang Y35.CE2 and N39.ND2 other bump:2.52369 Ang L33.CG and F37.CZ other bump:2.54778 Ang L33.CD1 and F37.CZ other bump:2.75177 Ang L33.CD2 and F37.CZ other bump:2.69204 Ang L33.CD1 and F37.CE2 other bump:2.80975 Ang L33.CG and F37.CE1 other bump:3.04516 Ang K2.CG and F37.CD2 other bump:2.56813 Ang S3.CA and Q36.NE2 other bump:2.44384 Ang S3.CB and Q36.NE2 other bump:3.00279 Ang W30.CZ3 and L34.CD2 other bump:3.19871 Ang W30.CE3 and L34.CD2 other bump:3.06154 Ang W30.CZ2 and L34.CD2 other bump:2.93258 Ang W30.CH2 and L34.CD2 other bump:2.17019 Ang Q28.O and P32.CD other bump:2.95447 Ang Q28.C and P32.CD other bump:3.13787 Ang S29.C and P32.CD other bump:2.23195 Ang Q28.O and P32.CG other bump:2.36288 Ang K26.CD and Q28.NE2 other bump:2.54092 Ang K26.CB and Q28.OE1 other bump:3.1247 Ang K26.CD and Q28.CD other bump:2.85348 Ang N9.OD1 and E12.CD other bump:2.28032 Ang N9.OD1 and E12.CG other bump:2.4375 Ang N9.OD1 and E12.CB other bump:2.68278 Ang K2.CB and F8.CZ other bump:2.41348 Ang K2.CE and F8.CE1 other bump:2.83821 Ang K2.CB and F8.CE1 other bump:2.96882 Ang K2.CE and F8.CD1 Number of specific fragments= 1 total=84 Number of alignments=12 # Reading fragments from alignment file # T0129 read from /projects/compbio/experiments/casp5/t0129/1brwA/T0129-1brwA-2track-local-adpstyle5.pw.a2m.gz # 1brwA read from /projects/compbio/experiments/casp5/t0129/1brwA/T0129-1brwA-2track-local-adpstyle5.pw.a2m.gz # found chain 1brwA in template set T0129 11 :QLKSAGIGFNATELHGFLSGLLCGGLKDQSWLPLLYQFSNDNHAYPTGLVQPVTELYEQISQTLSDVEGFTFELGLTEDEN 1brwA 8 :AKKRDGKALTKEEIEWIVRGYTNGDIPDYQMSALAMAIYFRGMTEEETAALTMAMVQSGEMLDLSSIRGVKVDKHSTGGVG Fragment has 58 clashes (null) has 58 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 83 residues other bump:2.62825 Ang F71.CE1 and F73.CZ other bump:2.6326 Ang F71.CD1 and F73.CZ other bump:2.58193 Ang F71.CD1 and F73.CE2 other bump:2.46015 Ang F71.CE1 and F73.CE1 other bump:3.08234 Ang F71.CZ and F73.CE1 other bump:2.9949 Ang F71.CD1 and F73.CD2 other bump:2.83679 Ang F71.CE1 and F73.CD1 other bump:2.52171 Ang E56.CD and E59.OE1 other bump:1.87171 Ang E56.OE1 and E59.OE1 other bump:2.92103 Ang E56.CD and E59.CD other bump:2.5786 Ang V54.CG1 and Y58.OH other bump:2.54731 Ang V54.CG1 and Y58.CZ other bump:2.74386 Ang V54.O and Y58.CE2 other bump:3.07767 Ang V54.C and Y58.CE2 other bump:1.92961 Ang V54.CG1 and Y58.CE2 other bump:2.15709 Ang V54.O and Y58.CD2 other bump:2.84261 Ang V54.C and Y58.CD2 other bump:3.04231 Ang V54.CG1 and Y58.CD2 other bump:2.54037 Ang L19.CD2 and E56.OE2 other bump:2.6437 Ang L19.CB and T55.CG2 other bump:2.77343 Ang L19.CG and T55.CG2 other bump:2.10688 Ang L19.CD1 and T55.CG2 other bump:2.29702 Ang L19.CD1 and T55.CB other bump:1.61302 Ang G49.O and P53.CD other bump:2.69728 Ang G49.C and P53.CD other bump:2.89998 Ang L50.C and P53.CD other bump:2.04928 Ang G49.O and P53.CG other bump:3.1854 Ang G49.C and P53.CG neighbor-bump: 1.69632 Ang D42.O and N43.CG neighbor-bump: 2.66016 Ang D42.C and N43.CG other bump:2.07558 Ang K4.O and D42.OD2 other bump:2.89097 Ang Y37.CE2 and N41.ND2 other bump:2.52369 Ang L35.CG and F39.CZ other bump:2.54778 Ang L35.CD1 and F39.CZ other bump:2.75177 Ang L35.CD2 and F39.CZ other bump:2.69204 Ang L35.CD1 and F39.CE2 other bump:2.80975 Ang L35.CG and F39.CE1 other bump:3.04516 Ang K4.CG and F39.CD2 other bump:2.56813 Ang S5.CA and Q38.NE2 other bump:2.44384 Ang S5.CB and Q38.NE2 other bump:3.00279 Ang W32.CZ3 and L36.CD2 other bump:2.93258 Ang W32.CH2 and L36.CD2 other bump:3.19871 Ang W32.CE3 and L36.CD2 other bump:3.06154 Ang W32.CZ2 and L36.CD2 other bump:2.17019 Ang Q30.O and P34.CD other bump:2.95447 Ang Q30.C and P34.CD other bump:3.13787 Ang S31.C and P34.CD other bump:2.23195 Ang Q30.O and P34.CG other bump:2.36288 Ang K28.CD and Q30.NE2 other bump:2.54092 Ang K28.CB and Q30.OE1 other bump:3.1247 Ang K28.CD and Q30.CD other bump:2.85348 Ang N11.OD1 and E14.CD other bump:2.28032 Ang N11.OD1 and E14.CG other bump:2.4375 Ang N11.OD1 and E14.CB other bump:2.68278 Ang K4.CB and F10.CZ other bump:2.83821 Ang K4.CB and F10.CE1 other bump:2.41348 Ang K4.CE and F10.CE1 other bump:2.96882 Ang K4.CE and F10.CD1 T0129 95 :QADSLS 1brwA 91 :TTLVLG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 8 residues T0129 105 :QFLLGIG 1brwA 97 :PLVASVG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 9 residues Number of specific fragments= 3 total=87 Number of alignments=13 # Reading fragments from alignment file # T0129 read from /projects/compbio/experiments/casp5/t0129/1exrA/T0129-1exrA-2track-global-adpstyle5.pw.a2m.gz # 1exrA read from /projects/compbio/experiments/casp5/t0129/1exrA/T0129-1exrA-2track-global-adpstyle5.pw.a2m.gz # found chain 1exrA in training set T0129 3 :ISHSDLNQ 1exrA 3 :QLTEEQIA Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 10 residues neighbor-bump: 2.40524 Ang G1.O and I2.CD1 neighbor-bump: 2.95931 Ang G1.C and I2.CG1 T0129 13 :KSA 1exrA 13 :KEA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 5 residues T0129 16 :GIGFNATEL 1exrA 24 :DGTITTKEL Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.61882 Ang N6.OD1 and E9.CG other bump:2.49775 Ang N6.OD1 and E9.CB other bump:2.83513 Ang N6.OD1 and E9.CA other bump:2.12204 Ang N6.OD1 and E9.N neighbor-bump: 3.00952 Ang G2.C and I3.CG1 neighbor-bump: 2.09371 Ang G2.O and I3.CB neighbor-bump: 2.46204 Ang G2.C and I3.CB T0129 26 :GFLSGLLCGGLKDQSWLPLLYQFSNDNHA 1exrA 33 :GTVMRSLGQNPTEAELQDMINEVDADGNG Fragment has 20 clashes (null) has 20 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 31 residues neighbor-bump: 2.05142 Ang H29.O and A30.CB neighbor-bump: 2.45288 Ang H29.C and A30.CB other bump:2.29591 Ang D27.OD1 and H29.CE1 other bump:2.53442 Ang D27.CG and H29.ND1 other bump:1.61758 Ang D27.OD1 and H29.ND1 other bump:2.48858 Ang L18.CG and Y22.CE1 other bump:2.1387 Ang L18.CD1 and Y22.CE1 other bump:2.37427 Ang L18.O and Y22.CD1 other bump:1.66379 Ang Q15.O and P19.CD other bump:2.82421 Ang Q15.C and P19.CD other bump:3.03673 Ang S16.C and P19.CD other bump:2.28274 Ang Q15.O and P19.CG other bump:3.00916 Ang L12.CD1 and W17.CH2 other bump:2.80927 Ang S5.CB and W17.CH2 other bump:2.47347 Ang S5.OG and W17.CH2 other bump:3.22478 Ang L12.CD1 and W17.CZ3 other bump:3.20019 Ang S5.CB and W17.CZ2 other bump:2.76679 Ang L12.CB and W17.NE1 other bump:3.16162 Ang L12.C and W17.NE1 other bump:2.94191 Ang L12.CB and W17.CE2 T0129 55 :YPTGLVQPVTELYEQISQT 1exrA 65 :FPEFLSLMARKMKEQDSEE Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 21 residues other bump:1.47541 Ang G5.O and P9.CD other bump:2.67501 Ang G5.C and P9.CD other bump:1.92399 Ang G5.O and P9.CG other bump:3.08976 Ang G5.C and P9.CG other bump:2.99678 Ang Y2.CE2 and L6.CD1 T0129 74 :LSDVE 1exrA 89 :FKVFD Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 7 residues T0129 87 :TEDENVFTQAD 1exrA 94 :RDGNGLISAAE Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 13 residues T0129 103 :ANQFLLGIGLAQP 1exrA 105 :LRHVMTNLGEKLT Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues other bump:2.10971 Ang L6.CD1 and Q13.NE2 T0129 125 :GEAVDDLQDICQLGYDEDDNEEELA 1exrA 118 :DDEVDEMIREADIDGDGHINYEEFV Fragment has 15 clashes (null) has 15 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 27 residues other bump:2.14931 Ang Q9.NE2 and D19.CA other bump:3.00267 Ang Q9.CD and D19.CA other bump:1.78486 Ang Q9.NE2 and D19.N other bump:3.05163 Ang Q9.CD and D19.N other bump:1.56509 Ang Q9.NE2 and E18.C other bump:2.85824 Ang Q9.CD and E18.C other bump:2.47218 Ang Q9.CD and E18.O other bump:2.89804 Ang Q13.NE2 and E18.CA other bump:2.74993 Ang Q9.NE2 and E18.CA other bump:3.04496 Ang Q13.CD and E18.N other bump:1.92423 Ang Q13.NE2 and E18.N other bump:2.40197 Ang Q13.NE2 and D17.N other bump:2.2909 Ang Q13.NE2 and Y16.C other bump:3.10227 Ang Q13.CD and Y16.CA other bump:2.8029 Ang Q13.NE2 and Y16.CA T0129 152 :LE 1exrA 145 :MV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues Number of specific fragments= 10 total=97 Number of alignments=14 # Reading fragments from alignment file # T0129 read from /projects/compbio/experiments/casp5/t0129/1osa/T0129-1osa-2track-global-adpstyle5.pw.a2m.gz # 1osa read from /projects/compbio/experiments/casp5/t0129/1osa/T0129-1osa-2track-global-adpstyle5.pw.a2m.gz # found chain 1osa in template set T0129 1 :MLISHSDLNQQLKSA 1osa 1 :AEQLTEEQIAEFKEA Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 16 residues other bump:2.51336 Ang H5.CB and D7.OD1 neighbor-bump: 2.67218 Ang L2.O and I3.CD1 neighbor-bump: 2.20893 Ang L2.O and I3.CG1 neighbor-bump: 2.89378 Ang L2.C and I3.CG1 T0129 16 :GIGFNATEL 1osa 24 :DGTITTKEL Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.94298 Ang G2.C and I3.CG1 neighbor-bump: 2.08196 Ang G2.O and I3.CB neighbor-bump: 2.38933 Ang G2.C and I3.CB T0129 26 :GFLSGLLCGGLKDQSWLPLLYQFSNDNHA 1osa 33 :GTVMRSLGQNPTEAELQDMINEVDADGNG Fragment has 23 clashes (null) has 23 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 31 residues neighbor-bump: 2.21935 Ang H29.O and A30.CB neighbor-bump: 2.51728 Ang H29.C and A30.CB other bump:2.21789 Ang D27.OD1 and H29.CE1 other bump:2.51332 Ang D27.CG and H29.ND1 other bump:1.56175 Ang D27.OD1 and H29.ND1 other bump:2.60373 Ang L18.CG and Y22.CE1 other bump:2.15642 Ang L18.CD1 and Y22.CE1 other bump:2.36357 Ang L18.O and Y22.CD1 other bump:1.78002 Ang Q15.O and P19.CD other bump:2.90665 Ang Q15.C and P19.CD other bump:3.04622 Ang S16.C and P19.CD other bump:2.36619 Ang Q15.O and P19.CG other bump:2.12573 Ang S5.OG and W17.CH2 other bump:2.87736 Ang L12.CD1 and W17.CH2 other bump:2.61712 Ang S5.CB and W17.CH2 other bump:3.09832 Ang L12.CD1 and W17.CZ3 other bump:3.09458 Ang S5.OG and W17.CZ2 other bump:2.88216 Ang L12.CD1 and W17.CZ2 other bump:2.97962 Ang S5.CB and W17.CZ2 other bump:2.73996 Ang L12.CB and W17.NE1 other bump:2.94101 Ang L12.CB and W17.CE2 neighbor-bump: 2.11757 Ang L8.O and C9.CB neighbor-bump: 2.45719 Ang L8.C and C9.CB T0129 55 :YPTGLVQPVTELYEQISQT 1osa 65 :FPEFLSLMARKMKEQDSEE Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 21 residues other bump:2.73319 Ang G5.C and P9.CD other bump:1.5935 Ang G5.O and P9.CD other bump:3.0166 Ang G5.C and P9.CG other bump:1.86518 Ang G5.O and P9.CG T0129 74 :LSDVE 1osa 89 :FKVFD Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 7 residues T0129 87 :TEDENVFTQAD 1osa 94 :RDGNGLISAAE Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 13 residues T0129 103 :ANQFLLGIGLAQP 1osa 105 :LRHVMTNLGEKLT Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues other bump:2.06378 Ang L6.CD1 and Q13.NE2 other bump:2.69352 Ang F5.CE2 and I9.CD1 other bump:2.98959 Ang F5.CZ and I9.CD1 other bump:2.86432 Ang F5.CD2 and I9.CD1 T0129 125 :GEAVDDLQDICQLGYDEDDNEEELAEALE 1osa 118 :DDEVDEMIREADIDGDGHINYEEFVRMMV Fragment has 14 clashes (null) has 14 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 31 residues other bump:2.66477 Ang Q9.NE2 and D19.CA other bump:2.25446 Ang Q9.NE2 and D19.N other bump:2.81407 Ang Q9.CD and E18.C other bump:1.48453 Ang Q9.NE2 and E18.C other bump:2.20525 Ang Q9.CD and E18.O other bump:1.03747 Ang Q9.NE2 and E18.O other bump:2.60191 Ang Q9.NE2 and E18.CA other bump:2.99157 Ang Q13.CD and E18.N other bump:1.99735 Ang Q13.NE2 and E18.N other bump:2.1738 Ang Q13.NE2 and D17.N other bump:3.17617 Ang Q13.CD and Y16.C other bump:2.19417 Ang Q13.NE2 and Y16.C other bump:3.03418 Ang Q13.CD and Y16.CA other bump:2.65113 Ang Q13.NE2 and Y16.CA Number of specific fragments= 8 total=105 Number of alignments=15 # Reading fragments from alignment file # T0129 read from /projects/compbio/experiments/casp5/t0129/1a8h/1a8h-T0129-fssp-global-adpstyle5.pw.a2m.gz # 1a8h read from /projects/compbio/experiments/casp5/t0129/1a8h/1a8h-T0129-fssp-global-adpstyle5.pw.a2m.gz # found chain 1a8h in template set T0129 1 :MLISHS 1a8h 4 :VFYVTT Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 7 residues T0129 7 :DLNQQLKS 1a8h 30 :DFLARWHR Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 10 residues T0129 15 :AGIGFNATE 1a8h 47 :TGTDEHGET Fragment has 11 clashes (null) has 11 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.64803 Ang N7.C and A8.CB neighbor-bump: 2.2176 Ang N7.O and A8.CB other bump:1.71629 Ang I4.CG1 and F6.CZ other bump:0.964136 Ang I4.CD1 and F6.CZ other bump:2.15152 Ang I4.CG1 and F6.CE2 other bump:1.32313 Ang I4.CD1 and F6.CE2 other bump:2.6725 Ang I4.CG1 and F6.CE1 other bump:1.541 Ang I4.CD1 and F6.CE1 other bump:2.00816 Ang I4.CD1 and F6.CD2 other bump:2.15529 Ang I4.CD1 and F6.CD1 other bump:2.35947 Ang I4.CD1 and F6.CG T0129 24 :LHGFLSGLLCGGLKD 1a8h 70 :FVDRVSGRFKRAWDL Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 17 residues other bump:2.85682 Ang L2.CA and F5.CE2 other bump:2.82453 Ang L2.CD1 and F5.CE2 other bump:2.76995 Ang L2.O and F5.CE2 other bump:3.10276 Ang L2.CA and F5.CD2 other bump:2.60234 Ang L2.O and F5.CD2 T0129 39 :QSWLPLLYQFSN 1a8h 102 :KVVQLVLKKVYE Fragment has 13 clashes (null) has 13 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:2.61569 Ang Y9.CD1 and N13.ND2 other bump:2.31568 Ang Y9.CE1 and N13.ND2 other bump:3.33396 Ang W4.CH2 and L8.CD2 other bump:3.1999 Ang W4.CZ2 and L8.CD1 other bump:2.85986 Ang W4.CE2 and L8.CD1 other bump:2.88545 Ang W4.NE1 and L8.CD1 other bump:3.31688 Ang S3.CA and P6.CD other bump:2.92444 Ang S3.C and P6.CD neighbor-bump: 2.65383 Ang L5.N and P6.CD other bump:2.72043 Ang Q2.C and P6.CD other bump:1.67572 Ang Q2.O and P6.CD other bump:2.83751 Ang Q2.C and P6.CG other bump:1.70932 Ang Q2.O and P6.CG T0129 51 :DNHAYPT 1a8h 138 :ELVEGLC Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 9 residues other bump:2.4929 Ang H4.ND1 and G9.CA other bump:2.56342 Ang H4.CE1 and G9.CA other bump:2.19807 Ang A5.O and P7.CD other bump:2.73646 Ang A5.C and P7.CD T0129 59 :LVQPVTELYEQISQTLSDV 1a8h 145 :PIHGRPVERRKEGNYFFRM Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 21 residues neighbor-bump: 2.43033 Ang Q4.O and P5.CD neighbor-bump: 1.81154 Ang Q4.C and P5.CD self-bump: 2.22574 Ang P5.CA and P5.CD T0129 78 :EGFT 1a8h 199 :GDLS Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 6 residues neighbor-bump: 2.31505 Ang E2.CB and G3.N self-bump: 2.12471 Ang E2.CB and E2.C self-bump: 1.28797 Ang E2.CA and E2.CB T0129 84 :LG 1a8h 237 :AL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues T0129 89 :D 1a8h 242 :E Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 3 residues T0129 90 :ENVFTQADSLSDWAN 1a8h 253 :AWHLIGKDILKPHAV Fragment has 17 clashes (null) has 17 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 17 residues self-bump: 1.3435 Ang N16.CA and N16.CB other bump:1.75265 Ang T6.CG2 and W14.CH2 other bump:3.0841 Ang T6.CA and W14.CH2 other bump:2.60808 Ang T6.CB and W14.CH2 other bump:0.406354 Ang T6.CG2 and W14.CZ3 other bump:2.60205 Ang T6.OG1 and W14.CZ3 other bump:3.36557 Ang F5.C and W14.CZ3 other bump:3.08063 Ang T6.N and W14.CZ3 other bump:2.49264 Ang T6.CA and W14.CZ3 other bump:1.51781 Ang T6.CB and W14.CZ3 other bump:2.7185 Ang T6.CG2 and W14.CZ2 other bump:1.25313 Ang T6.CG2 and W14.CE3 other bump:2.69492 Ang T6.OG1 and W14.CE3 other bump:2.2543 Ang T6.CB and W14.CE3 other bump:2.92666 Ang T6.CG2 and W14.CE2 other bump:2.41403 Ang T6.CG2 and W14.CD2 other bump:2.66737 Ang Q7.CB and D9.OD1 T0129 105 :QFLLGIGLAQPE 1a8h 282 :RHLNVGGFLLGP Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues T0129 117 :LAKEKGEI 1a8h 298 :MSKTLGNV Fragment has 17 clashes (null) has 17 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 10 residues other bump:2.49123 Ang A3.N and I9.CD1 other bump:3.00087 Ang A3.CA and I9.CD1 other bump:2.27287 Ang K6.NZ and E8.OE2 other bump:1.97973 Ang K6.CD and E8.OE2 other bump:1.92286 Ang K6.CE and E8.OE2 other bump:2.15067 Ang K6.CB and E8.OE2 other bump:2.41201 Ang K6.CG and E8.OE2 other bump:1.99852 Ang K6.CA and E8.OE1 other bump:1.29152 Ang K6.CB and E8.OE1 other bump:1.9621 Ang K6.C and E8.OE1 other bump:2.89917 Ang K6.CD and E8.CD other bump:2.45936 Ang K6.CE and E8.CD other bump:3.00156 Ang K6.CA and E8.CD other bump:1.86631 Ang K6.CB and E8.CD other bump:2.87899 Ang K6.CG and E8.CD other bump:1.87067 Ang G1.O and K6.NZ other bump:2.87092 Ang G1.C and K6.NZ T0129 129 :DDLQDICQ 1a8h 306 :VDPFALLE Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 10 residues other bump:2.20342 Ang L4.O and C8.SG T0129 138 :GY 1a8h 314 :KY Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues T0129 145 :E 1a8h 378 :G Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 3 residues T0129 146 :EELAEALEEIIEYVRTIA 1a8h 398 :LKFHVALEEAMAYVKALN Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 20 residues other bump:2.28134 Ang E9.O and E13.CG T0129 168 :SHFNEGE 1a8h 416 :RYINEKK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 9 residues Number of specific fragments= 18 total=123 Number of alignments=16 # Reading fragments from alignment file # T0129 read from /projects/compbio/experiments/casp5/t0129/1a59/T0129-1a59-2track-local-adpstyle5.pw.a2m.gz # 1a59 read from /projects/compbio/experiments/casp5/t0129/1a59/T0129-1a59-2track-local-adpstyle5.pw.a2m.gz # found chain 1a59 in template set T0129 6 :SDLNQQLKSAGIGFNATELHGFL 1a59 191 :STFTARVITSTLADLHSAVTGAI Fragment has 92 clashes (null) has 92 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 25 residues other bump:2.92412 Ang E19.CG and F23.CZ other bump:2.36465 Ang E19.OE2 and F23.CZ other bump:2.04021 Ang Q6.CG and F23.CZ other bump:2.89448 Ang N5.C and F23.CZ other bump:1.6971 Ang Q6.N and F23.CZ other bump:0.706277 Ang Q6.CA and F23.CZ other bump:0.857809 Ang Q6.CB and F23.CZ other bump:1.85731 Ang Q6.C and F23.CZ other bump:2.57659 Ang Q7.N and F23.CZ other bump:3.03109 Ang E19.CG and F23.CE2 other bump:1.06429 Ang Q6.CG and F23.CE2 other bump:1.90564 Ang Q6.CD and F23.CE2 other bump:2.62212 Ang Q6.OE1 and F23.CE2 other bump:2.72078 Ang Q6.NE2 and F23.CE2 other bump:2.89546 Ang Q6.N and F23.CE2 other bump:1.9883 Ang Q6.CA and F23.CE2 other bump:0.582106 Ang Q6.CB and F23.CE2 other bump:2.98138 Ang Q6.C and F23.CE2 other bump:2.58184 Ang E19.OE2 and F23.CE1 other bump:2.48538 Ang Q6.CG and F23.CE1 other bump:2.96508 Ang N5.CA and F23.CE1 other bump:2.59735 Ang N5.O and F23.CE1 other bump:1.84644 Ang N5.C and F23.CE1 other bump:0.755251 Ang Q6.N and F23.CE1 other bump:1.20291 Ang Q6.CA and F23.CE1 other bump:2.0541 Ang Q6.CB and F23.CE1 other bump:2.58209 Ang Q6.C and F23.CE1 other bump:0.370774 Ang Q6.CG and F23.CD2 other bump:1.32432 Ang Q6.CD and F23.CD2 other bump:2.22324 Ang Q6.OE1 and F23.CD2 other bump:2.22564 Ang Q6.NE2 and F23.CD2 other bump:2.89167 Ang Q6.CA and F23.CD2 other bump:1.85573 Ang Q6.CB and F23.CD2 other bump:2.41333 Ang S2.O and F23.CD1 other bump:2.29071 Ang Q6.CG and F23.CD1 other bump:2.7085 Ang N5.C and F23.CD1 other bump:1.94379 Ang Q6.N and F23.CD1 other bump:2.42439 Ang Q6.CA and F23.CD1 other bump:2.71552 Ang Q6.CB and F23.CD1 other bump:1.48782 Ang Q6.CG and F23.CG other bump:2.61173 Ang Q6.CD and F23.CG other bump:3.05975 Ang Q6.N and F23.CG other bump:3.06577 Ang Q6.CA and F23.CG other bump:2.64851 Ang Q6.CB and F23.CG other bump:2.78259 Ang Q6.CG and F23.CB other bump:2.55635 Ang A17.O and H21.CD2 other bump:2.35058 Ang Q6.NE2 and L20.CD2 other bump:2.31432 Ang N5.O and E19.OE2 other bump:2.79236 Ang N5.C and E19.OE2 other bump:1.73371 Ang Q6.CA and E19.OE2 other bump:1.35461 Ang Q6.O and E19.OE2 other bump:1.36609 Ang Q6.C and E19.OE2 other bump:1.85209 Ang K9.CB and E19.OE1 other bump:2.49451 Ang K9.CA and E19.OE1 other bump:2.5349 Ang K9.C and E19.OE1 other bump:2.35814 Ang S10.N and E19.OE1 other bump:2.35164 Ang Q6.O and E19.OE1 other bump:2.7168 Ang K9.CB and E19.CD other bump:2.52585 Ang Q6.CA and E19.CD other bump:1.50489 Ang Q6.O and E19.CD other bump:2.22145 Ang Q6.C and E19.CD other bump:2.73074 Ang Q6.CA and E19.CG other bump:2.94046 Ang Q6.CB and E19.CG other bump:2.22703 Ang Q6.O and E19.CG other bump:2.77488 Ang Q6.C and E19.CG other bump:2.59908 Ang K9.CD and E19.CA other bump:2.54397 Ang K9.CE and E19.N other bump:2.12036 Ang K9.NZ and E19.N other bump:2.47553 Ang K9.CD and E19.N other bump:1.93109 Ang K9.CE and T18.C other bump:0.906497 Ang K9.NZ and T18.C other bump:2.42223 Ang K9.CD and T18.C other bump:2.23865 Ang K9.CE and T18.O other bump:1.43937 Ang K9.NZ and T18.O other bump:2.43705 Ang K9.CD and T18.O other bump:2.8043 Ang F15.CE2 and T18.OG1 other bump:1.89868 Ang F15.CE1 and T18.OG1 other bump:2.0109 Ang F15.CZ and T18.OG1 other bump:2.64408 Ang F15.CD1 and T18.OG1 other bump:1.48235 Ang K9.CE and T18.CG2 other bump:2.16039 Ang K9.NZ and T18.CG2 other bump:2.92735 Ang K9.CD and T18.CG2 other bump:1.97709 Ang K9.CE and T18.CB other bump:1.88672 Ang K9.NZ and T18.CB other bump:2.30062 Ang K9.CE and T18.CA other bump:1.1326 Ang K9.NZ and T18.CA other bump:2.7396 Ang F15.CE2 and T18.N other bump:2.46781 Ang K9.NZ and T18.N other bump:3.2718 Ang F15.CE2 and A17.C other bump:2.966 Ang F15.CE2 and A17.CB self-bump: 1.37819 Ang N16.CA and N16.CB neighbor-bump: 2.62489 Ang G12.C and I13.CB T0129 30 :GLLCGGLKDQSWLPLLYQFSNDNHAYPTGLVQPVTELYEQISQTLSDVEGF 1a59 214 :GALKGPLHGGANEAVMHTFEEIGIRKDESLDEAATRSKAWMVDALAQKKKV Fragment has 56 clashes (null) has 56 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 53 residues other bump:2.84031 Ang Q19.NE2 and F52.CZ other bump:2.15294 Ang Q19.OE1 and F52.CZ other bump:3.09751 Ang Q19.CD and F52.CE2 other bump:2.7103 Ang Q19.OE1 and F52.CE2 other bump:2.55622 Ang Q19.OE1 and F52.CE1 other bump:2.84102 Ang T45.CG2 and E50.CB other bump:2.96236 Ang Y39.CE2 and S43.OG other bump:2.27021 Ang D23.CG and Q41.OE1 other bump:1.83293 Ang D23.OD2 and Q41.OE1 other bump:2.74243 Ang D23.CG and Q41.CD other bump:2.5578 Ang D23.OD1 and Q41.CD other bump:2.69892 Ang D23.OD2 and Q41.CD other bump:2.7042 Ang T36.CG2 and E40.OE2 other bump:2.19113 Ang Q33.CD and E37.OE1 other bump:1.82842 Ang Q33.CG and E37.OE1 other bump:3.02632 Ang Q33.CG and E37.CD other bump:2.37798 Ang G30.O and P34.CD neighbor-bump: 1.82786 Ang Y27.CA and P28.CD neighbor-bump: 2.06939 Ang Y27.CB and P28.CD neighbor-bump: 1.66715 Ang Y27.O and P28.CD neighbor-bump: 0.900645 Ang Y27.C and P28.CD neighbor-bump: 3.08218 Ang Y27.CB and P28.CG neighbor-bump: 2.19682 Ang Y27.O and P28.CG neighbor-bump: 2.18693 Ang Y27.C and P28.CG neighbor-bump: 2.61959 Ang Y27.C and P28.CB other bump:2.42254 Ang F20.O and D23.O other bump:2.78316 Ang L14.CG and Y18.CE2 neighbor-bump: 2.57647 Ang L14.N and P15.CD other bump:1.67946 Ang Q11.O and P15.CD other bump:3.2609 Ang S12.CA and P15.CD other bump:2.93672 Ang S12.C and P15.CD other bump:2.79037 Ang Q11.C and P15.CD other bump:1.97699 Ang Q11.O and P15.CG other bump:2.99789 Ang Q11.C and P15.CG other bump:2.46745 Ang D10.O and W13.CD1 other bump:2.20986 Ang C5.O and Q11.OE1 other bump:3.16712 Ang G7.CA and Q11.CG other bump:2.48088 Ang C5.O and Q11.CG other bump:3.11583 Ang G6.C and Q11.CG other bump:2.90101 Ang G7.N and Q11.CG other bump:3.05219 Ang G7.CA and Q11.CB other bump:2.10094 Ang C5.O and Q11.CB other bump:3.00012 Ang C5.C and Q11.CB other bump:2.38192 Ang G6.C and Q11.CB other bump:2.73065 Ang G7.N and Q11.CB other bump:3.28036 Ang G6.CA and Q11.CB other bump:2.2924 Ang G6.O and Q11.CB other bump:1.42148 Ang L4.CG and D10.OD2 other bump:1.07284 Ang L4.CD1 and D10.OD2 other bump:1.83053 Ang L4.CD2 and D10.OD2 other bump:2.03079 Ang L4.CD1 and D10.OD1 other bump:2.12215 Ang L4.CG and D10.CG other bump:1.38176 Ang L4.CD1 and D10.CG other bump:2.6557 Ang L4.O and D10.CB other bump:2.50793 Ang L4.CG and D10.CB other bump:2.51363 Ang L4.CD1 and D10.CB T0129 81 :TF 1a59 268 :GH Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues neighbor-bump: 1.8461 Ang G1.O and T2.OG1 neighbor-bump: 2.69831 Ang G1.C and T2.OG1 T0129 85 :GLTEDEN 1a59 270 :RVYKNGD Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 9 residues other bump:2.65254 Ang T4.CG2 and E7.C other bump:2.11731 Ang T4.CG2 and E7.O neighbor-bump: 2.11964 Ang D6.O and E7.CG neighbor-bump: 2.8517 Ang D6.C and E7.CG neighbor-bump: 2.20633 Ang D6.O and E7.CB neighbor-bump: 2.64668 Ang D6.C and E7.CB T0129 92 :VFTQADSLSDWANQF 1a59 279 :VPTMKSALDAMIKHY Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 17 residues other bump:2.5523 Ang W12.CZ3 and F16.CZ other bump:3.09729 Ang W12.CE3 and F16.CZ other bump:2.13614 Ang W12.CZ3 and F16.CE2 other bump:2.03351 Ang W12.CE3 and F16.CE2 other bump:3.44742 Ang W12.CH2 and F16.CE2 other bump:2.78337 Ang W12.CE3 and F16.CD2 T0129 113 :AQPELAKEKGEIGEAVDDLQ 1a59 294 :DRPEMLGLYNGLEAAMEEAK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 22 residues Number of specific fragments= 6 total=129 Number of alignments=17 # Reading fragments from alignment file # T0129 read from /projects/compbio/experiments/casp5/t0129/1a59/T0129-1a59-2track-local-adpstyle1.pw.a2m.gz # 1a59 read from /projects/compbio/experiments/casp5/t0129/1a59/T0129-1a59-2track-local-adpstyle1.pw.a2m.gz # found chain 1a59 in template set T0129 6 :SDLNQQLKSAGIGFNATELHGFL 1a59 191 :STFTARVITSTLADLHSAVTGAI Fragment has 92 clashes (null) has 92 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 25 residues other bump:2.92412 Ang E19.CG and F23.CZ other bump:2.36465 Ang E19.OE2 and F23.CZ other bump:2.04021 Ang Q6.CG and F23.CZ other bump:2.89448 Ang N5.C and F23.CZ other bump:1.6971 Ang Q6.N and F23.CZ other bump:0.706277 Ang Q6.CA and F23.CZ other bump:0.857809 Ang Q6.CB and F23.CZ other bump:1.85731 Ang Q6.C and F23.CZ other bump:2.57659 Ang Q7.N and F23.CZ other bump:3.03109 Ang E19.CG and F23.CE2 other bump:1.06429 Ang Q6.CG and F23.CE2 other bump:1.90564 Ang Q6.CD and F23.CE2 other bump:2.62212 Ang Q6.OE1 and F23.CE2 other bump:2.72078 Ang Q6.NE2 and F23.CE2 other bump:2.89546 Ang Q6.N and F23.CE2 other bump:1.9883 Ang Q6.CA and F23.CE2 other bump:0.582106 Ang Q6.CB and F23.CE2 other bump:2.98138 Ang Q6.C and F23.CE2 other bump:2.58184 Ang E19.OE2 and F23.CE1 other bump:2.48538 Ang Q6.CG and F23.CE1 other bump:2.96508 Ang N5.CA and F23.CE1 other bump:2.59735 Ang N5.O and F23.CE1 other bump:1.84644 Ang N5.C and F23.CE1 other bump:0.755251 Ang Q6.N and F23.CE1 other bump:1.20291 Ang Q6.CA and F23.CE1 other bump:2.0541 Ang Q6.CB and F23.CE1 other bump:2.58209 Ang Q6.C and F23.CE1 other bump:0.370774 Ang Q6.CG and F23.CD2 other bump:1.32432 Ang Q6.CD and F23.CD2 other bump:2.22324 Ang Q6.OE1 and F23.CD2 other bump:2.22564 Ang Q6.NE2 and F23.CD2 other bump:2.89167 Ang Q6.CA and F23.CD2 other bump:1.85573 Ang Q6.CB and F23.CD2 other bump:2.41333 Ang S2.O and F23.CD1 other bump:2.29071 Ang Q6.CG and F23.CD1 other bump:2.7085 Ang N5.C and F23.CD1 other bump:1.94379 Ang Q6.N and F23.CD1 other bump:2.42439 Ang Q6.CA and F23.CD1 other bump:2.71552 Ang Q6.CB and F23.CD1 other bump:1.48782 Ang Q6.CG and F23.CG other bump:2.61173 Ang Q6.CD and F23.CG other bump:3.05975 Ang Q6.N and F23.CG other bump:3.06577 Ang Q6.CA and F23.CG other bump:2.64851 Ang Q6.CB and F23.CG other bump:2.78259 Ang Q6.CG and F23.CB other bump:2.55635 Ang A17.O and H21.CD2 other bump:2.35058 Ang Q6.NE2 and L20.CD2 other bump:2.31432 Ang N5.O and E19.OE2 other bump:2.79236 Ang N5.C and E19.OE2 other bump:1.73371 Ang Q6.CA and E19.OE2 other bump:1.35461 Ang Q6.O and E19.OE2 other bump:1.36609 Ang Q6.C and E19.OE2 other bump:1.85209 Ang K9.CB and E19.OE1 other bump:2.49451 Ang K9.CA and E19.OE1 other bump:2.5349 Ang K9.C and E19.OE1 other bump:2.35814 Ang S10.N and E19.OE1 other bump:2.35164 Ang Q6.O and E19.OE1 other bump:2.7168 Ang K9.CB and E19.CD other bump:2.52585 Ang Q6.CA and E19.CD other bump:1.50489 Ang Q6.O and E19.CD other bump:2.22145 Ang Q6.C and E19.CD other bump:2.73074 Ang Q6.CA and E19.CG other bump:2.94046 Ang Q6.CB and E19.CG other bump:2.22703 Ang Q6.O and E19.CG other bump:2.77488 Ang Q6.C and E19.CG other bump:2.59908 Ang K9.CD and E19.CA other bump:2.54397 Ang K9.CE and E19.N other bump:2.12036 Ang K9.NZ and E19.N other bump:2.47553 Ang K9.CD and E19.N other bump:1.93109 Ang K9.CE and T18.C other bump:0.906497 Ang K9.NZ and T18.C other bump:2.42223 Ang K9.CD and T18.C other bump:2.23865 Ang K9.CE and T18.O other bump:1.43937 Ang K9.NZ and T18.O other bump:2.43705 Ang K9.CD and T18.O other bump:2.8043 Ang F15.CE2 and T18.OG1 other bump:1.89868 Ang F15.CE1 and T18.OG1 other bump:2.0109 Ang F15.CZ and T18.OG1 other bump:2.64408 Ang F15.CD1 and T18.OG1 other bump:1.48235 Ang K9.CE and T18.CG2 other bump:2.16039 Ang K9.NZ and T18.CG2 other bump:2.92735 Ang K9.CD and T18.CG2 other bump:1.97709 Ang K9.CE and T18.CB other bump:1.88672 Ang K9.NZ and T18.CB other bump:2.30062 Ang K9.CE and T18.CA other bump:1.1326 Ang K9.NZ and T18.CA other bump:2.7396 Ang F15.CE2 and T18.N other bump:2.46781 Ang K9.NZ and T18.N other bump:3.2718 Ang F15.CE2 and A17.C other bump:2.966 Ang F15.CE2 and A17.CB self-bump: 1.37819 Ang N16.CA and N16.CB neighbor-bump: 2.62489 Ang G12.C and I13.CB T0129 30 :GLLCGGLKDQSWLPLLYQFSNDNHAYPTGLVQPVTELYEQISQTLSDVEGF 1a59 214 :GALKGPLHGGANEAVMHTFEEIGIRKDESLDEAATRSKAWMVDALAQKKKV Fragment has 56 clashes (null) has 56 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 53 residues other bump:2.84031 Ang Q19.NE2 and F52.CZ other bump:2.15294 Ang Q19.OE1 and F52.CZ other bump:3.09751 Ang Q19.CD and F52.CE2 other bump:2.7103 Ang Q19.OE1 and F52.CE2 other bump:2.55622 Ang Q19.OE1 and F52.CE1 other bump:2.84102 Ang T45.CG2 and E50.CB other bump:2.96236 Ang Y39.CE2 and S43.OG other bump:2.27021 Ang D23.CG and Q41.OE1 other bump:1.83293 Ang D23.OD2 and Q41.OE1 other bump:2.74243 Ang D23.CG and Q41.CD other bump:2.5578 Ang D23.OD1 and Q41.CD other bump:2.69892 Ang D23.OD2 and Q41.CD other bump:2.7042 Ang T36.CG2 and E40.OE2 other bump:2.19113 Ang Q33.CD and E37.OE1 other bump:1.82842 Ang Q33.CG and E37.OE1 other bump:3.02632 Ang Q33.CG and E37.CD other bump:2.37798 Ang G30.O and P34.CD neighbor-bump: 1.82786 Ang Y27.CA and P28.CD neighbor-bump: 2.06939 Ang Y27.CB and P28.CD neighbor-bump: 1.66715 Ang Y27.O and P28.CD neighbor-bump: 0.900645 Ang Y27.C and P28.CD neighbor-bump: 3.08218 Ang Y27.CB and P28.CG neighbor-bump: 2.19682 Ang Y27.O and P28.CG neighbor-bump: 2.18693 Ang Y27.C and P28.CG neighbor-bump: 2.61959 Ang Y27.C and P28.CB other bump:2.42254 Ang F20.O and D23.O other bump:2.78316 Ang L14.CG and Y18.CE2 neighbor-bump: 2.57647 Ang L14.N and P15.CD other bump:1.67946 Ang Q11.O and P15.CD other bump:3.2609 Ang S12.CA and P15.CD other bump:2.93672 Ang S12.C and P15.CD other bump:2.79037 Ang Q11.C and P15.CD other bump:1.97699 Ang Q11.O and P15.CG other bump:2.99789 Ang Q11.C and P15.CG other bump:2.46745 Ang D10.O and W13.CD1 other bump:2.20986 Ang C5.O and Q11.OE1 other bump:3.16712 Ang G7.CA and Q11.CG other bump:2.48088 Ang C5.O and Q11.CG other bump:3.11583 Ang G6.C and Q11.CG other bump:2.90101 Ang G7.N and Q11.CG other bump:3.05219 Ang G7.CA and Q11.CB other bump:2.10094 Ang C5.O and Q11.CB other bump:3.00012 Ang C5.C and Q11.CB other bump:2.38192 Ang G6.C and Q11.CB other bump:2.73065 Ang G7.N and Q11.CB other bump:3.28036 Ang G6.CA and Q11.CB other bump:2.2924 Ang G6.O and Q11.CB other bump:1.42148 Ang L4.CG and D10.OD2 other bump:1.07284 Ang L4.CD1 and D10.OD2 other bump:1.83053 Ang L4.CD2 and D10.OD2 other bump:2.03079 Ang L4.CD1 and D10.OD1 other bump:2.12215 Ang L4.CG and D10.CG other bump:1.38176 Ang L4.CD1 and D10.CG other bump:2.6557 Ang L4.O and D10.CB other bump:2.50793 Ang L4.CG and D10.CB other bump:2.51363 Ang L4.CD1 and D10.CB Number of specific fragments= 2 total=131 Number of alignments=18 # Reading fragments from alignment file # T0129 read from /projects/compbio/experiments/casp5/t0129/1iapA/T0129-1iapA-2track-local-adpstyle5.pw.a2m.gz # 1iapA read from /projects/compbio/experiments/casp5/t0129/1iapA/T0129-1iapA-2track-local-adpstyle5.pw.a2m.gz # found chain 1iapA in template set T0129 6 :SDLNQQLKSAGIGFNATELHGFLSGLLCGGLKD 1iapA 57 :AHLMALLQHVALQFEPGPLLCCLHADMLGSLGP Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 35 residues T0129 39 :QSWLPLLYQFSNDN 1iapA 94 :KAFLDFYHSFLEKT Fragment has 19 clashes (null) has 19 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 16 residues neighbor-bump: 2.00124 Ang Q10.CD and F11.CZ neighbor-bump: 1.75299 Ang Q10.OE1 and F11.CZ neighbor-bump: 1.83883 Ang Q10.NE2 and F11.CZ neighbor-bump: 2.37591 Ang Q10.CD and F11.CE2 neighbor-bump: 1.54673 Ang Q10.OE1 and F11.CE2 neighbor-bump: 2.72488 Ang Q10.NE2 and F11.CE2 neighbor-bump: 2.35422 Ang Q10.CD and F11.CE1 neighbor-bump: 2.10621 Ang Q10.OE1 and F11.CE1 neighbor-bump: 2.43206 Ang Q10.NE2 and F11.CE1 neighbor-bump: 2.97155 Ang Q10.CD and F11.CD2 neighbor-bump: 1.75743 Ang Q10.OE1 and F11.CD2 neighbor-bump: 2.95267 Ang Q10.CD and F11.CD1 neighbor-bump: 2.26036 Ang Q10.OE1 and F11.CD1 neighbor-bump: 2.12049 Ang Q10.OE1 and F11.CG other bump:2.57011 Ang L5.O and Y9.CD2 other bump:3.09431 Ang S3.C and P6.CD other bump:1.85349 Ang Q2.O and P6.CD other bump:2.9974 Ang Q2.C and P6.CD other bump:2.55214 Ang Q2.O and P6.CG T0129 53 :HAYPTGLVQPV 1iapA 112 :VPVPPNVAFEL Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 13 residues other bump:2.23232 Ang H2.O and Y4.CE1 other bump:3.2237 Ang H2.C and Y4.CE1 other bump:2.158 Ang H2.O and Y4.CD1 T0129 64 :TELYEQISQTLSDVE 1iapA 132 :EDVQRRFVQEVVQSQ Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 17 residues T0129 92 :VFTQADSLSDWANQFLLGIGLAQPELAKEK 1iapA 147 :QVAVGRQLEDFRSKRLMGMTPWEQELAQLE Fragment has 18 clashes (null) has 18 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 32 residues other bump:2.06659 Ang E26.O and E30.OE2 other bump:2.66233 Ang E26.C and E30.OE2 other bump:1.12893 Ang E26.O and E30.OE1 other bump:1.96701 Ang E26.C and E30.OE1 other bump:2.35042 Ang L27.CA and E30.OE1 other bump:2.59787 Ang L27.C and E30.OE1 other bump:1.71891 Ang E26.O and E30.CD other bump:2.63897 Ang E26.C and E30.CD other bump:2.74011 Ang F16.CE1 and Q24.NE2 other bump:2.32825 Ang F16.CZ and Q24.NE2 other bump:2.18679 Ang F16.CD1 and Q24.OE1 other bump:1.29549 Ang F16.CE1 and Q24.OE1 other bump:2.17348 Ang F16.CZ and Q24.OE1 other bump:2.25831 Ang F16.CE1 and Q24.CD other bump:2.50319 Ang F16.CZ and Q24.CD other bump:2.88793 Ang L18.CB and I20.CD1 other bump:1.84537 Ang Q15.NE2 and I20.CG2 other bump:2.94897 Ang Q15.CD and I20.CG2 T0129 135 :CQLGYDEDDNEEELAEALEEIIE 1iapA 177 :AWVGRDRASYEARERHVAERLLM Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 25 residues other bump:2.02031 Ang D9.O and E13.OE2 other bump:2.68255 Ang D9.C and E13.OE2 other bump:1.07797 Ang D9.O and E13.OE1 other bump:1.91677 Ang D9.C and E13.OE1 other bump:2.37856 Ang D10.N and E13.OE1 other bump:2.2811 Ang D10.CA and E13.OE1 other bump:2.62892 Ang D10.C and E13.OE1 other bump:1.63429 Ang D9.O and E13.CD other bump:2.61899 Ang D9.C and E13.CD other bump:2.61861 Ang D7.OD1 and D10.CG Number of specific fragments= 6 total=137 Number of alignments=19 # Reading fragments from alignment file # T0129 read from /projects/compbio/experiments/casp5/t0129/1iapA/T0129-1iapA-2track-local-adpstyle1.pw.a2m.gz # 1iapA read from /projects/compbio/experiments/casp5/t0129/1iapA/T0129-1iapA-2track-local-adpstyle1.pw.a2m.gz # found chain 1iapA in template set T0129 7 :DLNQQLKSAGIGFNATELHGFLSGLLCGGLKDQSWLPLLYQFS 1iapA 58 :HLMALLQHVALQFEPGPLLCCLHADMLGSLGPKEAKKAFLDFY Fragment has 65 clashes (null) has 65 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 45 residues other bump:1.46356 Ang L31.CD1 and L39.CD1 other bump:2.94872 Ang L31.CG and W36.CH2 other bump:3.16748 Ang L31.CB and W36.CH2 other bump:1.86089 Ang L27.O and W36.CH2 other bump:2.60329 Ang L27.C and W36.CH2 other bump:2.79345 Ang C28.N and W36.CH2 other bump:2.32351 Ang C28.CA and W36.CH2 other bump:1.90577 Ang C28.O and W36.CH2 other bump:1.87317 Ang C28.C and W36.CH2 other bump:2.68024 Ang G29.N and W36.CH2 other bump:2.60901 Ang G30.N and W36.CH2 other bump:2.66813 Ang L31.N and W36.CH2 other bump:2.6197 Ang L27.O and W36.CZ3 other bump:2.89403 Ang L27.C and W36.CZ3 other bump:2.4785 Ang C28.N and W36.CZ3 other bump:1.39354 Ang C28.CA and W36.CZ3 other bump:2.64075 Ang C28.CB and W36.CZ3 other bump:1.64674 Ang C28.O and W36.CZ3 other bump:1.53987 Ang C28.C and W36.CZ3 other bump:2.79246 Ang G29.N and W36.CZ3 other bump:2.79162 Ang L31.CG and W36.CZ2 other bump:2.30416 Ang L31.CA and W36.CZ2 other bump:2.48257 Ang L31.CB and W36.CZ2 other bump:2.91204 Ang L27.O and W36.CZ2 other bump:2.12646 Ang C28.O and W36.CZ2 other bump:2.70052 Ang C28.C and W36.CZ2 other bump:3.04621 Ang G29.C and W36.CZ2 other bump:2.32286 Ang G30.N and W36.CZ2 other bump:2.75439 Ang G30.CA and W36.CZ2 other bump:2.27653 Ang G30.C and W36.CZ2 other bump:1.34316 Ang L31.N and W36.CZ2 other bump:1.60913 Ang L31.CA and W36.NE1 other bump:2.28951 Ang L31.CB and W36.NE1 other bump:1.14189 Ang L31.C and W36.NE1 other bump:2.41131 Ang K32.N and W36.NE1 other bump:1.08833 Ang L31.O and W36.NE1 other bump:3.22288 Ang G30.C and W36.NE1 other bump:2.03876 Ang L31.N and W36.NE1 other bump:2.36397 Ang C28.CA and W36.CE3 other bump:3.0098 Ang C28.CB and W36.CE3 other bump:1.6551 Ang C28.O and W36.CE3 other bump:2.25004 Ang C28.C and W36.CE3 other bump:2.95249 Ang L31.CG and W36.CE2 other bump:1.88719 Ang L31.CA and W36.CE2 other bump:1.95901 Ang L31.CB and W36.CE2 other bump:2.39261 Ang L31.C and W36.CE2 other bump:2.39649 Ang L31.O and W36.CE2 other bump:2.07924 Ang C28.O and W36.CE2 other bump:3.13572 Ang C28.C and W36.CE2 other bump:3.01285 Ang G30.C and W36.CE2 other bump:1.70638 Ang L31.N and W36.CE2 other bump:2.99882 Ang L31.CA and W36.CD2 other bump:2.39556 Ang L31.CB and W36.CD2 other bump:1.85372 Ang C28.O and W36.CD2 other bump:2.9491 Ang C28.C and W36.CD2 other bump:2.72204 Ang L31.CA and W36.CD1 other bump:2.85146 Ang L31.CB and W36.CD1 other bump:1.81105 Ang L31.C and W36.CD1 other bump:2.53975 Ang K32.N and W36.CD1 other bump:1.47427 Ang L31.O and W36.CD1 other bump:3.01171 Ang K32.CA and W36.CD1 other bump:2.31815 Ang K32.O and W36.CD1 other bump:2.71425 Ang K32.C and W36.CD1 other bump:2.91937 Ang L31.CB and W36.CG other bump:2.97773 Ang L31.C and W36.CG Number of specific fragments= 1 total=138 Number of alignments=20 # Reading fragments from alignment file # T0129 read from /projects/compbio/experiments/casp5/t0129/1csh/1csh-T0129-fssp-global-adpstyle5.pw.a2m.gz # 1csh read from /projects/compbio/experiments/casp5/t0129/1csh/1csh-T0129-fssp-global-adpstyle5.pw.a2m.gz # found chain 1csh in template set T0129 1 :ML 1csh 3 :ST Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 3 residues self-bump: 1.34686 Ang M1.CA and M1.CB T0129 3 :I 1csh 14 :I Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 3 residues T0129 4 :SHSDLNQQLKSAGIGFNATELHGFLS 1csh 54 :ETSVLDPDEGIRFRGFSIPECQKLLP Fragment has 9 clashes (null) has 9 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:2.48547 Ang L22.CG and L26.CD1 other bump:2.69187 Ang N18.OD1 and E21.CD other bump:2.62399 Ang N18.OD1 and E21.CG other bump:2.70758 Ang N18.OD1 and E21.CB neighbor-bump: 2.44383 Ang L10.O and K11.CD neighbor-bump: 1.34194 Ang L10.O and K11.CG neighbor-bump: 2.40209 Ang L10.C and K11.CG neighbor-bump: 1.85107 Ang L10.O and K11.CB neighbor-bump: 2.4267 Ang L10.C and K11.CB T0129 30 :GLLCGGLKDQSWLPLLYQ 1csh 95 :LLVTGQIPTPEQVSWVSK Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 20 residues other bump:2.72065 Ang Q11.C and P15.CD other bump:3.07342 Ang S12.C and P15.CD other bump:1.57794 Ang Q11.O and P15.CD self-bump: 1.36599 Ang P15.N and P15.CD other bump:3.25554 Ang Q11.C and P15.CG other bump:2.08377 Ang Q11.O and P15.CG T0129 48 :FSNDNHAYPTGLVQPV 1csh 151 :ESNFARAYAEGINRTK Fragment has 11 clashes (null) has 11 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 18 residues neighbor-bump: 2.56956 Ang Q15.N and P16.CD self-bump: 1.37556 Ang P16.N and P16.CD other bump:2.87268 Ang V14.C and P16.CD other bump:2.41142 Ang A8.CB and L13.CD1 self-bump: 1.39116 Ang P10.N and P10.CD neighbor-bump: 2.61102 Ang Y9.N and P10.CD other bump:1.62167 Ang N6.O and P10.CD other bump:2.76998 Ang N6.C and P10.CD other bump:3.12014 Ang H7.C and P10.CD other bump:1.85706 Ang N6.O and P10.CG other bump:2.98169 Ang N6.C and P10.CG T0129 64 :TEL 1csh 169 :EFV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 5 residues T0129 67 :YEQISQTLSDVEGFTFELGLTEDE 1csh 200 :IGAIDSKLDWSHNFTNMLGYTDPQ Fragment has 26 clashes (null) has 26 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 26 residues other bump:2.76558 Ang G14.C and E18.OE2 other bump:2.19886 Ang G14.O and E18.OE2 other bump:2.49964 Ang F15.CA and E18.OE1 other bump:1.86477 Ang G14.C and E18.OE1 other bump:2.76061 Ang F15.C and E18.OE1 other bump:0.987966 Ang G14.O and E18.OE1 other bump:2.63814 Ang G14.C and E18.CD other bump:1.73932 Ang G14.O and E18.CD other bump:2.45764 Ang E13.OE2 and F17.CZ other bump:2.29491 Ang E13.CD and F17.CE1 other bump:1.51272 Ang E13.OE2 and F17.CE1 other bump:2.84185 Ang E13.CD and F17.CD1 other bump:2.55194 Ang E13.OE2 and F17.CD1 other bump:2.61771 Ang L9.CD1 and E13.OE2 other bump:2.42608 Ang L9.CB and E13.OE1 other bump:2.34489 Ang L9.CG and E13.OE1 other bump:1.48639 Ang L9.CD1 and E13.OE1 other bump:2.31242 Ang L9.CD1 and E13.CD neighbor-bump: 2.84472 Ang Q4.OE1 and I5.C neighbor-bump: 2.69943 Ang Q4.CD and I5.O neighbor-bump: 1.87174 Ang Q4.OE1 and I5.O neighbor-bump: 2.7977 Ang Q4.CD and I5.N neighbor-bump: 2.3322 Ang Y2.O and E3.CG neighbor-bump: 2.75382 Ang Y2.C and E3.CG neighbor-bump: 1.85616 Ang Y2.O and E3.CB neighbor-bump: 2.34525 Ang Y2.C and E3.CB T0129 91 :N 1csh 242 :N Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 3 residues T0129 92 :VFTQADSLSDWANQFLLGI 1csh 248 :SHLVGSALSDPYLSFAAAM Fragment has 24 clashes (null) has 24 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 21 residues other bump:3.05591 Ang F16.CE2 and I20.CD1 other bump:2.51257 Ang Q5.CG and L18.CD1 other bump:1.43148 Ang Q5.CD and L18.CD1 other bump:0.465913 Ang Q5.OE1 and L18.CD1 other bump:2.43256 Ang Q5.NE2 and L18.CD1 other bump:2.26439 Ang Q5.CD and L18.CG other bump:1.57193 Ang Q5.OE1 and L18.CG other bump:2.48712 Ang Q5.NE2 and L18.CG other bump:2.30202 Ang Q5.CD and L18.CB other bump:2.35066 Ang Q5.OE1 and L18.CB other bump:1.67251 Ang Q5.NE2 and L18.CB other bump:2.08464 Ang V2.CG1 and Q15.NE2 other bump:2.48611 Ang V2.CB and Q15.OE1 other bump:1.47143 Ang V2.CG1 and Q15.OE1 other bump:2.62851 Ang V2.O and Q15.CD other bump:3.08037 Ang V2.C and Q15.CD other bump:2.86024 Ang V2.CB and Q15.CD other bump:1.77018 Ang V2.CG1 and Q15.CD other bump:3.0711 Ang V2.CA and Q15.CD other bump:2.35199 Ang V2.O and Q15.CG other bump:3.1181 Ang V2.C and Q15.CG other bump:3.05312 Ang V2.CG1 and Q15.CG other bump:3.20571 Ang V2.CA and Q15.CG other bump:2.97291 Ang F3.CE2 and D7.OD2 T0129 111 :GLAQPELAKEKGEIGEAVDDLQD 1csh 275 :GLANQEVLLWLSQLQKDLGADAS Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 25 residues other bump:2.18807 Ang V19.CG2 and Q23.OE1 other bump:2.27819 Ang V19.CB and Q23.OE1 other bump:2.08433 Ang V19.CG1 and Q23.OE1 other bump:2.85281 Ang V19.CB and Q23.CD other bump:2.24018 Ang V19.CG1 and Q23.CD other bump:1.94638 Ang V19.CG1 and Q23.CG T0129 134 :I 1csh 315 :V Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 3 residues T0129 135 :CQ 1csh 332 :CQ Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues T0129 137 :LGYDEDDNEEELAEALEEIIEYVRT 1csh 338 :LKHLPSDPMFKLVAQLYKIVPNVLL Fragment has 14 clashes (null) has 14 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 27 residues other bump:2.64311 Ang I21.CG2 and R25.NH2 other bump:1.93978 Ang I21.CG2 and R25.NH1 other bump:2.3441 Ang I21.CG2 and R25.CZ other bump:2.19838 Ang E18.O and E22.OE1 other bump:1.55278 Ang L2.O and E6.OE2 other bump:2.19123 Ang L2.C and E6.OE2 other bump:2.48395 Ang G3.CA and E6.OE2 other bump:2.42437 Ang G3.O and E6.OE2 other bump:2.1935 Ang G3.C and E6.OE2 other bump:1.99678 Ang L2.O and E6.CD other bump:2.86309 Ang L2.C and E6.CD other bump:2.00043 Ang L2.O and E6.CG other bump:2.91595 Ang L2.C and E6.CG other bump:2.8396 Ang G1.C and D5.OD1 T0129 162 :IAMLFYS 1csh 388 :TEMNYYT Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 9 residues T0129 169 :HFNEG 1csh 413 :RALGF Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 7 residues T0129 174 :EIESKPVL 1csh 429 :GLEKLSAG Fragment has 15 clashes (null) has 15 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 10 residues other bump:2.74458 Ang S5.N and L9.CD2 other bump:1.76969 Ang E4.CA and L9.CD2 other bump:2.65597 Ang E4.O and L9.CD2 other bump:2.05565 Ang E4.C and L9.CD2 other bump:1.12459 Ang E4.CB and L9.CD2 other bump:2.49085 Ang E4.CG and L9.CD2 other bump:3.21571 Ang E4.CA and L9.CG other bump:3.02463 Ang E4.C and L9.CG other bump:2.50598 Ang E4.CB and L9.CG neighbor-bump: 2.24875 Ang P7.O and V8.CG2 neighbor-bump: 2.95594 Ang P7.C and V8.CG2 other bump:1.83848 Ang I3.O and P7.CD neighbor-bump: 2.75984 Ang K6.CB and P7.CD other bump:3.02868 Ang I3.C and P7.CD other bump:2.49168 Ang I3.O and P7.CG Number of specific fragments= 16 total=154 Number of alignments=21 # Reading fragments from alignment file # T0129 read from /projects/compbio/experiments/casp5/t0129/1auwA/1auwA-T0129-fssp-global-adpstyle5.pw.a2m.gz # 1auwA read from /projects/compbio/experiments/casp5/t0129/1auwA/1auwA-T0129-fssp-global-adpstyle5.pw.a2m.gz # found chain 1auwA in template set T0129 10 :QQLKS 1auwA 81 :VKQSD Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 7 residues T0129 15 :AGIGFNATELHGFLSGLLCGGLKDQSWL 1auwA 94 :RRLKELIGDIAGKLHTGRSRNDQVVTDL Fragment has 20 clashes (null) has 20 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 30 residues other bump:2.18451 Ang A8.CB and H12.NE2 other bump:2.56312 Ang I4.O and H12.CE1 other bump:3.00691 Ang I4.C and H12.CE1 other bump:3.06965 Ang I4.CB and H12.CE1 other bump:1.92464 Ang I4.CG2 and H12.CE1 other bump:2.78201 Ang I4.C and H12.ND1 other bump:3.08266 Ang I4.CA and H12.ND1 other bump:2.56843 Ang I4.CB and H12.ND1 other bump:1.26985 Ang I4.CG2 and H12.ND1 other bump:3.25962 Ang A8.CA and H12.CD2 other bump:2.7112 Ang A8.CB and H12.CD2 other bump:3.26263 Ang I4.C and H12.CG other bump:2.58147 Ang I4.CG2 and H12.CG neighbor-bump: 3.03311 Ang T9.CG2 and E10.CA neighbor-bump: 2.41053 Ang T9.CB and E10.N neighbor-bump: 1.9392 Ang T9.CG2 and E10.N self-bump: 2.21428 Ang T9.CB and T9.C self-bump: 2.42097 Ang T9.CG2 and T9.C self-bump: 1.3061 Ang T9.CA and T9.CB other bump:2.46711 Ang A2.O and F6.CD1 T0129 43 :PLLYQFSNDNHAYPTGLVQPVTELYEQISQTL 1auwA 153 :VILPGYTHLQKAQPIRWSQFLLSHAVALTRDS Fragment has 26 clashes (null) has 26 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 34 residues other bump:2.45404 Ang V22.CG1 and Y26.CE1 other bump:2.39093 Ang V22.O and Y26.CD1 other bump:1.89674 Ang Q20.O and E24.OE2 other bump:2.50088 Ang Q20.C and E24.OE2 other bump:2.43061 Ang Q20.CG and E24.OE2 other bump:2.40444 Ang P21.CA and E24.OE1 other bump:1.25602 Ang Q20.O and E24.OE1 other bump:2.1257 Ang Q20.C and E24.OE1 other bump:2.57527 Ang P21.C and E24.OE1 other bump:1.64128 Ang Q20.O and E24.CD other bump:2.62872 Ang Q20.C and E24.CD other bump:2.36653 Ang L18.O and P21.CD other bump:2.73452 Ang L18.C and P21.CD other bump:2.10548 Ang G17.O and P21.CD other bump:3.16193 Ang G17.C and P21.CD other bump:3.24153 Ang L18.CA and P21.CD other bump:2.11022 Ang Q6.CG and T16.OG1 other bump:2.87089 Ang Q6.CD and T16.OG1 other bump:1.66398 Ang Q6.CG and T16.CG2 other bump:0.923513 Ang Q6.CD and T16.CG2 other bump:1.49891 Ang Q6.NE2 and T16.CG2 other bump:1.72416 Ang Q6.OE1 and T16.CG2 other bump:2.29908 Ang Q6.CG and T16.CB other bump:2.26728 Ang Q6.CD and T16.CB other bump:2.02264 Ang Q6.NE2 and T16.CB other bump:2.44965 Ang Q6.OE1 and Y14.CE1 T0129 75 :SDVEGFT 1auwA 202 :GALAGNP Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 9 residues other bump:2.65196 Ang S2.OG and G6.C other bump:2.60586 Ang S2.CB and G6.O other bump:1.49698 Ang S2.OG and G6.O neighbor-bump: 2.08541 Ang D3.O and V4.CG2 neighbor-bump: 2.77117 Ang D3.C and V4.CG2 T0129 82 :FELGLTEDENVFTQADSLSDWANQFLLGIGLAQ 1auwA 218 :SELEFASISLNSMDAISERDFVVEFLSFATLLM Fragment has 19 clashes (null) has 19 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 35 residues other bump:2.72166 Ang F26.CE1 and I30.CD1 other bump:2.3783 Ang F26.CE2 and I30.CD1 other bump:2.3178 Ang F26.CZ and I30.CD1 other bump:2.82435 Ang F26.CD2 and I30.CD1 other bump:1.99071 Ang Q15.CG and L19.CD1 other bump:2.66544 Ang Q15.CD and L19.CD1 other bump:2.80451 Ang Q15.NE2 and L19.CD1 other bump:2.83333 Ang Q15.CG and L19.CG other bump:2.7627 Ang E10.OE2 and A16.C other bump:1.30089 Ang E10.OE2 and A16.CB other bump:2.70678 Ang E10.CG and A16.CB other bump:1.19989 Ang E10.CD and A16.CB other bump:1.23526 Ang E10.OE1 and A16.CB other bump:1.27619 Ang E10.OE2 and A16.CA other bump:2.26299 Ang E10.CD and A16.CA other bump:2.699 Ang E10.OE1 and A16.CA other bump:1.89295 Ang E10.OE2 and A16.N other bump:2.95681 Ang E10.CD and A16.N neighbor-bump: 2.8339 Ang N11.OD1 and V12.CG2 T0129 115 :PELAKE 1auwA 254 :SKMAED Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 8 residues T0129 121 :KGEIGE 1auwA 265 :TSEFGF Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 8 residues other bump:2.67083 Ang I5.CG2 and E7.CG T0129 127 :AV 1auwA 274 :SD Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues T0129 129 :DDLQDICQ 1auwA 290 :PDSLELIR Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 10 residues T0129 137 :LGYDEDDNEEELAEALEEIIEYVRTIAMLFYSHFNEGEIESKPV 1auwA 317 :LPSTYNKDLQEDKEAVFDVVDTLTAVLQVATGVISTLQISKENM Fragment has 36 clashes (null) has 36 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 46 residues other bump:2.99238 Ang E41.CB and P44.CD other bump:3.19985 Ang E41.C and P44.CD other bump:2.58492 Ang E41.OE1 and P44.CG other bump:3.09175 Ang E41.CB and P44.CG other bump:2.17767 Ang Y32.CE2 and N36.OD1 other bump:3.04332 Ang Y23.CZ and I27.CG2 other bump:1.83349 Ang A14.C and E18.OE1 other bump:1.2084 Ang A14.O and E18.OE1 other bump:2.79937 Ang A14.C and E18.CD other bump:2.24772 Ang A14.O and E18.CD other bump:2.63532 Ang D7.CB and E10.OE2 other bump:0.80245 Ang D7.O and E10.OE1 other bump:1.72136 Ang D7.C and E10.OE1 other bump:2.54371 Ang D7.CA and E10.OE1 other bump:1.98868 Ang D7.O and E10.CD other bump:2.79904 Ang D7.C and E10.CD other bump:3.10648 Ang D7.CA and E10.CD self-bump: 2.21989 Ang D5.CB and D5.C neighbor-bump: 2.29107 Ang Y4.CD1 and D5.OD2 neighbor-bump: 1.41057 Ang Y4.CE1 and D5.OD2 neighbor-bump: 2.31679 Ang Y4.CE2 and D5.OD2 neighbor-bump: 1.43117 Ang Y4.CZ and D5.OD2 neighbor-bump: 2.08692 Ang Y4.OH and D5.OD2 neighbor-bump: 2.82864 Ang Y4.CB and D5.OD1 neighbor-bump: 1.57145 Ang Y4.CG and D5.OD1 neighbor-bump: 2.23879 Ang Y4.CD1 and D5.OD1 neighbor-bump: 0.949285 Ang Y4.CD2 and D5.OD1 neighbor-bump: 2.42143 Ang Y4.CE1 and D5.OD1 neighbor-bump: 1.38733 Ang Y4.CE2 and D5.OD1 neighbor-bump: 2.34309 Ang Y4.CG and D5.CG neighbor-bump: 2.34167 Ang Y4.CD1 and D5.CG neighbor-bump: 2.15177 Ang Y4.CD2 and D5.CG neighbor-bump: 2.12403 Ang Y4.CE1 and D5.CG neighbor-bump: 1.95515 Ang Y4.CE2 and D5.CG neighbor-bump: 1.92366 Ang Y4.CZ and D5.CG self-bump: 1.29712 Ang D5.CA and D5.CB Number of specific fragments= 10 total=164 Number of alignments=22 # Reading fragments from alignment file # T0129 read from /projects/compbio/experiments/casp5/t0129/1exnA/1exnA-T0129-fssp-global-adpstyle5.pw.a2m.gz # 1exnA read from /projects/compbio/experiments/casp5/t0129/1exnA/1exnA-T0129-fssp-global-adpstyle5.pw.a2m.gz # found chain 1exnA in template set T0129 2 :LISHSDLNQQLKSAG 1exnA 24 :IVDGTNLGFRFKHNN Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 17 residues other bump:3.09314 Ang I3.CG1 and H5.NE2 other bump:3.00688 Ang I3.CD1 and H5.NE2 T0129 20 :NATELHGFLSGLL 1exnA 40 :KKPFASSYVSTIQ Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues T0129 34 :GGLKDQSWLPLLYQFSND 1exnA 53 :SLAKSYSARTTIVLGDKG Fragment has 61 clashes (null) has 61 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 20 residues neighbor-bump: 1.02804 Ang N18.O and D19.OD1 neighbor-bump: 1.70754 Ang N18.O and D19.CG neighbor-bump: 2.57716 Ang N18.C and D19.CG other bump:3.27213 Ang W9.CE2 and L12.C other bump:2.97925 Ang W9.NE1 and L12.C other bump:3.07503 Ang W9.CZ2 and L12.C other bump:3.27879 Ang L4.CA and L12.CD2 other bump:2.64364 Ang L4.CB and L12.CD2 other bump:3.05306 Ang W9.CG and L12.CD2 other bump:2.71764 Ang W9.CD1 and L12.CD2 other bump:1.57375 Ang L4.CG and L12.CD2 other bump:2.42511 Ang L4.CD1 and L12.CD2 other bump:0.2243 Ang L4.CD2 and L12.CD2 other bump:2.42175 Ang W9.CG and L12.CD1 other bump:1.30255 Ang W9.CD1 and L12.CD1 other bump:2.61292 Ang L4.CD2 and L12.CD1 other bump:2.29862 Ang W9.NE1 and L12.CD1 other bump:3.02775 Ang W9.CB and L12.CG other bump:2.08292 Ang W9.CG and L12.CG other bump:1.31215 Ang W9.CD1 and L12.CG other bump:2.84189 Ang W9.CD2 and L12.CG other bump:2.84832 Ang L4.CG and L12.CG other bump:1.63774 Ang L4.CD2 and L12.CG other bump:2.74166 Ang W9.CE2 and L12.CG other bump:1.90446 Ang W9.NE1 and L12.CG other bump:2.31064 Ang W9.CD1 and L12.CB other bump:2.68628 Ang L4.CD2 and L12.CB other bump:2.76777 Ang W9.CE2 and L12.CB other bump:1.84951 Ang W9.NE1 and L12.CB other bump:2.72662 Ang W9.CD1 and L12.CA other bump:3.17916 Ang W9.CD2 and L12.CA other bump:1.9682 Ang W9.CE2 and L12.CA other bump:1.52733 Ang W9.NE1 and L12.CA other bump:2.35175 Ang W9.CZ2 and L12.CA other bump:2.57236 Ang W9.CD1 and L12.N other bump:1.83099 Ang W9.CE2 and L12.N other bump:1.27141 Ang W9.NE1 and L12.N other bump:2.27364 Ang W9.CZ2 and L12.N other bump:3.01547 Ang W9.CG and P11.C other bump:2.64918 Ang W9.CD1 and P11.C other bump:2.42308 Ang W9.CD2 and P11.C other bump:3.33387 Ang W9.CE3 and P11.C other bump:1.42049 Ang W9.CE2 and P11.C other bump:1.67745 Ang W9.NE1 and P11.C other bump:1.85961 Ang W9.CZ2 and P11.C other bump:2.915 Ang W9.CH2 and P11.C other bump:2.50806 Ang W9.CG and P11.O other bump:2.7086 Ang W9.CD1 and P11.O other bump:1.43876 Ang W9.CD2 and P11.O other bump:2.10842 Ang W9.CE3 and P11.O other bump:0.932309 Ang W9.CE2 and P11.O other bump:2.04014 Ang W9.NE1 and P11.O other bump:1.46175 Ang W9.CZ2 and P11.O other bump:2.35569 Ang W9.CZ3 and P11.O other bump:2.0778 Ang W9.CH2 and P11.O neighbor-bump: 2.51689 Ang L10.CB and P11.CD other bump:2.90182 Ang W9.CE2 and P11.CA other bump:2.95871 Ang W9.NE1 and P11.CA other bump:3.15211 Ang W9.CZ2 and P11.CA self-bump: 1.39131 Ang L10.CA and L10.CB other bump:2.7482 Ang L4.CD2 and W9.CD1 T0129 52 :NHAYPTGLVQPVTELYEQISQTLSDVEGFTFE 1exnA 97 :EKALDEQFFEYLKDAFELCKTTFPTFTIRGVE Fragment has 24 clashes (null) has 24 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 34 residues neighbor-bump: 2.68857 Ang F30.C and T31.OG1 neighbor-bump: 1.93602 Ang F30.O and T31.CB neighbor-bump: 2.39995 Ang F30.C and T31.CB other bump:2.79368 Ang E28.OE2 and F30.CZ other bump:2.91149 Ang E28.OE2 and F30.CE2 other bump:2.57008 Ang I20.CB and D26.OD2 other bump:1.69405 Ang I20.CG2 and D26.OD2 other bump:2.81514 Ang I20.CG2 and D26.OD1 other bump:2.55726 Ang I20.CG2 and D26.CG other bump:2.16198 Ang E18.O and S21.OG other bump:2.8552 Ang V13.CG1 and Y17.CE2 other bump:2.7512 Ang G8.C and P12.CD other bump:3.05104 Ang L9.C and P12.CD other bump:1.61895 Ang G8.O and P12.CD neighbor-bump: 2.47225 Ang Q11.N and P12.CD other bump:2.97803 Ang G8.C and P12.CG other bump:2.31489 Ang G8.O and P12.CG other bump:2.57576 Ang N2.C and P6.CD other bump:3.25396 Ang H3.CA and P6.CD other bump:1.42898 Ang N2.O and P6.CD neighbor-bump: 2.63168 Ang Y5.N and P6.CD other bump:2.80699 Ang H3.C and P6.CD other bump:3.01292 Ang N2.C and P6.CG other bump:1.97316 Ang N2.O and P6.CG T0129 84 :LGLTEDENVFTQ 1exnA 148 :WLISTDGDWDTL Fragment has 8 clashes (null) has 8 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues other bump:2.25262 Ang E8.OE1 and F11.CZ other bump:3.0355 Ang E8.CA and F11.CE1 other bump:2.0978 Ang E8.CD and F11.CE1 other bump:1.18682 Ang E8.OE1 and F11.CE1 other bump:2.78823 Ang E8.OE2 and F11.CE1 other bump:2.80692 Ang E8.CA and F11.CD1 other bump:2.16069 Ang E8.OE1 and F11.CD1 other bump:2.64433 Ang E8.O and F11.CB T0129 96 :ADSLSDWANQFLLG 1exnA 186 :VDDVEQFISLKAIM Fragment has 23 clashes (null) has 23 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 16 residues other bump:2.44441 Ang W8.CD1 and F12.CZ other bump:1.34036 Ang W8.NE1 and F12.CZ other bump:2.97353 Ang W8.CG and F12.CZ other bump:2.48959 Ang W8.CD2 and F12.CZ other bump:1.35805 Ang W8.CE2 and F12.CZ other bump:1.91936 Ang W8.CZ2 and F12.CZ other bump:3.1007 Ang W8.CH2 and F12.CZ other bump:2.33985 Ang W8.NE1 and F12.CE2 other bump:3.04281 Ang W8.CG and F12.CE2 other bump:2.03709 Ang W8.CD2 and F12.CE2 other bump:1.3931 Ang W8.CE2 and F12.CE2 other bump:2.55 Ang W8.CE3 and F12.CE2 other bump:1.49682 Ang W8.CZ2 and F12.CE2 other bump:2.56074 Ang W8.CZ3 and F12.CE2 other bump:2.10655 Ang W8.CH2 and F12.CE2 other bump:2.91126 Ang W8.CD1 and F12.CE1 other bump:2.17633 Ang W8.NE1 and F12.CE1 other bump:2.69205 Ang W8.CE2 and F12.CE1 other bump:3.22647 Ang W8.CZ2 and F12.CE1 other bump:3.1217 Ang W8.CE3 and F12.CD2 other bump:2.74815 Ang W8.CZ2 and F12.CD2 other bump:3.09934 Ang W8.CZ3 and F12.CD2 other bump:2.91822 Ang W8.CH2 and F12.CD2 T0129 110 :IGLAQPELAKEKGEI 1exnA 206 :IRGVEGIGAKRGYNI Fragment has 20 clashes (null) has 20 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 17 residues other bump:2.10258 Ang E8.OE2 and I16.CD1 other bump:3.11276 Ang E8.OE2 and I16.CG1 other bump:2.66735 Ang E8.CG and K13.CG other bump:2.85 Ang E8.CD and K13.CG other bump:1.99 Ang P7.O and E12.OE1 other bump:2.61335 Ang E8.CA and E12.OE1 neighbor-bump: 1.4899 Ang Q6.CA and P7.CD neighbor-bump: 1.73661 Ang Q6.O and P7.CD neighbor-bump: 0.702999 Ang Q6.C and P7.CD self-bump: 1.27872 Ang P7.N and P7.CD neighbor-bump: 2.23035 Ang Q6.CB and P7.CD neighbor-bump: 2.34317 Ang Q6.CG and P7.CD neighbor-bump: 2.77074 Ang Q6.CA and P7.CG neighbor-bump: 1.55763 Ang Q6.O and P7.CG neighbor-bump: 1.67447 Ang Q6.C and P7.CG self-bump: 2.1341 Ang P7.N and P7.CG neighbor-bump: 2.96601 Ang Q6.CB and P7.CG neighbor-bump: 2.53118 Ang Q6.CG and P7.CG neighbor-bump: 1.78797 Ang Q6.O and P7.CB neighbor-bump: 2.20501 Ang Q6.C and P7.CB T0129 125 :GEAVDDLQDICQLGYDEDDN 1exnA 222 :REFGNVLDIIDQLPLPGKQK Fragment has 15 clashes (null) has 15 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 22 residues other bump:2.58706 Ang D10.C and Y16.OH other bump:1.82728 Ang D10.CA and Y16.OH other bump:2.06348 Ang D10.CB and Y16.OH other bump:2.40603 Ang D10.CG and Y16.OH other bump:3.13688 Ang D10.CA and Y16.CZ other bump:2.91867 Ang L14.CD2 and Y16.CE1 other bump:2.55856 Ang V5.CG1 and Q9.CG other bump:3.00241 Ang V5.CB and Q9.CB other bump:2.21402 Ang V5.CG1 and Q9.CB neighbor-bump: 3.27117 Ang V5.CG1 and D6.CA neighbor-bump: 2.27012 Ang V5.CG1 and D6.N neighbor-bump: 2.2383 Ang A4.C and V5.CG2 neighbor-bump: 1.23271 Ang A4.O and V5.CG2 neighbor-bump: 2.35899 Ang A4.C and V5.CB neighbor-bump: 1.80476 Ang A4.O and V5.CB T0129 145 :EEELAEALEEIIEYVRTIAMLFYSH 1exnA 243 :IQNLNASEELLFRNLILVDLPTYCV Fragment has 17 clashes (null) has 17 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 27 residues other bump:3.16747 Ang M21.SD and S25.OG neighbor-bump: 2.66079 Ang F23.CD2 and Y24.OH neighbor-bump: 2.28933 Ang F23.CE2 and Y24.OH neighbor-bump: 2.40559 Ang F23.CD2 and Y24.CZ neighbor-bump: 2.58746 Ang F23.CE2 and Y24.CZ neighbor-bump: 2.62776 Ang F23.CD2 and Y24.CE2 neighbor-bump: 2.98743 Ang F23.CE2 and Y24.CE1 other bump:2.88366 Ang E11.CD and Y15.OH other bump:1.81501 Ang E11.OE2 and Y15.OH other bump:2.58881 Ang E11.CD and Y15.CZ other bump:1.34403 Ang E11.OE2 and Y15.CZ other bump:2.69141 Ang E11.CG and Y15.CE2 other bump:2.44129 Ang E11.CD and Y15.CE2 other bump:1.61448 Ang E11.OE2 and Y15.CE2 other bump:2.29965 Ang E11.OE2 and Y15.CE1 other bump:3.19242 Ang E11.CD and Y15.CD2 other bump:2.63202 Ang E11.OE2 and Y15.CD2 Number of specific fragments= 9 total=173 Number of alignments=23 # Reading fragments from alignment file # T0129 read from /projects/compbio/experiments/casp5/t0129/1cll/T0129-1cll-2track-local-adpstyle1.pw.a2m.gz # 1cll read from /projects/compbio/experiments/casp5/t0129/1cll/T0129-1cll-2track-local-adpstyle1.pw.a2m.gz # found chain 1cll in template set T0129 6 :SDLNQQLKSAGIGFNATELHGFLSGLLCGGLKDQSWLPLLYQFS 1cll 30 :KELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMA Fragment has 58 clashes (null) has 58 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 46 residues other bump:1.87813 Ang L27.CD2 and Q43.NE2 other bump:2.27433 Ang L27.CG and Q43.NE2 other bump:2.54169 Ang L27.CD1 and Q43.NE2 other bump:2.61492 Ang L27.CB and Q43.OE1 other bump:0.78885 Ang L27.CD2 and Q43.OE1 other bump:1.88214 Ang L27.CG and Q43.OE1 other bump:1.0024 Ang L27.CD2 and Q43.CD other bump:2.25566 Ang L27.CG and Q43.CD other bump:3.00019 Ang L27.CD1 and Q43.CD other bump:2.19362 Ang L27.CD2 and Q43.CG other bump:2.71843 Ang L27.CD2 and Q43.CB other bump:2.79212 Ang L27.CA and Q35.OE1 other bump:1.65492 Ang L27.CB and Q35.OE1 other bump:2.76881 Ang L27.CB and Q35.CD other bump:2.52603 Ang L28.CD2 and Q35.CG other bump:3.1173 Ang L28.CD2 and Q35.CB other bump:2.56863 Ang L28.CD2 and Q35.CA other bump:2.89754 Ang L28.CD2 and Q35.N other bump:3.22161 Ang L28.CG and D34.C other bump:2.58652 Ang L28.CD2 and D34.C other bump:2.73979 Ang L28.CD1 and D34.C other bump:2.11703 Ang L28.CD2 and D34.O other bump:2.7476 Ang L28.CD1 and D34.O other bump:3.02437 Ang L28.CD1 and D34.CA other bump:2.76008 Ang L28.CD1 and D34.N other bump:1.1624 Ang N5.OD1 and L20.CD2 other bump:1.50111 Ang F15.CE1 and L20.CD2 other bump:2.58888 Ang F15.CZ and L20.CD2 other bump:1.67422 Ang N5.CG and L20.CD2 other bump:1.92074 Ang N5.ND2 and L20.CD2 other bump:2.33269 Ang F15.CD1 and L20.CD2 other bump:2.10326 Ang N5.OD1 and L20.CD1 other bump:1.34186 Ang F15.CE1 and L20.CD1 other bump:1.79861 Ang F15.CZ and L20.CD1 other bump:2.69736 Ang F15.CG and L20.CD1 other bump:1.94636 Ang F15.CD1 and L20.CD1 other bump:2.93312 Ang F15.CD2 and L20.CD1 other bump:2.57432 Ang F15.CE2 and L20.CD1 other bump:1.69878 Ang N5.OD1 and L20.CG other bump:1.56233 Ang F15.CE1 and L20.CG other bump:2.64142 Ang N5.CG and L20.CG other bump:2.464 Ang F15.CD1 and L20.CG other bump:2.8335 Ang F15.CE1 and L20.CB other bump:2.74895 Ang N16.OD1 and E19.CB other bump:1.55691 Ang N5.OD1 and F15.CZ other bump:2.94571 Ang N5.N and F15.CZ other bump:2.39894 Ang N5.CA and F15.CZ other bump:2.88892 Ang N5.CB and F15.CZ other bump:2.46325 Ang N5.CG and F15.CZ other bump:3.05892 Ang N5.CA and F15.CE2 other bump:2.90726 Ang L8.CG and F15.CE2 other bump:2.27283 Ang L8.CD1 and F15.CE2 other bump:2.81006 Ang L8.CB and F15.CE2 other bump:1.08703 Ang N5.OD1 and F15.CE1 other bump:2.2762 Ang N5.CG and F15.CE1 other bump:2.30067 Ang L8.CD1 and F15.CD2 other bump:3.07059 Ang L8.CB and F15.CD2 other bump:2.39265 Ang N5.OD1 and F15.CD1 T0129 59 :LVQPVTELYEQISQTLSDVE 1cll 74 :RKMKDTDSEEEIREAFRVFD Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 22 residues T0129 87 :TEDENVFTQAD 1cll 94 :KDGNGYISAAE Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 13 residues T0129 103 :ANQFLLGIGLAQPE 1cll 105 :LRHVMTNLGEKLTD Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 16 residues other bump:2.62356 Ang L6.CG and Q13.NE2 other bump:1.72898 Ang L6.CD2 and Q13.NE2 T0129 126 :EAVDDLQDICQLGYDEDDNEEELAEAL 1cll 119 :EEVDEMIREADIDGDGQVNYEEFVQMM Fragment has 23 clashes (null) has 23 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 29 residues other bump:2.76861 Ang L13.CD1 and E26.OE2 other bump:2.45888 Ang L13.CD1 and E26.OE1 other bump:2.94984 Ang L13.CD1 and E26.CD other bump:3.24815 Ang Q8.CD and D18.CA other bump:2.42841 Ang Q8.NE2 and D18.CA other bump:2.23522 Ang Q8.NE2 and D18.N other bump:3.16324 Ang Q12.CD and D18.N other bump:2.36927 Ang Q12.NE2 and D18.N other bump:3.01974 Ang Q8.CD and E17.C other bump:1.69838 Ang Q8.NE2 and E17.C other bump:2.30247 Ang Q8.CD and E17.O other bump:1.12523 Ang Q8.NE2 and E17.O other bump:2.99047 Ang Q8.NE2 and E17.CA other bump:2.52674 Ang Q12.OE1 and E17.CA other bump:2.72705 Ang Q12.CD and E17.CA other bump:2.27994 Ang Q12.NE2 and E17.CA other bump:2.28184 Ang Q12.CD and E17.N other bump:1.44966 Ang Q12.NE2 and E17.N other bump:2.29246 Ang Q12.NE2 and D16.C other bump:2.81606 Ang Q12.NE2 and D16.CA other bump:2.9801 Ang Q12.CD and D16.N other bump:2.44072 Ang Q12.NE2 and D16.N other bump:2.75187 Ang Q12.OE1 and Y15.CD1 Number of specific fragments= 5 total=178 Number of alignments=24 # Reading fragments from alignment file # T0129 read from /projects/compbio/experiments/casp5/t0129/1cll/T0129-1cll-2track-local-adpstyle5.pw.a2m.gz # 1cll read from /projects/compbio/experiments/casp5/t0129/1cll/T0129-1cll-2track-local-adpstyle5.pw.a2m.gz # found chain 1cll in template set T0129 4 :SHSDLNQQLKSAGIGFNATELHGFLSGLLCGGLKDQSWLPLLYQFS 1cll 28 :TTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMA Fragment has 66 clashes (null) has 66 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 48 residues other bump:1.87813 Ang L29.CD2 and Q45.NE2 other bump:2.27433 Ang L29.CG and Q45.NE2 other bump:2.54169 Ang L29.CD1 and Q45.NE2 other bump:2.61492 Ang L29.CB and Q45.OE1 other bump:0.78885 Ang L29.CD2 and Q45.OE1 other bump:1.88214 Ang L29.CG and Q45.OE1 other bump:1.0024 Ang L29.CD2 and Q45.CD other bump:2.25566 Ang L29.CG and Q45.CD other bump:3.00019 Ang L29.CD1 and Q45.CD other bump:2.19362 Ang L29.CD2 and Q45.CG other bump:2.71843 Ang L29.CD2 and Q45.CB other bump:2.79212 Ang L29.CA and Q37.OE1 other bump:1.65492 Ang L29.CB and Q37.OE1 other bump:2.76881 Ang L29.CB and Q37.CD other bump:2.52603 Ang L30.CD2 and Q37.CG other bump:3.1173 Ang L30.CD2 and Q37.CB other bump:2.56863 Ang L30.CD2 and Q37.CA other bump:2.89754 Ang L30.CD2 and Q37.N other bump:3.22161 Ang L30.CG and D36.C other bump:2.58652 Ang L30.CD2 and D36.C other bump:2.73979 Ang L30.CD1 and D36.C other bump:2.11703 Ang L30.CD2 and D36.O other bump:2.7476 Ang L30.CD1 and D36.O other bump:3.02437 Ang L30.CD1 and D36.CA other bump:2.76008 Ang L30.CD1 and D36.N other bump:1.77021 Ang H3.CD2 and L26.CD1 other bump:2.57324 Ang H3.NE2 and L26.CD1 other bump:2.78071 Ang H3.CD2 and L26.CG other bump:3.0089 Ang H3.ND1 and H23.CE1 other bump:2.85983 Ang H3.CE1 and H23.CE1 other bump:2.44929 Ang H3.CE1 and H23.ND1 other bump:2.7053 Ang H3.ND1 and H23.CD2 other bump:2.88754 Ang H3.CE1 and H23.CA other bump:1.1624 Ang N7.OD1 and L22.CD2 other bump:1.50111 Ang F17.CE1 and L22.CD2 other bump:2.58888 Ang F17.CZ and L22.CD2 other bump:1.67422 Ang N7.CG and L22.CD2 other bump:1.92074 Ang N7.ND2 and L22.CD2 other bump:2.33269 Ang F17.CD1 and L22.CD2 other bump:2.10326 Ang N7.OD1 and L22.CD1 other bump:1.34186 Ang F17.CE1 and L22.CD1 other bump:1.79861 Ang F17.CZ and L22.CD1 other bump:2.69736 Ang F17.CG and L22.CD1 other bump:1.94636 Ang F17.CD1 and L22.CD1 other bump:2.93312 Ang F17.CD2 and L22.CD1 other bump:2.57432 Ang F17.CE2 and L22.CD1 other bump:1.69878 Ang N7.OD1 and L22.CG other bump:1.56233 Ang F17.CE1 and L22.CG other bump:2.64142 Ang N7.CG and L22.CG other bump:2.464 Ang F17.CD1 and L22.CG other bump:2.8335 Ang F17.CE1 and L22.CB other bump:2.74895 Ang N18.OD1 and E21.CB other bump:1.55691 Ang N7.OD1 and F17.CZ other bump:2.94571 Ang N7.N and F17.CZ other bump:2.39894 Ang N7.CA and F17.CZ other bump:2.88892 Ang N7.CB and F17.CZ other bump:2.46325 Ang N7.CG and F17.CZ other bump:3.05892 Ang N7.CA and F17.CE2 other bump:2.90726 Ang L10.CG and F17.CE2 other bump:2.27283 Ang L10.CD1 and F17.CE2 other bump:2.81006 Ang L10.CB and F17.CE2 other bump:1.08703 Ang N7.OD1 and F17.CE1 other bump:2.2762 Ang N7.CG and F17.CE1 other bump:2.30067 Ang L10.CD1 and F17.CD2 other bump:3.07059 Ang L10.CB and F17.CD2 other bump:2.39265 Ang N7.OD1 and F17.CD1 T0129 55 :YPTGLVQPVTELYEQISQTLSDVEG 1cll 74 :RKMKDTDSEEEIREAFRVFDKDGNG Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 27 residues other bump:2.41534 Ang V10.O and Y14.CD1 other bump:1.86044 Ang G5.O and P9.CD other bump:2.86073 Ang G5.C and P9.CD other bump:2.99729 Ang L6.CA and P9.CD other bump:2.58496 Ang L6.O and P9.CD other bump:2.69115 Ang L6.C and P9.CD other bump:2.54555 Ang G5.O and P9.CG T0129 92 :VFTQAD 1cll 99 :YISAAE Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 8 residues T0129 103 :ANQFLLGIGLAQP 1cll 105 :LRHVMTNLGEKLT Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues other bump:2.62356 Ang L6.CG and Q13.NE2 other bump:1.72898 Ang L6.CD2 and Q13.NE2 T0129 125 :GEAVDDLQDICQLGYDEDDNEEELAEAL 1cll 118 :DEEVDEMIREADIDGDGQVNYEEFVQMM Fragment has 23 clashes (null) has 23 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 30 residues other bump:2.76861 Ang L14.CD1 and E27.OE2 other bump:2.45888 Ang L14.CD1 and E27.OE1 other bump:2.94984 Ang L14.CD1 and E27.CD other bump:3.24815 Ang Q9.CD and D19.CA other bump:2.42841 Ang Q9.NE2 and D19.CA other bump:2.23522 Ang Q9.NE2 and D19.N other bump:3.16324 Ang Q13.CD and D19.N other bump:2.36927 Ang Q13.NE2 and D19.N other bump:3.01974 Ang Q9.CD and E18.C other bump:1.69838 Ang Q9.NE2 and E18.C other bump:2.30247 Ang Q9.CD and E18.O other bump:1.12523 Ang Q9.NE2 and E18.O other bump:2.99047 Ang Q9.NE2 and E18.CA other bump:2.52674 Ang Q13.OE1 and E18.CA other bump:2.72705 Ang Q13.CD and E18.CA other bump:2.27994 Ang Q13.NE2 and E18.CA other bump:2.28184 Ang Q13.CD and E18.N other bump:1.44966 Ang Q13.NE2 and E18.N other bump:2.29246 Ang Q13.NE2 and D17.C other bump:2.81606 Ang Q13.NE2 and D17.CA other bump:2.9801 Ang Q13.CD and D17.N other bump:2.44072 Ang Q13.NE2 and D17.N other bump:2.75187 Ang Q13.OE1 and Y16.CD1 Number of specific fragments= 5 total=183 Number of alignments=25 # Reading fragments from alignment file # T0129 read from /projects/compbio/experiments/casp5/t0129/1ljrA/T0129-1ljrA-2track-local-adpstyle5.pw.a2m.gz # 1ljrA read from /projects/compbio/experiments/casp5/t0129/1ljrA/T0129-1ljrA-2track-local-adpstyle5.pw.a2m.gz # found chain 1ljrA in template set T0129 22 :TELHGFLSGLLCGGLKDQSWLPLLYQFS 1ljrA 96 :HEYLGWHADCIRGTFGIPLWVQVLGPLI Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 30 residues other bump:2.56601 Ang W21.O and Y26.CB other bump:3.20363 Ang K17.NZ and W21.CZ2 other bump:2.61578 Ang K17.NZ and W21.NE1 self-bump: 2.20289 Ang C13.CB and C13.C self-bump: 1.2601 Ang C13.CA and C13.CB other bump:2.14994 Ang L8.CD2 and L12.CD1 other bump:2.77807 Ang L8.CD2 and L12.CB other bump:2.78849 Ang F7.CZ and L11.CD1 other bump:2.59674 Ang F7.CD1 and L11.CD1 other bump:1.89919 Ang F7.CE1 and L11.CD1 T0129 52 :NHAYPTGLVQPVTELYEQISQTLSDVE 1ljrA 124 :GVQVPEEKVERNRTAMDQALQWLEDKF Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 29 residues other bump:1.8385 Ang T14.O and E18.OE1 self-bump: 1.39876 Ang Q11.CA and Q11.CB T0129 88 :EDEN 1ljrA 151 :LGDR Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 6 residues other bump:2.10221 Ang E2.O and N5.OD1 self-bump: 1.28975 Ang D3.CA and D3.CB T0129 105 :QFLLGIGLAQPEL 1ljrA 155 :PFLAGQQVTLADL Fragment has 14 clashes (null) has 14 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues other bump:2.59178 Ang F3.CB and E13.OE2 other bump:2.39747 Ang A10.O and E13.OE1 other bump:2.19764 Ang A10.N and E13.OE1 other bump:2.76208 Ang A10.C and P12.CD neighbor-bump: 2.48803 Ang Q11.N and P12.CD other bump:1.82064 Ang L5.CD1 and P12.CD other bump:3.04913 Ang A10.CB and P12.CD other bump:0.650384 Ang L5.CD1 and P12.CG other bump:3.04562 Ang L5.CB and P12.CG other bump:1.89351 Ang L5.CG and P12.CG other bump:2.80213 Ang L5.CD2 and P12.CG other bump:1.91978 Ang L5.CD1 and P12.CB other bump:2.18666 Ang L5.CG and P12.CB other bump:2.96862 Ang L5.CD1 and P12.CA T0129 126 :EAVDDLQDICQLGYDEDDNEEELAEALEEIIEYV 1ljrA 168 :MALEELMQPVALGYELFEGRPRLAAWRGRVEAFL Fragment has 26 clashes (null) has 26 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 36 residues other bump:2.335 Ang E29.CD and E33.OE2 other bump:1.93598 Ang E29.OE2 and E33.OE2 other bump:2.49704 Ang E29.OE1 and E33.OE2 neighbor-bump: 2.45898 Ang N20.O and E21.CG other bump:2.09832 Ang D16.OD2 and D19.OD1 other bump:2.33656 Ang D16.CG and D19.OD1 self-bump: 1.39707 Ang D19.CA and D19.CB other bump:2.75863 Ang I10.CG2 and Y15.CD1 other bump:2.32586 Ang I10.CG2 and Y15.CG other bump:2.24481 Ang I10.CG2 and Y15.CB other bump:2.34107 Ang D9.CG and Q12.NE2 other bump:1.96443 Ang D9.OD1 and Q12.NE2 other bump:1.9078 Ang D9.CA and Q12.NE2 other bump:2.31938 Ang D9.CB and Q12.NE2 other bump:2.64888 Ang D9.C and Q12.NE2 other bump:1.71744 Ang D9.O and Q12.OE1 other bump:2.30536 Ang D9.N and Q12.OE1 other bump:1.85953 Ang D9.CA and Q12.OE1 other bump:1.84283 Ang D9.C and Q12.OE1 other bump:1.52646 Ang Q8.O and Q12.OE1 other bump:2.14692 Ang Q8.C and Q12.OE1 other bump:1.91144 Ang D9.O and Q12.CD other bump:2.11323 Ang D9.CA and Q12.CD other bump:2.29193 Ang D9.C and Q12.CD other bump:3.18738 Ang Q8.C and Q12.CD other bump:2.53723 Ang D9.O and Q12.CG Number of specific fragments= 5 total=188 Number of alignments=26 # Reading fragments from alignment file # T0129 read from /projects/compbio/experiments/casp5/t0129/1ljrA/T0129-1ljrA-2track-local-adpstyle1.pw.a2m.gz # 1ljrA read from /projects/compbio/experiments/casp5/t0129/1ljrA/T0129-1ljrA-2track-local-adpstyle1.pw.a2m.gz # found chain 1ljrA in template set T0129 23 :ELHGFLSGLLCGGLKDQSWLPLLYQFS 1ljrA 97 :EYLGWHADCIRGTFGIPLWVQVLGPLI Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 29 residues other bump:2.56601 Ang W20.O and Y25.CB other bump:3.20363 Ang K16.NZ and W20.CZ2 other bump:2.61578 Ang K16.NZ and W20.NE1 self-bump: 2.20289 Ang C12.CB and C12.C self-bump: 1.2601 Ang C12.CA and C12.CB other bump:2.14994 Ang L7.CD2 and L11.CD1 other bump:2.77807 Ang L7.CD2 and L11.CB other bump:2.78849 Ang F6.CZ and L10.CD1 other bump:1.89919 Ang F6.CE1 and L10.CD1 other bump:2.59674 Ang F6.CD1 and L10.CD1 T0129 52 :NHAYPTGLVQPVTELYEQISQTLSDVE 1ljrA 124 :GVQVPEEKVERNRTAMDQALQWLEDKF Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 29 residues other bump:1.8385 Ang T14.O and E18.OE1 self-bump: 1.39876 Ang Q11.CA and Q11.CB T0129 86 :LTEDENVFTQADSLSDWA 1ljrA 151 :LGDRPFLAGQQVTLADLM Fragment has 38 clashes (null) has 38 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 20 residues other bump:2.58644 Ang F9.CE1 and S16.C other bump:1.35686 Ang F9.CZ and S16.OG other bump:2.03415 Ang F9.CG and S16.OG other bump:2.35649 Ang F9.CD1 and S16.OG other bump:1.30178 Ang F9.CD2 and S16.OG other bump:2.10724 Ang F9.CE1 and S16.OG other bump:0.7512 Ang F9.CE2 and S16.OG other bump:1.4977 Ang F9.CZ and S16.CB other bump:1.98608 Ang F9.CG and S16.CB other bump:1.47697 Ang F9.CD1 and S16.CB other bump:2.23726 Ang F9.CD2 and S16.CB other bump:1.14387 Ang F9.CE1 and S16.CB other bump:2.04992 Ang F9.CE2 and S16.CB other bump:2.26708 Ang F9.CZ and S16.CA other bump:2.80782 Ang F9.CD1 and S16.CA other bump:2.15296 Ang F9.CE1 and S16.CA other bump:3.00152 Ang F9.CE2 and S16.CA other bump:2.42398 Ang F9.CB and S14.OG other bump:2.67401 Ang F9.CG and S14.OG other bump:2.52821 Ang N7.ND2 and A12.C other bump:2.69923 Ang N7.ND2 and A12.CA other bump:2.24536 Ang N7.ND2 and A12.N other bump:2.63624 Ang T10.OG1 and A12.N other bump:2.68991 Ang N7.ND2 and Q11.C other bump:2.0194 Ang E6.OE2 and Q11.O neighbor-bump: 2.28807 Ang T10.OG1 and Q11.N neighbor-bump: 2.36921 Ang T10.CB and Q11.N other bump:3.14953 Ang N7.CG and T10.C other bump:2.60399 Ang N7.OD1 and T10.C neighbor-bump: 1.64779 Ang F9.O and T10.CG2 neighbor-bump: 2.27731 Ang F9.C and T10.CG2 other bump:2.76343 Ang N7.OD1 and T10.CA other bump:2.15002 Ang N7.OD1 and T10.N other bump:1.86497 Ang D5.OD2 and N7.O other bump:2.75105 Ang L2.C and D5.OD1 other bump:1.88059 Ang L2.O and D5.OD1 neighbor-bump: 2.49556 Ang T3.CG2 and E4.N self-bump: 1.28582 Ang T3.CA and T3.CB T0129 127 :AVDDLQDICQLGYDEDDNEEELAEALEEIIEYV 1ljrA 169 :ALEELMQPVALGYELFEGRPRLAAWRGRVEAFL Fragment has 26 clashes (null) has 26 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 35 residues other bump:2.335 Ang E28.CD and E32.OE2 other bump:1.93598 Ang E28.OE2 and E32.OE2 other bump:2.49704 Ang E28.OE1 and E32.OE2 neighbor-bump: 2.45898 Ang N19.O and E20.CG other bump:2.09832 Ang D15.OD2 and D18.OD1 other bump:2.33656 Ang D15.CG and D18.OD1 self-bump: 1.39707 Ang D18.CA and D18.CB other bump:2.75863 Ang I9.CG2 and Y14.CD1 other bump:2.32586 Ang I9.CG2 and Y14.CG other bump:2.24481 Ang I9.CG2 and Y14.CB other bump:2.34107 Ang D8.CG and Q11.NE2 other bump:1.96443 Ang D8.OD1 and Q11.NE2 other bump:1.9078 Ang D8.CA and Q11.NE2 other bump:2.31938 Ang D8.CB and Q11.NE2 other bump:2.64888 Ang D8.C and Q11.NE2 other bump:1.71744 Ang D8.O and Q11.OE1 other bump:2.30536 Ang D8.N and Q11.OE1 other bump:1.85953 Ang D8.CA and Q11.OE1 other bump:1.84283 Ang D8.C and Q11.OE1 other bump:1.52646 Ang Q7.O and Q11.OE1 other bump:2.14692 Ang Q7.C and Q11.OE1 other bump:1.91144 Ang D8.O and Q11.CD other bump:2.11323 Ang D8.CA and Q11.CD other bump:2.29193 Ang D8.C and Q11.CD other bump:3.18738 Ang Q7.C and Q11.CD other bump:2.53723 Ang D8.O and Q11.CG Number of specific fragments= 4 total=192 Number of alignments=27 # Reading fragments from alignment file # T0129 read from /projects/compbio/experiments/casp5/t0129/1bglA/1bglA-T0129-fssp-global-adpstyle5.pw.a2m.gz # 1bglA read from /projects/compbio/experiments/casp5/t0129/1bglA/1bglA-T0129-fssp-global-adpstyle5.pw.a2m.gz # found chain 1bglA in template set T0129 6 :SDLNQQL 1bglA 370 :QTMVQDI Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 9 residues self-bump: 1.36982 Ang S2.CA and S2.CB T0129 13 :KSAGIGFNATELHGF 1bglA 378 :LMKQNNFNAVRCSHY Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 17 residues T0129 28 :LSGLLCGGLKDQS 1bglA 394 :NHPLWYTLCDRYG Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues neighbor-bump: 2.14797 Ang Q13.O and S14.OG neighbor-bump: 2.72435 Ang Q13.C and S14.OG neighbor-bump: 2.0888 Ang Q13.O and S14.CB neighbor-bump: 2.52244 Ang Q13.C and S14.CB other bump:3.06408 Ang C7.SG and K11.CE other bump:1.57866 Ang L2.CD1 and L6.CD1 T0129 42 :LPLLYQFS 1bglA 407 :LYVVDEAN Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 10 residues T0129 51 :DNHAYP 1bglA 417 :THGMVP Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 8 residues T0129 59 :LVQPVTELYEQISQTLSDVE 1bglA 432 :WLPAMSERVTRMVQRDRNHP Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 22 residues neighbor-bump: 2.32264 Ang S18.O and D19.CA T0129 79 :GFTFELG 1bglA 453 :VIIWSLG Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 9 residues neighbor-bump: 2.68237 Ang F3.CD1 and T4.OG1 T0129 89 :DENVFTQADSLSDWANQ 1bglA 461 :ESGHGANHDALYRWIKS Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 19 residues other bump:2.65098 Ang E3.O and F6.CE1 T0129 106 :FLLGIG 1bglA 482 :RPVQYE Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 8 residues T0129 112 :LAQPELAKE 1bglA 501 :PMYARVDED Fragment has 8 clashes (null) has 8 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.7538 Ang E6.OE1 and K9.CD other bump:2.58139 Ang E6.CD and K9.CD other bump:2.3222 Ang E6.OE1 and K9.CG other bump:2.41492 Ang E6.OE1 and K9.CB other bump:2.83466 Ang E6.CD and K9.CB other bump:2.75168 Ang A3.C and P5.CD other bump:2.4027 Ang L2.CB and P5.CG other bump:3.118 Ang L2.CD1 and P5.CB T0129 122 :GEIGEAVDD 1bglA 518 :WSIKKWLSL Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.89274 Ang E6.O and D9.OD1 other bump:2.8069 Ang E6.C and D9.OD1 T0129 131 :LQDIC 1bglA 531 :RPLIL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 7 residues T0129 136 :QLGYDEDDNEEELAEALEEIIEYVRTIAMLFYSHFNE 1bglA 537 :EYAHAMGNSLGGFAKYWQAFRQYPRLQGGFVWDWVDQ Fragment has 29 clashes (null) has 29 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 39 residues other bump:2.37322 Ang Y5.CE2 and Y33.CE1 other bump:2.61525 Ang Y5.CD2 and Y33.CD1 other bump:2.41786 Ang Y5.CE2 and Y33.CD1 other bump:2.63434 Ang D6.CB and F32.CZ other bump:1.30275 Ang L3.CG and M30.CE other bump:1.77128 Ang L3.CD2 and M30.CE other bump:2.34644 Ang L3.CD1 and M30.CE other bump:1.58779 Ang L3.CB and M30.CE other bump:2.55504 Ang L3.CG and M30.SD other bump:2.23324 Ang L3.CD2 and M30.SD other bump:3.09095 Ang L3.CD1 and M30.SD other bump:2.4804 Ang L3.CD1 and M30.CB neighbor-bump: 2.3825 Ang A29.CB and M30.N self-bump: 2.17328 Ang A29.CB and A29.C self-bump: 1.27305 Ang A29.CA and A29.CB other bump:1.81206 Ang Y24.O and T27.OG1 other bump:2.71733 Ang Y24.C and T27.OG1 other bump:2.7718 Ang E20.OE2 and Y24.CE1 other bump:2.46438 Ang D6.OD2 and E11.OE2 other bump:3.05803 Ang D6.CG and E11.CG other bump:2.21829 Ang E7.O and N10.OD1 other bump:2.60688 Ang D6.C and N10.OD1 other bump:1.92053 Ang E7.C and N10.OD1 other bump:2.28125 Ang E7.N and N10.OD1 other bump:2.4678 Ang E7.CA and N10.OD1 other bump:2.96003 Ang E7.C and N10.CG other bump:2.89967 Ang E7.N and N10.CG self-bump: 1.32265 Ang D8.CA and D8.CB other bump:2.62895 Ang Y5.CE1 and E7.OE2 T0129 173 :GEIESKPVL 1bglA 617 :LTEAKHQQQ Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.65513 Ang E5.O and V9.CB other bump:1.69624 Ang G1.O and E5.OE1 other bump:2.41537 Ang G1.C and E5.OE1 other bump:2.60055 Ang G2.CA and E5.OE1 other bump:2.62947 Ang G1.O and E5.CD Number of specific fragments= 14 total=206 Number of alignments=28 # Reading fragments from alignment file # T0129 read from /projects/compbio/experiments/casp5/t0129/1phd/1phd-T0129-fssp-global-adpstyle5.pw.a2m.gz # 1phd read from /projects/compbio/experiments/casp5/t0129/1phd/1phd-T0129-fssp-global-adpstyle5.pw.a2m.gz # found chain 1phd in template set T0129 2 :LISHSD 1phd 11 :LAPLPP Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 8 residues T0129 13 :KSAGIGFNATELHGFLSGLLCG 1phd 30 :NPSNLSAGVQEAWAVLQESNVP Fragment has 23 clashes (null) has 23 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 24 residues other bump:2.92841 Ang S3.CA and L13.CD2 other bump:2.08172 Ang S3.CB and L13.CD2 other bump:0.694953 Ang S3.OG and L13.CD2 other bump:3.03703 Ang S3.C and L13.CD2 other bump:3.01291 Ang S3.CB and L13.CD1 other bump:2.63905 Ang S3.OG and L13.CD1 other bump:2.82851 Ang A4.N and L13.CD1 other bump:2.03097 Ang G5.N and L13.CD1 other bump:2.8295 Ang G5.CA and L13.CD1 other bump:2.37371 Ang S3.CB and L13.CG other bump:1.62585 Ang S3.OG and L13.CG other bump:2.40619 Ang N9.CG and E12.OE2 other bump:1.91116 Ang N9.ND2 and E12.OE2 other bump:1.37998 Ang N9.CG and E12.OE1 other bump:0.570194 Ang N9.OD1 and E12.OE1 other bump:2.53711 Ang N9.CB and E12.OE1 other bump:1.84342 Ang N9.CG and E12.CD other bump:1.93725 Ang N9.ND2 and E12.CD other bump:1.43836 Ang N9.OD1 and E12.CD other bump:2.96142 Ang N9.CG and E12.CG other bump:2.29379 Ang N9.OD1 and E12.CG other bump:2.58952 Ang N9.OD1 and E12.CB neighbor-bump: 2.04091 Ang F8.O and N9.CG T0129 35 :GLKDQSWLP 1phd 57 :RCNGGHWIA Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.32899 Ang L3.CB and K4.N self-bump: 2.15765 Ang L3.CB and L3.C self-bump: 1.23105 Ang L3.CA and L3.CB T0129 44 :LLYQFSNDNHA 1phd 77 :DYRHFSSECPF Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 13 residues T0129 55 :YPTGLV 1phd 96 :YDFIPT Fragment has 17 clashes (null) has 17 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 8 residues other bump:2.98999 Ang Y2.CZ and V7.CG1 other bump:2.14086 Ang Y2.OH and V7.CG1 other bump:2.88878 Ang Y2.OH and V7.CB other bump:2.71347 Ang Y2.CZ and T4.OG1 other bump:2.3486 Ang G1.O and P3.CD other bump:2.5399 Ang G1.C and P3.CD neighbor-bump: 2.41896 Ang Y2.N and P3.CD neighbor-bump: 1.71686 Ang Y2.CA and P3.CD neighbor-bump: 2.12978 Ang Y2.O and P3.CD neighbor-bump: 1.04764 Ang Y2.C and P3.CD self-bump: 1.30757 Ang P3.N and P3.CD other bump:2.53365 Ang G1.O and P3.CG other bump:2.89077 Ang G1.C and P3.CG neighbor-bump: 3.12659 Ang Y2.CA and P3.CG neighbor-bump: 2.15935 Ang Y2.C and P3.CG self-bump: 2.14455 Ang P3.N and P3.CG self-bump: 2.15567 Ang P3.N and P3.CB T0129 61 :QPVTELYEQISQ 1phd 133 :ELACSLIESLRP Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues T0129 73 :TLSDVEGFT 1phd 162 :IFMLLAGLP Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.58147 Ang E7.CB and F9.CE1 other bump:2.5056 Ang E7.CB and F9.CD1 T0129 82 :FELGLTEDENVFTQADSLSDWANQFL 1phd 203 :YLIPIIEQRRQKPGTDAISIVANGQV Fragment has 21 clashes (null) has 21 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:1.87843 Ang D21.O and Q25.NE2 other bump:2.69089 Ang D21.C and Q25.NE2 other bump:2.31785 Ang D21.O and Q25.CD other bump:2.13302 Ang D21.O and Q25.CG other bump:3.09521 Ang D21.C and Q25.CG other bump:2.91003 Ang W22.CA and Q25.CG other bump:3.14306 Ang W22.C and Q25.CG other bump:2.44146 Ang T14.CG2 and N24.OD1 other bump:3.01181 Ang T14.CG2 and N24.CG other bump:2.82339 Ang N11.OD1 and A23.C other bump:2.69606 Ang N11.OD1 and A23.CB other bump:2.60572 Ang Q15.CB and S20.OG other bump:3.17683 Ang E10.CD and L19.CB other bump:2.46257 Ang E10.OE1 and L19.CB other bump:2.11884 Ang Q15.CB and D17.OD1 other bump:2.46036 Ang Q15.CG and D17.OD1 neighbor-bump: 3.0143 Ang V12.CG1 and F13.CZ neighbor-bump: 2.62787 Ang V12.CG1 and F13.CE2 neighbor-bump: 2.90256 Ang V12.CG1 and F13.CD2 neighbor-bump: 2.69063 Ang F2.CD2 and E3.OE2 neighbor-bump: 3.06313 Ang F2.CE2 and E3.OE2 T0129 108 :LG 1phd 246 :LV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues T0129 110 :IGLAQPELAKEKG 1phd 257 :LSFSMEFLAKSPE Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues T0129 123 :EIGEAVDDLQ 1phd 280 :RIPAACEELL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 12 residues T0129 133 :DICQLGYDEDDNE 1phd 321 :PQMLSGLDERENA Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues other bump:2.14586 Ang C4.O and Y8.CE1 other bump:1.84844 Ang C4.O and Y8.CD1 T0129 146 :EELAEALEEIIEYVRTIAMLFYSHFN 1phd 365 :REIIVTLKEWLTRIPDFSIAPGAQIQ Fragment has 12 clashes (null) has 12 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:2.48868 Ang M20.CG and F26.CZ other bump:2.77137 Ang M20.SD and F26.CZ other bump:2.91776 Ang M20.CB and F26.CZ other bump:2.52319 Ang M20.CG and F26.CE2 other bump:1.93952 Ang M20.SD and F26.CE2 other bump:2.91647 Ang M20.CB and F26.CE2 other bump:2.60505 Ang M20.SD and F26.CD2 other bump:2.98448 Ang V15.CG2 and I18.CG1 other bump:2.25797 Ang I12.O and R16.NE other bump:1.40003 Ang I12.O and R16.CD other bump:2.64895 Ang I12.C and R16.CD other bump:2.61212 Ang L8.O and I12.CD1 T0129 172 :EGEIESKPVLH 1phd 396 :VSGVQALPLVW Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 12 residues self-bump: 1.37817 Ang E6.CA and E6.CB Number of specific fragments= 14 total=220 Number of alignments=29 # Reading fragments from alignment file # T0129 read from /projects/compbio/experiments/casp5/t0129/1g4yR/T0129-1g4yR-2track-local-adpstyle5.pw.a2m.gz # 1g4yR read from /projects/compbio/experiments/casp5/t0129/1g4yR/T0129-1g4yR-2track-local-adpstyle5.pw.a2m.gz # found chain 1g4yR in template set T0129 3 :ISHSDLNQQLKSAGIGFNATELHGFLSGLLCGG 1g4yR 27 :ITTKELGTVMRSLGQNPTEAELQDMINEVDADG Fragment has 26 clashes (null) has 26 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 35 residues other bump:3.10336 Ang L31.CG and G34.CA other bump:2.16084 Ang H4.CD2 and L27.CD1 other bump:2.63665 Ang H4.NE2 and L27.CD1 other bump:3.16255 Ang H4.ND1 and H24.CE1 other bump:3.22794 Ang H4.CE1 and H24.CE1 other bump:2.63379 Ang H4.CE1 and H24.ND1 other bump:2.277 Ang H4.ND1 and H24.CD2 other bump:2.13355 Ang H4.CE1 and H24.CG other bump:2.52085 Ang H4.CE1 and H24.CB other bump:3.13226 Ang H4.ND1 and H24.CA other bump:2.06645 Ang H4.CE1 and H24.CA other bump:2.40141 Ang H4.NE2 and H24.CA other bump:2.56749 Ang H4.CE1 and H24.N other bump:3.15458 Ang H4.CE1 and L23.C other bump:2.83842 Ang N19.OD1 and E22.CD other bump:2.36768 Ang N19.OD1 and E22.CG other bump:2.45463 Ang N19.OD1 and E22.CB other bump:2.27605 Ang N19.OD1 and E22.N other bump:2.47944 Ang I16.CG2 and F18.CE1 other bump:2.84308 Ang L11.CD1 and F18.CE1 other bump:2.89808 Ang L11.CD2 and F18.CE1 other bump:2.75135 Ang I16.CG2 and F18.CD1 other bump:2.58595 Ang L11.CD1 and F18.CD1 other bump:2.16878 Ang N8.CG and K12.NZ other bump:1.35632 Ang N8.OD1 and K12.NZ self-bump: 1.38807 Ang H4.CA and H4.CB T0129 36 :LKDQSWLPLLYQFSNDNH 1g4yR 63 :IDFPEFLTMMARKMKDTD Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 20 residues neighbor-bump: 2.38813 Ang Q13.O and F14.CD1 other bump:3.0841 Ang S6.C and P9.CD other bump:2.59979 Ang Q5.O and P9.CD T0129 62 :PVTELYEQISQTLSDVEGFTF 1g4yR 81 :SEEEIREAFRVFDKDGNGYIS Fragment has 20 clashes (null) has 20 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 23 residues other bump:1.80227 Ang L14.CD2 and T21.OG1 other bump:2.79387 Ang L14.CD2 and T21.CB other bump:2.89351 Ang L14.CD2 and T21.CA other bump:2.80438 Ang L14.CD2 and T21.N other bump:2.53674 Ang L14.CD2 and F20.C other bump:2.19612 Ang L14.CD2 and F20.O other bump:1.73421 Ang T4.CG2 and Y7.OH other bump:2.83483 Ang T4.CB and Y7.OH other bump:2.33807 Ang T4.CG2 and Y7.CZ other bump:2.92569 Ang T4.CA and Y7.CZ other bump:2.77882 Ang T4.CG2 and Y7.CE2 other bump:2.88919 Ang T4.O and Y7.CE2 other bump:3.16183 Ang T4.N and Y7.CE2 other bump:2.11508 Ang T4.CA and Y7.CE2 other bump:2.68453 Ang T4.CB and Y7.CE2 other bump:2.90241 Ang T4.OG1 and Y7.CE2 other bump:2.94474 Ang T4.C and Y7.CE2 other bump:2.66672 Ang T4.CA and Y7.CD2 other bump:3.15082 Ang T4.C and Y7.CD2 self-bump: 1.37759 Ang Y7.CA and Y7.CB T0129 100 :SDWANQFLLGIGLAQP 1g4yR 102 :AAELRHVMTNLGEKLT Fragment has 9 clashes (null) has 9 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 18 residues other bump:2.58285 Ang L10.CD2 and Q16.O neighbor-bump: 2.79642 Ang I12.CG2 and G13.CA neighbor-bump: 2.3888 Ang I12.CB and G13.N neighbor-bump: 1.58573 Ang I12.CG2 and G13.N self-bump: 2.31308 Ang I12.CG2 and I12.C self-bump: 1.35841 Ang I12.CA and I12.CB other bump:2.67865 Ang N6.CG and L10.CD1 other bump:2.02726 Ang N6.ND2 and L10.CD1 other bump:2.91412 Ang N6.OD1 and L10.CD1 T0129 125 :GEAVDDLQDICQLGYDEDDNEEELAEA 1g4yR 118 :DEEVDEMIREADIDGDGQVNYEEFVQM Fragment has 18 clashes (null) has 18 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 29 residues other bump:2.95918 Ang C12.SG and L25.CD2 other bump:2.4047 Ang Q13.CG and D20.OD1 other bump:2.36837 Ang Q13.CD and D20.OD1 other bump:1.98861 Ang Q13.OE1 and D20.OD1 other bump:3.00011 Ang Q13.CD and D20.CG other bump:2.09226 Ang Q13.OE1 and D20.CG other bump:2.9166 Ang Q13.OE1 and D20.CB other bump:2.82626 Ang Q13.OE1 and D20.CA other bump:2.32922 Ang Q13.OE1 and D20.N other bump:2.59121 Ang Q13.CD and D19.C other bump:2.20355 Ang Q13.OE1 and D19.C other bump:2.41761 Ang Q13.NE2 and D19.C other bump:2.44959 Ang Q13.CD and D19.O other bump:3.1804 Ang Q13.CD and D19.CA other bump:2.93475 Ang Q13.OE1 and D19.CA other bump:2.66509 Ang Q13.NE2 and D19.CA other bump:2.85681 Ang Q13.CD and D19.N other bump:1.97069 Ang Q13.NE2 and D19.N Number of specific fragments= 5 total=225 Number of alignments=30 # Reading fragments from alignment file # T0129 read from /projects/compbio/experiments/casp5/t0129/1g4yR/T0129-1g4yR-2track-local-adpstyle1.pw.a2m.gz # 1g4yR read from /projects/compbio/experiments/casp5/t0129/1g4yR/T0129-1g4yR-2track-local-adpstyle1.pw.a2m.gz # found chain 1g4yR in template set T0129 2 :LISHSDLNQQLKSAGIGFNATELHGFLSGLLCGGLKDQSWLPLLYQFSNDNHAYPTG 1g4yR 26 :TITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSE Fragment has 36 clashes (null) has 36 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 59 residues other bump:2.77192 Ang F48.CA and D51.OD1 other bump:2.72745 Ang F48.C and D51.OD1 other bump:2.11904 Ang Y46.O and N50.OD1 other bump:2.81118 Ang F27.CE2 and Q47.OE1 other bump:2.17381 Ang F27.CZ and Q47.OE1 other bump:3.02022 Ang F27.CZ and Q47.CD other bump:2.30587 Ang L31.CD1 and Q47.CB other bump:2.92598 Ang L31.CD1 and Q47.CA other bump:2.76021 Ang Q39.OE1 and L44.CA other bump:2.61011 Ang L2.CD1 and D38.OD2 other bump:3.10336 Ang L32.CG and G35.CA other bump:2.16084 Ang H5.CD2 and L28.CD1 other bump:2.63665 Ang H5.NE2 and L28.CD1 other bump:3.16255 Ang H5.ND1 and H25.CE1 other bump:3.22794 Ang H5.CE1 and H25.CE1 other bump:2.63379 Ang H5.CE1 and H25.ND1 other bump:2.277 Ang H5.ND1 and H25.CD2 other bump:2.13355 Ang H5.CE1 and H25.CG other bump:2.52085 Ang H5.CE1 and H25.CB other bump:3.13226 Ang H5.ND1 and H25.CA other bump:2.06645 Ang H5.CE1 and H25.CA other bump:2.40141 Ang H5.NE2 and H25.CA other bump:2.56749 Ang H5.CE1 and H25.N other bump:3.15458 Ang H5.CE1 and L24.C other bump:2.83842 Ang N20.OD1 and E23.CD other bump:2.36768 Ang N20.OD1 and E23.CG other bump:2.45463 Ang N20.OD1 and E23.CB other bump:2.27605 Ang N20.OD1 and E23.N other bump:2.47944 Ang I17.CG2 and F19.CE1 other bump:2.84308 Ang L12.CD1 and F19.CE1 other bump:2.89808 Ang L12.CD2 and F19.CE1 other bump:2.75135 Ang I17.CG2 and F19.CD1 other bump:2.58595 Ang L12.CD1 and F19.CD1 other bump:1.35632 Ang N9.OD1 and K13.NZ other bump:2.16878 Ang N9.CG and K13.NZ self-bump: 1.38807 Ang H5.CA and H5.CB T0129 64 :TELYEQISQTLSDVEGFTF 1g4yR 83 :EEIREAFRVFDKDGNGYIS Fragment has 20 clashes (null) has 20 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 21 residues other bump:1.80227 Ang L12.CD2 and T19.OG1 other bump:2.79387 Ang L12.CD2 and T19.CB other bump:2.89351 Ang L12.CD2 and T19.CA other bump:2.80438 Ang L12.CD2 and T19.N other bump:2.53674 Ang L12.CD2 and F18.C other bump:2.19612 Ang L12.CD2 and F18.O other bump:1.73422 Ang T2.CG2 and Y5.OH other bump:2.83484 Ang T2.CB and Y5.OH other bump:2.33809 Ang T2.CG2 and Y5.CZ other bump:2.92569 Ang T2.CA and Y5.CZ other bump:2.77883 Ang T2.CG2 and Y5.CE2 other bump:2.88919 Ang T2.O and Y5.CE2 other bump:2.94474 Ang T2.C and Y5.CE2 other bump:3.16183 Ang T2.N and Y5.CE2 other bump:2.11508 Ang T2.CA and Y5.CE2 other bump:2.68454 Ang T2.CB and Y5.CE2 other bump:2.90242 Ang T2.OG1 and Y5.CE2 other bump:3.15082 Ang T2.C and Y5.CD2 other bump:2.66672 Ang T2.CA and Y5.CD2 self-bump: 1.37759 Ang Y5.CA and Y5.CB T0129 100 :SDWANQFLLGIGLAQPE 1g4yR 102 :AAELRHVMTNLGEKLTD Fragment has 11 clashes (null) has 11 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 19 residues other bump:2.01665 Ang N6.ND2 and E18.OE1 other bump:2.84677 Ang L10.CD1 and E18.OE1 other bump:2.58285 Ang L10.CD2 and Q16.O neighbor-bump: 2.79642 Ang I12.CG2 and G13.CA neighbor-bump: 2.3888 Ang I12.CB and G13.N neighbor-bump: 1.58573 Ang I12.CG2 and G13.N self-bump: 2.31308 Ang I12.CG2 and I12.C self-bump: 1.35841 Ang I12.CA and I12.CB other bump:2.02726 Ang N6.ND2 and L10.CD1 other bump:2.91412 Ang N6.OD1 and L10.CD1 other bump:2.67865 Ang N6.CG and L10.CD1 T0129 126 :EAVDDLQDICQLGYDEDDNEEELAEAL 1g4yR 119 :EEVDEMIREADIDGDGQVNYEEFVQMM Fragment has 18 clashes (null) has 18 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 29 residues other bump:2.95918 Ang C11.SG and L24.CD2 other bump:2.4047 Ang Q12.CG and D19.OD1 other bump:2.36837 Ang Q12.CD and D19.OD1 other bump:1.98861 Ang Q12.OE1 and D19.OD1 other bump:3.00011 Ang Q12.CD and D19.CG other bump:2.09226 Ang Q12.OE1 and D19.CG other bump:2.9166 Ang Q12.OE1 and D19.CB other bump:2.82626 Ang Q12.OE1 and D19.CA other bump:2.32922 Ang Q12.OE1 and D19.N other bump:2.59121 Ang Q12.CD and D18.C other bump:2.20355 Ang Q12.OE1 and D18.C other bump:2.41761 Ang Q12.NE2 and D18.C other bump:2.44959 Ang Q12.CD and D18.O other bump:3.1804 Ang Q12.CD and D18.CA other bump:2.93475 Ang Q12.OE1 and D18.CA other bump:2.66509 Ang Q12.NE2 and D18.CA other bump:2.85681 Ang Q12.CD and D18.N other bump:1.97069 Ang Q12.NE2 and D18.N Number of specific fragments= 4 total=229 Number of alignments=31 # Reading fragments from alignment file # T0129 read from /projects/compbio/experiments/casp5/t0129/1fd9A/1fd9A-T0129-fssp-global-adpstyle5.pw.a2m.gz # 1fd9A read from /projects/compbio/experiments/casp5/t0129/1fd9A/1fd9A-T0129-fssp-global-adpstyle5.pw.a2m.gz # found chain 1fd9A in template set T0129 1 :M 1fd9A 9 :T Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 2 residues T0129 2 :LISHSDLNQQLKSAGIGFNATELHGFLSGLLCGG 1fd9A 16 :YSIGADLGKNFKNQGIDVNPEAMAKGMQDAMSGA Fragment has 11 clashes (null) has 11 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 36 residues other bump:1.19502 Ang I17.CG2 and F19.CZ other bump:2.48637 Ang I17.CB and F19.CZ other bump:1.57629 Ang I17.CG2 and F19.CE2 other bump:2.99912 Ang I17.CA and F19.CE2 other bump:2.04376 Ang I17.CB and F19.CE2 other bump:2.39142 Ang I17.O and F19.CE2 other bump:2.89253 Ang I17.C and F19.CE2 other bump:2.34112 Ang I17.CG2 and F19.CE1 other bump:2.7643 Ang I17.CG2 and F19.CD2 other bump:2.12013 Ang I17.O and F19.CD2 other bump:2.97769 Ang I17.C and F19.CD2 T0129 36 :LKDQSWLPLLYQFSNDNHAYPTGLVQP 1fd9A 53 :LTEQQMKDVLNKFQKDLMAKRTAEFNK Fragment has 12 clashes (null) has 12 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 29 residues other bump:2.81861 Ang S6.C and P9.CD other bump:2.48702 Ang Q5.C and P9.CD other bump:3.2849 Ang S6.CA and P9.CD other bump:1.49041 Ang Q5.O and P9.CD other bump:2.99646 Ang Q5.C and P9.CG other bump:2.53268 Ang Q5.O and P9.CG other bump:2.14527 Ang L2.CB and W7.NE1 other bump:2.60653 Ang L2.CG and W7.NE1 other bump:2.45913 Ang L2.CD1 and W7.NE1 other bump:3.0663 Ang L2.CB and W7.CE2 other bump:2.69688 Ang L2.CB and W7.CD1 other bump:2.48471 Ang L2.CD1 and W7.CD1 T0129 69 :Q 1fd9A 80 :K Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 3 residues T0129 75 :SDVEGFTFELGLTEDEN 1fd9A 81 :ADENKVKGEAFLTENKN Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 19 residues other bump:2.98459 Ang F9.CE2 and L13.CD1 T0129 102 :WANQFLLGIGLAQPELAKEKG 1fd9A 98 :KPGVVVLPSGLQYKVINSGNG Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 23 residues other bump:2.22279 Ang E16.OE1 and K19.CB T0129 124 :IG 1fd9A 120 :KP Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues T0129 126 :EAVDDLQDICQLGYDEDDNEEELAEALEEIIEYVR 1fd9A 130 :EYTGRLIDGTVFDSTEKTGKPATFQVSQVIPGWTE Fragment has 28 clashes (null) has 28 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 37 residues other bump:2.02714 Ang D5.OD1 and Y34.OH other bump:2.26456 Ang A25.CB and E30.OE2 other bump:3.06691 Ang Y15.CE2 and D18.OD2 other bump:1.95843 Ang Y15.OH and D18.OD2 other bump:1.82531 Ang Y15.CE2 and D18.OD1 other bump:1.23512 Ang Y15.OH and D18.OD1 other bump:2.37358 Ang Y15.CE2 and D18.CG other bump:1.75657 Ang Y15.OH and D18.CG other bump:2.60972 Ang Y15.CE2 and D18.N other bump:2.94636 Ang Y15.CD2 and D18.N other bump:2.84068 Ang Y15.CD2 and E17.CB other bump:2.52016 Ang Q12.OE1 and Y15.CD1 other bump:2.82111 Ang Q12.CD and Y15.CD1 other bump:2.33906 Ang Q12.OE1 and Y15.CG other bump:2.22767 Ang Q12.OE1 and Y15.CB other bump:1.76261 Ang V4.CG2 and Q12.OE1 other bump:2.26777 Ang V4.CG2 and Q12.CD other bump:3.09175 Ang V4.CG2 and Q12.CG other bump:2.5159 Ang D6.OD1 and C11.C other bump:2.64937 Ang D9.OD1 and C11.SG other bump:2.89813 Ang D6.CG and I10.C other bump:2.06367 Ang D6.OD1 and I10.C other bump:2.00402 Ang D6.OD1 and I10.O neighbor-bump: 2.63213 Ang D9.C and I10.CB other bump:3.07613 Ang D6.CG and I10.CA other bump:2.8335 Ang D6.OD1 and I10.CA other bump:2.60861 Ang D6.OD2 and I10.CA neighbor-bump: 2.32703 Ang D6.OD2 and L7.O T0129 161 :TIAMLFYS 1fd9A 174 :TWEIYVPS Fragment has 20 clashes (null) has 20 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 10 residues other bump:1.87223 Ang M5.CE and F7.CZ other bump:0.689971 Ang M5.SD and F7.CZ other bump:2.18993 Ang M5.CB and F7.CZ other bump:1.44103 Ang M5.CG and F7.CZ other bump:1.51522 Ang M5.CE and F7.CE2 other bump:1.8626 Ang M5.SD and F7.CE2 other bump:2.16649 Ang M5.CB and F7.CE2 other bump:1.78078 Ang M5.CG and F7.CE2 other bump:2.18344 Ang M5.CE and F7.CE1 other bump:0.798101 Ang M5.SD and F7.CE1 other bump:1.99773 Ang M5.CG and F7.CE1 other bump:1.5524 Ang M5.CE and F7.CD2 other bump:2.57852 Ang M5.SD and F7.CD2 other bump:2.49589 Ang M5.CG and F7.CD2 other bump:2.21147 Ang M5.CE and F7.CD1 other bump:1.96128 Ang M5.SD and F7.CD1 other bump:2.65705 Ang M5.CG and F7.CD1 other bump:1.94605 Ang M5.CE and F7.CG other bump:2.63482 Ang M5.SD and F7.CG other bump:2.87475 Ang M5.CG and F7.CG T0129 169 :HFNEGEIESKPVL 1fd9A 188 :RSVGGPIGPNETL Fragment has 12 clashes (null) has 12 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues other bump:2.40284 Ang F3.CD1 and I8.O other bump:2.75616 Ang F3.CZ and E5.CD other bump:2.84868 Ang F3.CE2 and E5.CD other bump:1.93773 Ang F3.CD1 and E5.CG other bump:1.95113 Ang F3.CE1 and E5.CG other bump:2.17458 Ang F3.CG and E5.CG other bump:2.41116 Ang F3.CD2 and E5.CG other bump:2.43842 Ang F3.CE2 and E5.CG other bump:1.87475 Ang F3.CD1 and E5.CB other bump:1.45488 Ang F3.CE1 and E5.CB other bump:2.43174 Ang F3.CZ and E5.CB other bump:2.92088 Ang F3.CG and E5.CB Number of specific fragments= 10 total=239 Number of alignments=32 # Reading fragments from alignment file # T0129 read from /projects/compbio/experiments/casp5/t0129/1fkmA/1fkmA-T0129-fssp-global-adpstyle5.pw.a2m.gz # 1fkmA read from /projects/compbio/experiments/casp5/t0129/1fkmA/1fkmA-T0129-fssp-global-adpstyle5.pw.a2m.gz # found chain 1fkmA in template set T0129 1 :MLI 1fkmA 249 :NSI Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues T0129 4 :SHSDLNQQ 1fkmA 269 :NQQDLRQI Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 10 residues other bump:2.51473 Ang H3.ND1 and N7.ND2 other bump:2.29721 Ang H3.CE1 and N7.ND2 T0129 12 :LKSAGIGFNATELHGFLSGL 1fkmA 292 :LLIGYLPVNTKRQEGFLQRK Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 22 residues other bump:2.26459 Ang F17.CE2 and L21.CD1 other bump:2.22164 Ang F17.CZ and L21.CD1 other bump:2.90611 Ang G6.O and F17.CE2 other bump:2.37776 Ang I7.CG1 and L14.CD2 other bump:2.92414 Ang L2.CD2 and I7.CG2 neighbor-bump: 2.05323 Ang S4.O and A5.CB neighbor-bump: 2.38257 Ang S4.C and A5.CB T0129 32 :LCGGLKDQS 1fkmA 319 :LKHTFSDQH Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues T0129 41 :WL 1fkmA 334 :WH Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues T0129 43 :PLLYQFSN 1fkmA 348 :IPLYQFKS Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 10 residues T0129 51 :DNHAYPTGLVQPVTELYEQISQ 1fkmA 372 :PASGYVQGINDLVTPFFETFLT Fragment has 25 clashes (null) has 25 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 24 residues other bump:2.4622 Ang Q20.CG and Q23.NE2 other bump:2.2491 Ang Q20.O and Q23.NE2 other bump:2.8511 Ang Q20.C and Q23.NE2 other bump:2.16579 Ang Q20.CA and Q23.OE1 other bump:1.06728 Ang Q20.O and Q23.OE1 other bump:1.60144 Ang Q20.C and Q23.OE1 other bump:2.8836 Ang Q20.CA and Q23.CD other bump:1.57888 Ang Q20.O and Q23.CD other bump:2.47758 Ang Q20.C and Q23.CD other bump:1.77503 Ang G9.O and P13.CD other bump:2.89715 Ang G9.C and P13.CD other bump:3.28725 Ang L10.CA and P13.CD self-bump: 1.37023 Ang P13.N and P13.CD neighbor-bump: 2.51066 Ang Q12.N and P13.CD other bump:2.97783 Ang L10.C and P13.CD other bump:2.17114 Ang G9.O and P13.CG other bump:3.17958 Ang G9.C and P13.CG other bump:2.95607 Ang Y6.CE1 and V11.CG2 other bump:2.90213 Ang Y6.CZ and V11.CG2 other bump:2.1501 Ang Y6.OH and V11.CG2 other bump:2.89804 Ang P7.CD and L10.CD2 neighbor-bump: 2.4731 Ang A5.CB and Y6.N self-bump: 2.15597 Ang A5.CB and A5.C self-bump: 1.19696 Ang A5.CA and A5.CB self-bump: 1.36295 Ang H4.CA and H4.CB T0129 73 :TLSDVEGFTFELGLTEDENVFTQADS 1fkmA 400 :QIDDVEIKDPSTYMVDEQITDLEADT Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:2.58989 Ang D18.OD2 and F22.CE1 other bump:2.68598 Ang L15.CD2 and E19.OE1 other bump:2.32268 Ang T10.OG1 and L13.CD1 other bump:2.38485 Ang D5.CB and F9.CE1 other bump:2.28487 Ang D5.O and F9.CD1 T0129 99 :LSDWANQFLLGIGLAQPELAKEKGEIGEAVDDLQD 1fkmA 429 :LTKLLEQITDNYIHGQPGILRQVKNLSQLVKRIDA Fragment has 26 clashes (null) has 26 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 37 residues other bump:2.17265 Ang K22.O and E26.OE2 other bump:2.13439 Ang K22.CG and E26.OE2 other bump:2.7426 Ang K22.C and E26.OE2 other bump:0.892486 Ang K22.O and E26.OE1 other bump:2.44873 Ang E23.CA and E26.OE1 other bump:1.74656 Ang K22.C and E26.OE1 other bump:2.34074 Ang E23.N and E26.OE1 other bump:1.64684 Ang K22.O and E26.CD other bump:2.55851 Ang K22.C and E26.CD other bump:2.77068 Ang Q17.NE2 and L20.CD2 other bump:2.60027 Ang G12.CA and E19.OE1 other bump:2.64093 Ang L11.C and E19.OE1 other bump:1.73768 Ang G12.N and E19.OE1 other bump:2.17039 Ang F9.O and E19.OE1 other bump:2.66801 Ang F9.C and E19.OE1 other bump:3.04189 Ang G12.CA and E19.CD other bump:2.65638 Ang G12.N and E19.CD other bump:3.23135 Ang G12.CA and E19.CG other bump:3.12008 Ang G12.N and E19.CG other bump:2.34379 Ang L11.CD1 and E19.CB other bump:2.62386 Ang G12.CA and E19.CB other bump:2.6592 Ang L11.C and E19.CB other bump:2.56116 Ang G12.N and E19.CB other bump:2.51693 Ang L11.CD1 and E19.CA neighbor-bump: 2.18526 Ang L15.O and A16.CB neighbor-bump: 2.55113 Ang L15.C and A16.CB T0129 134 :ICQLGYDE 1fkmA 476 :FIQFAFRW Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 10 residues T0129 142 :DDNEEEL 1fkmA 499 :RMWDTYL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 9 residues T0129 149 :A 1fkmA 508 :T Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 3 residues T0129 152 :LEEII 1fkmA 571 :LNEFH Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 7 residues other bump:2.87504 Ang L2.CD1 and I6.CD1 T0129 157 :EYVRTIAMLF 1fkmA 594 :DFQETITFLQ Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 12 residues other bump:2.5939 Ang I7.CG2 and F11.CE1 other bump:2.22405 Ang I7.O and F11.CD1 neighbor-bump: 2.57704 Ang E2.CG and Y3.N T0129 167 :YSHFNEGEIES 1fkmA 607 :TKDWTETDIEM Fragment has 11 clashes (null) has 11 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 13 residues other bump:1.76349 Ang F5.CD1 and E9.OE1 other bump:2.588 Ang F5.CA and E9.OE1 other bump:2.97147 Ang F5.CD1 and E9.CD other bump:1.81017 Ang Y2.CD1 and F5.CZ other bump:2.71154 Ang Y2.CE1 and F5.CZ other bump:2.87061 Ang Y2.CG and F5.CZ other bump:1.91046 Ang Y2.CD1 and F5.CE2 other bump:2.47843 Ang Y2.CB and F5.CE2 other bump:2.45804 Ang Y2.CG and F5.CE2 other bump:3.12517 Ang Y2.CA and F5.CE2 other bump:2.8454 Ang Y2.CB and F5.CD2 T0129 178 :KPVLH 1fkmA 626 :QSLYK Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 6 residues self-bump: 1.28271 Ang H6.CA and H6.CB Number of specific fragments= 16 total=255 Number of alignments=33 # Reading fragments from alignment file # T0129 read from /projects/compbio/experiments/casp5/t0129/1iapA/1iapA-T0129-local-adpstyle1.pw.a2m.gz # 1iapA read from /projects/compbio/experiments/casp5/t0129/1iapA/1iapA-T0129-local-adpstyle1.pw.a2m.gz # found chain 1iapA in template set T0129 97 :DSLSDWANQFLLGIGLAQPELAKEKGEIGEAVDDLQ 1iapA 152 :RQLEDFRSKRLMGMTPWEQELAQLEAWVGRDRASYE Fragment has 23 clashes (null) has 23 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 38 residues other bump:1.62413 Ang K24.O and E28.OE1 other bump:2.63657 Ang K24.C and E28.OE1 other bump:2.77874 Ang E25.CA and E28.OE1 other bump:2.78013 Ang E25.C and E28.OE1 other bump:2.34681 Ang K24.O and E28.CD other bump:2.06659 Ang E21.O and E25.OE2 other bump:2.66233 Ang E21.C and E25.OE2 other bump:1.12893 Ang E21.O and E25.OE1 other bump:1.96701 Ang E21.C and E25.OE1 other bump:2.35042 Ang L22.CA and E25.OE1 other bump:2.59787 Ang L22.C and E25.OE1 other bump:1.71891 Ang E21.O and E25.CD other bump:2.63897 Ang E21.C and E25.CD other bump:2.74011 Ang F11.CE1 and Q19.NE2 other bump:2.32825 Ang F11.CZ and Q19.NE2 other bump:1.29549 Ang F11.CE1 and Q19.OE1 other bump:2.17348 Ang F11.CZ and Q19.OE1 other bump:2.18679 Ang F11.CD1 and Q19.OE1 other bump:2.25831 Ang F11.CE1 and Q19.CD other bump:2.50319 Ang F11.CZ and Q19.CD other bump:2.88793 Ang L13.CB and I15.CD1 other bump:1.84537 Ang Q10.NE2 and I15.CG2 other bump:2.94897 Ang Q10.CD and I15.CG2 Number of specific fragments= 1 total=256 Number of alignments=34 # Reading fragments from alignment file # T0129 read from /projects/compbio/experiments/casp5/t0129/1iapA/1iapA-T0129-local-adpstyle5.pw.a2m.gz # 1iapA read from /projects/compbio/experiments/casp5/t0129/1iapA/1iapA-T0129-local-adpstyle5.pw.a2m.gz # found chain 1iapA in template set T0129 90 :ENVFTQADSLSDWANQFLLGIGLAQPELAKEKGEIGE 1iapA 145 :SQQVAVGRQLEDFRSKRLMGMTPWEQELAQLEAWVGR Fragment has 23 clashes (null) has 23 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 39 residues other bump:1.62413 Ang K31.O and E35.OE1 other bump:2.63657 Ang K31.C and E35.OE1 other bump:2.77874 Ang E32.CA and E35.OE1 other bump:2.78013 Ang E32.C and E35.OE1 other bump:2.34681 Ang K31.O and E35.CD other bump:2.06659 Ang E28.O and E32.OE2 other bump:2.66233 Ang E28.C and E32.OE2 other bump:1.12893 Ang E28.O and E32.OE1 other bump:1.96701 Ang E28.C and E32.OE1 other bump:2.35042 Ang L29.CA and E32.OE1 other bump:2.59787 Ang L29.C and E32.OE1 other bump:1.71891 Ang E28.O and E32.CD other bump:2.63897 Ang E28.C and E32.CD other bump:2.74011 Ang F18.CE1 and Q26.NE2 other bump:2.32825 Ang F18.CZ and Q26.NE2 other bump:2.18679 Ang F18.CD1 and Q26.OE1 other bump:1.29549 Ang F18.CE1 and Q26.OE1 other bump:2.17348 Ang F18.CZ and Q26.OE1 other bump:2.25831 Ang F18.CE1 and Q26.CD other bump:2.50319 Ang F18.CZ and Q26.CD other bump:2.88793 Ang L20.CB and I22.CD1 other bump:1.84537 Ang Q17.NE2 and I22.CG2 other bump:2.94897 Ang Q17.CD and I22.CG2 T0129 133 :DICQLGYDEDDNEEELAEALEEIIE 1iapA 182 :DRASYEARERHVAERLLMHLEEMQH Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 27 residues other bump:2.3009 Ang E22.O and I25.CD1 other bump:2.99134 Ang E22.CA and I25.CG1 other bump:2.04806 Ang E22.O and I25.CG1 other bump:2.79426 Ang E22.C and I25.CG1 Number of specific fragments= 2 total=258 Number of alignments=35 # Reading fragments from alignment file # T0129 read from /projects/compbio/experiments/casp5/t0129/5cpp/T0129-5cpp-2track-local-adpstyle1.pw.a2m.gz # 5cpp read from /projects/compbio/experiments/casp5/t0129/5cpp/T0129-5cpp-2track-local-adpstyle1.pw.a2m.gz # found chain 5cpp in template set T0129 37 :KDQSWLPLLYQFS 5cpp 107 :EQRQFRALANQVV Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues other bump:1.72385 Ang Q4.O and P8.CD other bump:2.61813 Ang Q4.C and P8.CD other bump:3.01053 Ang S5.C and P8.CD neighbor-bump: 2.40053 Ang L7.N and P8.CD other bump:1.60592 Ang Q4.O and P8.CG other bump:2.76384 Ang Q4.C and P8.CG T0129 52 :NHAYPTGL 5cpp 120 :GMPVVDKL Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 10 residues other bump:3.1936 Ang H3.CA and P6.CD other bump:2.89199 Ang N2.C and P6.CD other bump:2.50859 Ang H3.O and P6.CD other bump:2.70041 Ang H3.C and P6.CD other bump:1.80439 Ang N2.O and P6.CD other bump:3.27872 Ang N2.C and P6.CG other bump:2.51064 Ang N2.O and P6.CG T0129 62 :PVTELYEQISQTLSDVEGFT 5cpp 130 :RIQELACSLIESLRPQGQCN Fragment has 16 clashes (null) has 16 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 22 residues other bump:1.62248 Ang L14.CB and F20.CZ other bump:2.39875 Ang L14.CG and F20.CZ other bump:2.44087 Ang L14.CD2 and F20.CZ other bump:1.83831 Ang L14.CA and F20.CZ other bump:2.46255 Ang L14.C and F20.CZ other bump:2.49823 Ang L14.O and F20.CZ other bump:2.38507 Ang L14.CB and F20.CE2 other bump:2.22791 Ang L14.CG and F20.CE2 other bump:1.40306 Ang L14.CD2 and F20.CE2 other bump:2.75998 Ang L14.CA and F20.CE2 other bump:2.22223 Ang L14.CB and F20.CE1 other bump:2.81502 Ang L14.CA and F20.CE1 other bump:2.89002 Ang L14.C and F20.CE1 other bump:2.9275 Ang L14.CG and F20.CD2 other bump:1.88336 Ang L14.CD2 and F20.CD2 other bump:2.5688 Ang V17.CG1 and G19.O T0129 93 :FTQA 5cpp 150 :FTED Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 6 residues T0129 99 :LSDWANQFLLGIGLAQPELAKEKG 5cpp 156 :EPFPIRIFMLLAGLPEEDIPHLKY Fragment has 13 clashes (null) has 13 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 26 residues other bump:2.31246 Ang A16.CB and E19.OE2 other bump:2.23267 Ang A16.CA and E19.OE1 other bump:2.29806 Ang A16.CB and E19.OE1 other bump:1.41783 Ang A16.O and E19.OE1 other bump:1.97235 Ang A16.C and E19.OE1 other bump:3.12788 Ang A16.CA and E19.CD other bump:2.61413 Ang A16.CB and E19.CD other bump:2.59366 Ang A16.O and E19.CD other bump:3.17073 Ang A16.C and E19.CD other bump:2.38179 Ang I13.CD1 and L15.CD1 other bump:3.13124 Ang I13.CD1 and L15.CB other bump:2.84607 Ang F9.CE2 and I13.CG2 other bump:2.98078 Ang F9.CZ and I13.CG2 T0129 128 :VDDLQDICQLGYDEDDNEEELAEALEEIIEYVR 5cpp 180 :LTDQMTRPDGSMTFAEAKEALYDYLIPIIEQRR Fragment has 11 clashes (null) has 11 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 35 residues other bump:2.36553 Ang E24.O and E28.OE1 other bump:2.82481 Ang V2.CG1 and N18.OD1 other bump:2.29348 Ang Q6.CG and N18.ND2 other bump:2.79644 Ang Q6.CD and N18.ND2 other bump:2.56249 Ang Q6.NE2 and N18.ND2 other bump:2.54677 Ang V2.O and N18.CG other bump:2.72743 Ang Q6.NE2 and N18.CB other bump:2.37897 Ang D14.OD1 and D17.CG other bump:2.77733 Ang D14.OD1 and D17.CB self-bump: 1.38571 Ang L11.CA and L11.CB other bump:2.51965 Ang L5.CD2 and Q10.OE1 Number of specific fragments= 6 total=264 Number of alignments=36 # Reading fragments from alignment file # T0129 read from /projects/compbio/experiments/casp5/t0129/5cpp/T0129-5cpp-2track-local-adpstyle5.pw.a2m.gz # 5cpp read from /projects/compbio/experiments/casp5/t0129/5cpp/T0129-5cpp-2track-local-adpstyle5.pw.a2m.gz # found chain 5cpp in template set T0129 36 :LKDQSWLPLLYQFS 5cpp 106 :PEQRQFRALANQVV Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 16 residues other bump:1.72385 Ang Q5.O and P9.CD other bump:2.61813 Ang Q5.C and P9.CD other bump:3.01053 Ang S6.C and P9.CD neighbor-bump: 2.40053 Ang L8.N and P9.CD other bump:1.60592 Ang Q5.O and P9.CG other bump:2.76384 Ang Q5.C and P9.CG T0129 52 :NHAYPTGL 5cpp 120 :GMPVVDKL Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 10 residues other bump:3.1936 Ang H3.CA and P6.CD other bump:2.89199 Ang N2.C and P6.CD other bump:2.50859 Ang H3.O and P6.CD other bump:2.70041 Ang H3.C and P6.CD other bump:1.80439 Ang N2.O and P6.CD other bump:3.27872 Ang N2.C and P6.CG other bump:2.51064 Ang N2.O and P6.CG T0129 62 :PVTELYEQISQTLSDVEGF 5cpp 130 :RIQELACSLIESLRPQGQC Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 21 residues other bump:2.5688 Ang V17.CG1 and G19.O T0129 92 :VFTQA 5cpp 149 :NFTED Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 7 residues T0129 99 :LSDWANQFLLGIGLAQPELAKEKGEIGEAVD 5cpp 156 :EPFPIRIFMLLAGLPEEDIPHLKYLTDQMTR Fragment has 13 clashes (null) has 13 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 33 residues other bump:2.31246 Ang A16.CB and E19.OE2 other bump:2.23267 Ang A16.CA and E19.OE1 other bump:2.29806 Ang A16.CB and E19.OE1 other bump:1.41783 Ang A16.O and E19.OE1 other bump:1.97235 Ang A16.C and E19.OE1 other bump:3.12788 Ang A16.CA and E19.CD other bump:2.61413 Ang A16.CB and E19.CD other bump:2.59366 Ang A16.O and E19.CD other bump:3.17073 Ang A16.C and E19.CD other bump:2.38179 Ang I13.CD1 and L15.CD1 other bump:3.13124 Ang I13.CD1 and L15.CB other bump:2.84607 Ang F9.CE2 and I13.CG2 other bump:2.98078 Ang F9.CZ and I13.CG2 T0129 135 :CQLGYDEDDNEEELAEALEEIIEYVR 5cpp 187 :PDGSMTFAEAKEALYDYLIPIIEQRR Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:2.36553 Ang E17.O and E21.OE1 other bump:2.37897 Ang D7.OD1 and D10.CG other bump:2.77733 Ang D7.OD1 and D10.CB self-bump: 1.38571 Ang L4.CA and L4.CB Number of specific fragments= 6 total=270 Number of alignments=37 # Reading fragments from alignment file # T0129 read from /projects/compbio/experiments/casp5/t0129/1osa/T0129-1osa-2track-local-adpstyle1.pw.a2m.gz # 1osa read from /projects/compbio/experiments/casp5/t0129/1osa/T0129-1osa-2track-local-adpstyle1.pw.a2m.gz # found chain 1osa in template set T0129 2 :LISHSDLNQQLKSAGIGFNATELHGFLSGLLCGG 1osa 26 :TITTKELGTVMRSLGQNPTEAELQDMINEVDADG Fragment has 28 clashes (null) has 28 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 36 residues other bump:2.47771 Ang H5.CG and L28.CD1 other bump:1.41328 Ang H5.CD2 and L28.CD1 other bump:2.29977 Ang H5.NE2 and L28.CD1 other bump:2.23012 Ang H5.CD2 and L28.CG other bump:2.72683 Ang H5.NE2 and L28.CG other bump:2.89636 Ang H5.CD2 and L28.CB other bump:2.60603 Ang H5.NE2 and L28.CB other bump:3.06936 Ang H5.ND1 and H25.CE1 other bump:2.63779 Ang H5.CE1 and H25.ND1 other bump:2.49425 Ang H5.ND1 and H25.CD2 other bump:2.79717 Ang H5.CE1 and H25.CB other bump:2.31686 Ang H5.CE1 and H25.CA other bump:2.82723 Ang H5.NE2 and H25.CA other bump:3.05077 Ang H5.ND1 and H25.CA other bump:3.08409 Ang N9.CG and L24.CD2 other bump:1.94598 Ang N9.OD1 and L24.CD2 other bump:1.77924 Ang N9.CG and L24.CD1 other bump:1.25776 Ang N9.OD1 and L24.CD1 other bump:1.95882 Ang N9.ND2 and L24.CD1 other bump:2.91624 Ang N9.CG and L24.CG other bump:1.87776 Ang N9.OD1 and L24.CG other bump:2.32148 Ang N20.OD1 and E23.CG other bump:2.42062 Ang I17.CD1 and F19.CZ other bump:2.32088 Ang I17.CD1 and F19.CE1 other bump:2.36943 Ang L12.CD1 and F19.CE1 other bump:3.11235 Ang L12.CB and F19.CE1 other bump:2.90599 Ang I17.CG1 and F19.CE1 other bump:2.54703 Ang L12.CD1 and F19.CD1 T0129 50 :NDNHAYPTGLVQPVTELYEQISQT 1osa 60 :NGTIDFPEFLSLMARKMKEQDSEE Fragment has 13 clashes (null) has 13 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 26 residues other bump:2.73319 Ang G10.C and P14.CD other bump:1.5935 Ang G10.O and P14.CD other bump:3.0166 Ang G10.C and P14.CG other bump:1.86518 Ang G10.O and P14.CG other bump:2.33085 Ang H5.CE1 and G10.CA other bump:2.13465 Ang H5.NE2 and G10.CA other bump:1.86098 Ang H5.CE1 and G10.N other bump:2.25766 Ang H5.NE2 and G10.N other bump:2.16908 Ang H5.CE1 and T9.C other bump:2.48267 Ang H5.ND1 and T9.CG2 other bump:2.97962 Ang H5.CE1 and T9.CG2 other bump:2.74449 Ang H5.ND1 and T9.CB other bump:2.92147 Ang H5.CE1 and T9.CB Number of specific fragments= 2 total=272 Number of alignments=38 # Reading fragments from alignment file # T0129 read from /projects/compbio/experiments/casp5/t0129/1osa/T0129-1osa-2track-local-adpstyle5.pw.a2m.gz # 1osa read from /projects/compbio/experiments/casp5/t0129/1osa/T0129-1osa-2track-local-adpstyle5.pw.a2m.gz # found chain 1osa in template set T0129 3 :ISHSDLNQQLKSAGIGFNATELHGFLSGLLCGGLKDQSWLPLLYQFS 1osa 27 :ITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLSLMA Fragment has 55 clashes (null) has 55 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 49 residues other bump:2.53545 Ang L43.CG and F47.CZ other bump:2.12023 Ang L43.CD1 and F47.CZ other bump:2.45395 Ang L43.CD2 and F47.CZ other bump:2.55711 Ang L43.CG and F47.CE2 other bump:1.74871 Ang L43.CD2 and F47.CE2 other bump:2.82398 Ang L43.CD1 and F47.CE1 neighbor-bump: 2.76783 Ang Q46.NE2 and F47.CE1 neighbor-bump: 2.73179 Ang Q46.NE2 and F47.CD1 other bump:2.72442 Ang L30.CD1 and Q46.OE1 other bump:2.92719 Ang W40.CZ2 and L44.CD1 other bump:2.77221 Ang W40.CH2 and L44.CD1 other bump:2.95606 Ang Q38.NE2 and L43.CA other bump:2.89683 Ang L31.CD2 and Q38.CB other bump:2.55832 Ang L31.CD2 and Q38.CA other bump:2.57469 Ang L31.CD2 and Q38.N other bump:3.20939 Ang L31.CG and D37.C other bump:2.38562 Ang L31.CD2 and D37.C other bump:2.93918 Ang L31.CD1 and D37.C other bump:2.18493 Ang L31.CD2 and D37.O other bump:2.88856 Ang I2.C and D37.OD2 other bump:1.01026 Ang I2.O and D37.OD1 other bump:1.94652 Ang I2.C and D37.OD1 other bump:2.12669 Ang I2.O and D37.CG other bump:2.74988 Ang I2.C and D37.CG other bump:2.95163 Ang L31.CD1 and D37.CA other bump:2.76894 Ang L31.CD1 and D37.N other bump:2.94082 Ang L31.CD1 and K36.C other bump:1.41328 Ang H4.CD2 and L27.CD1 other bump:2.29977 Ang H4.NE2 and L27.CD1 other bump:2.47771 Ang H4.CG and L27.CD1 other bump:2.23012 Ang H4.CD2 and L27.CG other bump:2.72683 Ang H4.NE2 and L27.CG other bump:2.89636 Ang H4.CD2 and L27.CB other bump:2.60603 Ang H4.NE2 and L27.CB other bump:3.06936 Ang H4.ND1 and H24.CE1 other bump:2.63779 Ang H4.CE1 and H24.ND1 other bump:2.49425 Ang H4.ND1 and H24.CD2 other bump:2.79717 Ang H4.CE1 and H24.CB other bump:2.82723 Ang H4.NE2 and H24.CA other bump:3.05077 Ang H4.ND1 and H24.CA other bump:2.31686 Ang H4.CE1 and H24.CA other bump:1.94598 Ang N8.OD1 and L23.CD2 other bump:3.08409 Ang N8.CG and L23.CD2 other bump:1.25776 Ang N8.OD1 and L23.CD1 other bump:1.77924 Ang N8.CG and L23.CD1 other bump:1.95882 Ang N8.ND2 and L23.CD1 other bump:1.87776 Ang N8.OD1 and L23.CG other bump:2.91624 Ang N8.CG and L23.CG other bump:2.32148 Ang N19.OD1 and E22.CG other bump:2.42062 Ang I16.CD1 and F18.CZ other bump:2.36943 Ang L11.CD1 and F18.CE1 other bump:2.32088 Ang I16.CD1 and F18.CE1 other bump:3.11235 Ang L11.CB and F18.CE1 other bump:2.90599 Ang I16.CG1 and F18.CE1 other bump:2.54703 Ang L11.CD1 and F18.CD1 T0129 55 :YPTGLVQPVTELYEQISQTLSDVE 1osa 74 :RKMKEQDSEEELIEAFKVFDRDGN Fragment has 13 clashes (null) has 13 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 26 residues other bump:2.2759 Ang D23.OD1 and E25.OE2 other bump:2.75165 Ang D23.CB and E25.OE1 other bump:1.57294 Ang D23.CG and E25.OE1 other bump:0.473933 Ang D23.OD1 and E25.OE1 other bump:2.37648 Ang D23.OD2 and E25.OE1 other bump:2.38376 Ang D23.CG and E25.CD other bump:1.53031 Ang D23.OD1 and E25.CD other bump:2.65113 Ang D23.OD2 and E25.CD neighbor-bump: 2.63995 Ang D23.C and V24.CB other bump:2.52849 Ang V10.CG1 and Y14.CE1 other bump:2.59865 Ang V10.O and Y14.CD1 other bump:1.91923 Ang G5.O and P9.CD other bump:3.11718 Ang G5.C and P9.CD T0129 91 :NVFTQAD 1osa 98 :GLISAAE Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 9 residues T0129 103 :ANQFLLGIGLAQPE 1osa 105 :LRHVMTNLGEKLTD Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 16 residues other bump:2.06378 Ang L6.CD1 and Q13.NE2 other bump:2.69352 Ang F5.CE2 and I9.CD1 other bump:2.98959 Ang F5.CZ and I9.CD1 other bump:2.86432 Ang F5.CD2 and I9.CD1 T0129 126 :EAVDDLQDICQLGYDEDDNEEELAEAL 1osa 119 :DEVDEMIREADIDGDGHINYEEFVRMM Fragment has 14 clashes (null) has 14 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 29 residues other bump:2.66477 Ang Q8.NE2 and D18.CA other bump:2.25446 Ang Q8.NE2 and D18.N other bump:2.81407 Ang Q8.CD and E17.C other bump:1.48453 Ang Q8.NE2 and E17.C other bump:2.20525 Ang Q8.CD and E17.O other bump:1.03747 Ang Q8.NE2 and E17.O other bump:2.60191 Ang Q8.NE2 and E17.CA other bump:2.99157 Ang Q12.CD and E17.N other bump:1.99735 Ang Q12.NE2 and E17.N other bump:2.1738 Ang Q12.NE2 and D16.N other bump:3.17617 Ang Q12.CD and Y15.C other bump:2.19417 Ang Q12.NE2 and Y15.C other bump:3.03418 Ang Q12.CD and Y15.CA other bump:2.65113 Ang Q12.NE2 and Y15.CA Number of specific fragments= 5 total=277 Number of alignments=39 # Reading fragments from alignment file # T0129 read from /projects/compbio/experiments/casp5/t0129/1a8h/T0129-1a8h-2track-local-adpstyle5.pw.a2m.gz # 1a8h read from /projects/compbio/experiments/casp5/t0129/1a8h/T0129-1a8h-2track-local-adpstyle5.pw.a2m.gz # found chain 1a8h in template set T0129 24 :LHGFLSGLLCGG 1a8h 320 :LRYYLLREIPYG Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 14 residues neighbor-bump: 2.65169 Ang L9.O and L10.CD1 other bump:1.51783 Ang F5.CD1 and L9.CD1 other bump:2.03751 Ang F5.CE1 and L9.CD1 other bump:2.62836 Ang F5.O and L9.CB T0129 36 :LKDQSW 1a8h 336 :VSEEAL Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 8 residues other bump:2.55331 Ang K3.CB and Q5.OE1 T0129 45 :LYQ 1a8h 342 :RTR Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 5 residues T0129 55 :YPTGLVQPVTELYEQISQTLSD 1a8h 345 :YEADLADDLGNLVQRTRAMLFR Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 24 residues other bump:1.52326 Ang T4.O and P9.CD other bump:2.74709 Ang T4.C and P9.CD other bump:1.99964 Ang T4.O and P9.CG other bump:2.92354 Ang T4.C and P9.CG other bump:2.60275 Ang Y2.CE2 and V7.CG2 T0129 77 :VEG 1a8h 368 :AEG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 5 residues T0129 85 :GLTEDEN 1a8h 371 :RIPEPVA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 9 residues T0129 92 :VFTQADSLSDWANQFLLGIG 1a8h 380 :ELAEGTGLAGRLRPLVRELK Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 22 residues other bump:2.38613 Ang D11.O and Q15.OE1 T0129 120 :EKGEIGEAVDDLQDICQLGYDE 1a8h 400 :FHVALEEAMAYVKALNRYINEK Fragment has 8 clashes (null) has 8 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 24 residues other bump:3.05455 Ang C17.CA and Y21.CE1 other bump:2.84526 Ang C17.CB and Y21.CE1 other bump:2.65196 Ang C17.O and Y21.CE1 other bump:2.99158 Ang C17.C and Y21.CE1 other bump:1.87353 Ang C17.O and Y21.CD1 other bump:2.55648 Ang C17.C and Y21.CD1 other bump:2.26334 Ang G7.O and D11.OD1 other bump:2.27073 Ang G7.O and D11.CG T0129 142 :DDNEEELAEALEEIIEYVRTIAMLFY 1a8h 428 :KKEPEEARAVLYRVVEGLRIASILLT Fragment has 16 clashes (null) has 16 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 28 residues other bump:2.61221 Ang I22.CG2 and F26.CE1 other bump:2.76643 Ang I22.CG2 and F26.CD1 other bump:2.65017 Ang I22.O and F26.CD1 other bump:2.95825 Ang E14.CB and Y18.CE1 other bump:3.22599 Ang E14.C and Y18.CE1 other bump:2.65507 Ang E14.C and Y18.CD1 other bump:1.76181 Ang E14.O and Y18.CD1 other bump:1.86432 Ang E6.O and E10.OE2 other bump:2.59073 Ang E6.C and E10.OE2 other bump:1.10541 Ang E6.O and E10.OE1 other bump:1.8926 Ang E6.C and E10.OE1 other bump:2.31441 Ang E7.N and E10.OE1 other bump:2.20794 Ang E7.CA and E10.OE1 other bump:2.67774 Ang E7.C and E10.OE1 other bump:1.53385 Ang E6.O and E10.CD other bump:2.55364 Ang E6.C and E10.CD Number of specific fragments= 9 total=286 Number of alignments=40 # Reading fragments from alignment file # T0129 read from /projects/compbio/experiments/casp5/t0129/1a8h/T0129-1a8h-2track-local-adpstyle1.pw.a2m.gz # 1a8h read from /projects/compbio/experiments/casp5/t0129/1a8h/T0129-1a8h-2track-local-adpstyle1.pw.a2m.gz # found chain 1a8h in template set T0129 142 :DDNEEELAEALEEIIEYVRTIAMLF 1a8h 428 :KKEPEEARAVLYRVVEGLRIASILL Fragment has 16 clashes (null) has 16 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 27 residues other bump:2.61219 Ang I22.CG2 and F26.CE1 other bump:2.76642 Ang I22.CG2 and F26.CD1 other bump:2.65016 Ang I22.O and F26.CD1 other bump:2.95825 Ang E14.CB and Y18.CE1 other bump:3.22599 Ang E14.C and Y18.CE1 other bump:1.76181 Ang E14.O and Y18.CD1 other bump:2.65507 Ang E14.C and Y18.CD1 other bump:1.86432 Ang E6.O and E10.OE2 other bump:2.59073 Ang E6.C and E10.OE2 other bump:1.10541 Ang E6.O and E10.OE1 other bump:1.8926 Ang E6.C and E10.OE1 other bump:2.31441 Ang E7.N and E10.OE1 other bump:2.20794 Ang E7.CA and E10.OE1 other bump:2.67774 Ang E7.C and E10.OE1 other bump:1.53385 Ang E6.O and E10.CD other bump:2.55364 Ang E6.C and E10.CD Number of specific fragments= 1 total=287 Number of alignments=41 # Reading fragments from alignment file # T0129 read from /projects/compbio/experiments/casp5/t0129/1adeA/1adeA-T0129-fssp-global-adpstyle5.pw.a2m.gz # 1adeA read from /projects/compbio/experiments/casp5/t0129/1adeA/1adeA-T0129-fssp-global-adpstyle5.pw.a2m.gz # found chain 1adeA in template set T0129 9 :NQQLKSAGIG 1adeA 20 :VDLLTERAKY Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 12 residues T0129 20 :NA 1adeA 38 :NA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues T0129 24 :LHGFLSGLLCGGLK 1adeA 52 :LHLIPSGILRENVT Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 16 residues other bump:2.13698 Ang C11.SG and L14.CD2 other bump:2.97652 Ang C11.SG and L14.CG T0129 41 :W 1adeA 73 :V Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 3 residues T0129 42 :LPLLYQ 1adeA 103 :CPLILD Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 8 residues other bump:2.32371 Ang L4.CD1 and Y6.OH T0129 48 :F 1adeA 172 :L Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 3 residues T0129 49 :SNDNHAYPTGLVQPVTELYEQISQTLSDVEGFTFELG 1adeA 187 :LDDTMAVADILTSMVVDVSDLLDQARQRGDFVMFEGA Fragment has 51 clashes (null) has 51 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 39 residues other bump:2.74618 Ang F33.CD2 and F35.CZ other bump:2.12574 Ang F33.CE2 and F35.CZ other bump:2.35375 Ang F33.CE2 and F35.CE2 other bump:2.94823 Ang F33.CZ and F35.CE2 other bump:2.46685 Ang F33.CD2 and F35.CE1 other bump:2.41231 Ang F33.CE2 and F35.CE1 other bump:2.85559 Ang F33.CE2 and F35.CD1 other bump:2.34736 Ang D29.CB and E31.OE2 other bump:2.29799 Ang T26.CA and E31.OE1 other bump:1.92531 Ang T26.O and E31.OE1 other bump:2.38237 Ang T26.C and E31.OE1 other bump:2.93815 Ang D29.CB and E31.CD other bump:3.27179 Ang T26.CA and E31.CD neighbor-bump: 2.22065 Ang D29.O and V30.CB neighbor-bump: 2.48165 Ang D29.C and V30.CB neighbor-bump: 2.30285 Ang Q14.N and P15.CD other bump:2.34077 Ang G11.O and P15.CD neighbor-bump: 2.284 Ang Q14.CA and P15.CD neighbor-bump: 2.80372 Ang Q14.CB and P15.CD neighbor-bump: 2.52465 Ang Q14.CG and P15.CD neighbor-bump: 3.04926 Ang Q14.CD and P15.CD neighbor-bump: 1.86235 Ang Q14.C and P15.CD self-bump: 1.34074 Ang P15.N and P15.CD other bump:2.55008 Ang G11.O and P15.CG self-bump: 2.18651 Ang P15.N and P15.CG other bump:2.27282 Ang G11.O and Q14.NE2 other bump:1.71534 Ang G11.CA and Q14.NE2 other bump:2.30721 Ang G11.C and Q14.NE2 other bump:2.21384 Ang T10.C and Q14.OE1 other bump:1.56871 Ang T10.O and Q14.OE1 other bump:1.69492 Ang G11.O and Q14.OE1 other bump:2.03834 Ang G11.CA and Q14.OE1 other bump:1.67866 Ang G11.C and Q14.OE1 other bump:3.0744 Ang T10.C and Q14.CD other bump:2.45737 Ang T10.O and Q14.CD other bump:1.66548 Ang G11.O and Q14.CD other bump:2.9964 Ang G11.N and Q14.CD other bump:2.13432 Ang G11.CA and Q14.CD other bump:2.07602 Ang G11.C and Q14.CD other bump:2.44997 Ang G11.O and Q14.CG other bump:1.91301 Ang N5.O and P9.CD other bump:2.93931 Ang N5.C and P9.CD other bump:2.98154 Ang H6.CA and P9.CD other bump:2.41162 Ang H6.O and P9.CD other bump:2.41932 Ang H6.C and P9.CD other bump:2.9068 Ang A7.N and P9.CD neighbor-bump: 2.518 Ang Y8.N and P9.CD other bump:2.3055 Ang N5.O and P9.CG other bump:3.03813 Ang N5.C and P9.CG other bump:2.7418 Ang H6.CA and P9.CG other bump:2.9101 Ang H6.C and P9.CG T0129 86 :LTEDENVFTQADSLSDWANQFLLGIGLAQPEL 1adeA 228 :LDIDHGTYPYVTSSNTTAGGVATGSGLGPRYV Fragment has 62 clashes (null) has 62 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 34 residues other bump:3.00935 Ang F22.CZ and L33.CD2 other bump:2.70396 Ang F22.CD2 and L33.CD1 other bump:2.09819 Ang L28.CD1 and E32.OE1 other bump:1.90429 Ang L23.CD1 and Q30.CB other bump:2.78991 Ang L23.CG and Q30.CA other bump:1.81771 Ang L23.CD1 and Q30.CA other bump:2.85223 Ang L23.CD2 and Q30.CA other bump:2.96695 Ang L23.CG and Q30.N other bump:2.43234 Ang L23.CD1 and Q30.N other bump:2.47181 Ang L23.CD2 and Q30.N other bump:2.32069 Ang L23.CD2 and A29.C other bump:2.55566 Ang L23.CD2 and A29.O other bump:3.21395 Ang L23.CD2 and A29.CA other bump:2.88881 Ang L23.CD2 and L28.C other bump:2.1626 Ang L23.CD2 and L28.O other bump:2.53474 Ang F22.CE2 and L28.CD2 other bump:2.82719 Ang F22.CZ and L28.CD2 other bump:2.8722 Ang E6.OE2 and W18.CH2 other bump:3.05638 Ang E6.CB and W18.CH2 other bump:3.04664 Ang E6.CG and W18.CH2 other bump:2.17305 Ang E6.CD and W18.CH2 other bump:1.58631 Ang E6.OE1 and W18.CH2 other bump:2.18525 Ang E6.OE2 and W18.CZ3 other bump:1.99087 Ang E6.CD and W18.CZ3 other bump:1.46183 Ang E6.OE1 and W18.CZ3 other bump:2.76803 Ang E6.CB and W18.CZ2 other bump:2.80385 Ang E6.CD and W18.CZ2 other bump:1.87683 Ang E6.OE1 and W18.CZ2 other bump:2.75482 Ang E6.OE2 and W18.CE3 other bump:2.5099 Ang E6.CD and W18.CE3 other bump:1.65183 Ang E6.OE1 and W18.CE3 other bump:3.15125 Ang E6.CD and W18.CE2 other bump:1.96127 Ang E6.OE1 and W18.CE2 other bump:3.05164 Ang E6.CD and W18.CD2 other bump:1.88809 Ang E6.OE1 and W18.CD2 other bump:2.52244 Ang T3.OG1 and W18.CD1 other bump:2.87692 Ang L2.C and D17.OD2 other bump:1.70646 Ang T3.OG1 and D17.OD1 other bump:2.99595 Ang E4.CG and L15.C neighbor-bump: 1.9834 Ang S14.O and L15.CD1 other bump:3.0238 Ang E4.CG and L15.CA other bump:2.63752 Ang E4.CG and L15.N other bump:2.93942 Ang E4.CD and L15.N other bump:3.30242 Ang E4.CD and S14.CA other bump:2.85875 Ang E4.OE2 and S14.CA other bump:3.15803 Ang E4.CD and S14.N other bump:2.23 Ang E4.OE2 and S14.N other bump:2.32104 Ang E4.CD and D13.C other bump:2.94941 Ang E4.OE1 and D13.C other bump:1.214 Ang E4.OE2 and D13.C other bump:2.55326 Ang E4.CG and D13.O other bump:1.15441 Ang E4.CD and D13.O other bump:1.77279 Ang E4.OE1 and D13.O other bump:0.61712 Ang E4.OE2 and D13.O other bump:2.28783 Ang E4.OE2 and D13.CA other bump:2.73367 Ang N7.CG and A12.CB other bump:1.65905 Ang N7.ND2 and A12.CB neighbor-bump: 2.64258 Ang F9.CE2 and T10.OG1 other bump:1.8496 Ang T3.O and N7.OD1 other bump:2.22482 Ang T3.O and N7.CG other bump:2.53979 Ang T3.O and N7.CB other bump:2.50368 Ang G1.O and N7.CB T0129 118 :AK 1adeA 291 :CK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues T0129 121 :KGEIGEAVDDLQDIC 1adeA 309 :WLDTVAVRRAVQLNS Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 17 residues other bump:2.02092 Ang E4.OE1 and E7.OE1 other bump:1.96208 Ang E4.CD and E7.OE1 other bump:2.26577 Ang E4.OE2 and E7.OE1 other bump:2.6031 Ang E4.OE1 and E7.CD other bump:2.97534 Ang E4.CD and E7.CD T0129 137 :LG 1adeA 325 :SG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 4 residues T0129 139 :YDED 1adeA 332 :LDVL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 6 residues T0129 143 :DNEEELAEALEEIIE 1adeA 393 :QAALNYIKRIEELTG Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 17 residues other bump:1.67886 Ang G1.O and E5.OE1 other bump:2.40201 Ang D2.CA and E5.OE1 other bump:2.77302 Ang D2.C and E5.OE1 other bump:2.15253 Ang G1.C and E5.OE1 other bump:2.55275 Ang G1.O and E5.CD other bump:3.00625 Ang G1.C and E5.CD T0129 159 :VRTIAMLFYSHFNEGEIESKPVL 1adeA 408 :VPIDIISTGPDRTETMILRDPFD Fragment has 38 clashes (null) has 38 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 25 residues other bump:2.02427 Ang I18.CB and K21.NZ other bump:1.19526 Ang I18.CG1 and K21.NZ other bump:2.58537 Ang I18.CG2 and K21.NZ other bump:0.566795 Ang I18.CD1 and K21.NZ other bump:2.42739 Ang I18.CG1 and K21.CE other bump:1.10598 Ang I18.CD1 and K21.CE other bump:3.05029 Ang I18.CG1 and K21.CD other bump:2.68206 Ang I18.CG2 and K21.CD other bump:2.33767 Ang I18.CD1 and K21.CD other bump:2.04624 Ang I18.CG2 and K21.CG other bump:2.4685 Ang I5.CG2 and S20.OG other bump:2.50088 Ang I5.CB and S20.OG other bump:2.48519 Ang F9.CE2 and G16.N other bump:3.17549 Ang F9.CZ and G16.N other bump:2.8171 Ang F9.CD2 and E15.C other bump:2.42478 Ang F9.CE2 and E15.C other bump:2.76481 Ang F9.CZ and E15.C other bump:2.02498 Ang Y10.CB and E15.OE1 other bump:2.94612 Ang Y10.CG and E15.CD other bump:2.52701 Ang Y10.CB and E15.CD other bump:3.00984 Ang Y10.CB and E15.CB other bump:2.45018 Ang F9.CE1 and E15.CB other bump:2.81524 Ang F9.CZ and E15.CB other bump:2.95132 Ang F9.CD1 and E15.CB other bump:2.57093 Ang F9.CE1 and E15.CA other bump:2.6114 Ang F9.CE2 and E15.CA other bump:2.10715 Ang F9.CZ and E15.CA other bump:3.23833 Ang F9.CZ and E15.N other bump:2.57146 Ang H12.CE1 and N14.ND2 other bump:2.92128 Ang H12.ND1 and N14.CB other bump:2.457 Ang H12.ND1 and N14.N neighbor-bump: 3.05957 Ang F9.CE1 and Y10.CE1 neighbor-bump: 2.1397 Ang F9.CD1 and Y10.CE1 neighbor-bump: 2.38902 Ang F9.O and Y10.CD1 neighbor-bump: 2.66579 Ang F9.C and Y10.CD1 neighbor-bump: 2.63017 Ang F9.CE1 and Y10.CD1 neighbor-bump: 1.77724 Ang F9.CD1 and Y10.CD1 neighbor-bump: 2.48484 Ang F9.O and Y10.CG Number of specific fragments= 14 total=301 Number of alignments=42 # Reading fragments from alignment file # T0129 read from /projects/compbio/experiments/casp5/t0129/1ekbB/T0129-1ekbB-simpleSW-adpstyle5.pw.a2m.gz # 1ekbB read from /projects/compbio/experiments/casp5/t0129/1ekbB/T0129-1ekbB-simpleSW-adpstyle5.pw.a2m.gz # found chain 1ekbB in template set T0129 41 :WLPLLYQFSN 1ekbB 196 :GGPLMCQENN Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 12 residues self-bump: 1.37877 Ang N11.CA and N11.CB other bump:2.96787 Ang L5.CD1 and Y7.OH neighbor-bump: 2.65289 Ang G1.O and W2.CD1 self-bump: 1.39147 Ang W2.CA and W2.CB T0129 71 :SQTLSDVEGFTFELGLTEDENVFTQADSLSDWANQFL 1ekbB 206 :RWLLAGVTSFGYQCALPNRPGVYARVPRFTEWIQSFL Fragment has 15 clashes (null) has 15 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 39 residues other bump:2.56583 Ang D7.OD2 and F24.CG other bump:2.83547 Ang D7.CB and F24.CB other bump:2.96578 Ang T12.CG2 and N22.OD1 other bump:2.4435 Ang F13.CB and D20.OD2 other bump:2.84831 Ang E14.CB and L17.CD1 other bump:2.66895 Ang E14.CG and L17.CD1 other bump:1.6856 Ang E14.CD and L17.CD1 other bump:0.671136 Ang E14.OE1 and L17.CD1 other bump:2.62484 Ang E14.OE2 and L17.CD1 other bump:2.1714 Ang E14.OE1 and L17.CG other bump:2.95287 Ang E14.OE1 and L17.CB neighbor-bump: 2.47894 Ang F13.CE2 and E14.OE2 neighbor-bump: 2.96281 Ang F13.CE2 and E14.CD neighbor-bump: 2.28479 Ang F13.O and E14.CB neighbor-bump: 2.60687 Ang F13.C and E14.CB Number of specific fragments= 2 total=303 Number of alignments=43 # Reading fragments from alignment file # T0129 read from /projects/compbio/experiments/casp5/t0129/1ekbB/T0129-1ekbB-simpleSW-adpstyle1.pw.a2m.gz # 1ekbB read from /projects/compbio/experiments/casp5/t0129/1ekbB/T0129-1ekbB-simpleSW-adpstyle1.pw.a2m.gz # found chain 1ekbB in template set T0129 74 :LSDVEGFTFELGLTEDENVFTQADSLSDWANQFL 1ekbB 209 :LAGVTSFGYQCALPNRPGVYARVPRFTEWIQSFL Fragment has 15 clashes (null) has 15 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 36 residues other bump:2.56583 Ang D4.OD2 and F21.CG other bump:2.83547 Ang D4.CB and F21.CB other bump:2.96578 Ang T9.CG2 and N19.OD1 other bump:2.4435 Ang F10.CB and D17.OD2 other bump:2.84831 Ang E11.CB and L14.CD1 other bump:2.66895 Ang E11.CG and L14.CD1 other bump:1.6856 Ang E11.CD and L14.CD1 other bump:0.671136 Ang E11.OE1 and L14.CD1 other bump:2.62484 Ang E11.OE2 and L14.CD1 other bump:2.1714 Ang E11.OE1 and L14.CG other bump:2.95287 Ang E11.OE1 and L14.CB neighbor-bump: 2.47894 Ang F10.CE2 and E11.OE2 neighbor-bump: 2.96281 Ang F10.CE2 and E11.CD neighbor-bump: 2.28479 Ang F10.O and E11.CB neighbor-bump: 2.60687 Ang F10.C and E11.CB Number of specific fragments= 1 total=304 Number of alignments=44 # Reading fragments from alignment file # T0129 read from /projects/compbio/experiments/casp5/t0129/1go3F/T0129-1go3F-local-adpstyle1.pw.a2m.gz # 1go3F read from /projects/compbio/experiments/casp5/t0129/1go3F/T0129-1go3F-local-adpstyle1.pw.a2m.gz # found chain 1go3F in template set T0129 107 :LLGIGLAQPELAKEKGEIGEAVDDLQDICQ 1go3F 59 :LISLGIDEKTAVKIADILPEDLDDLRAIYY Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 32 residues other bump:3.06067 Ang L2.CA and L12.CD2 other bump:2.19831 Ang L2.CB and L12.CD2 other bump:2.88938 Ang L2.C and L12.CD2 other bump:2.87113 Ang L7.CB and L12.CD2 other bump:2.62727 Ang L3.CA and L12.CD1 other bump:2.92779 Ang L3.CB and L12.CD1 other bump:2.2915 Ang L3.CG and L12.CD1 other bump:2.02665 Ang L3.CD2 and L12.CD1 other bump:2.68374 Ang L3.N and L12.CD1 other bump:2.58468 Ang L7.O and L12.CD1 T0129 145 :EEELAEALEEIIEYVR 1go3F 89 :KRELPENAEEILEIVR Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 18 residues other bump:3.23267 Ang Y15.C and G18.N other bump:2.84427 Ang E11.CG and Y15.CE1 other bump:2.65409 Ang L5.CB and L9.CD1 other bump:2.85328 Ang L5.CD1 and L9.CD1 Number of specific fragments= 2 total=306 Number of alignments=45 # Reading fragments from alignment file # T0129 read from /projects/compbio/experiments/casp5/t0129/1go3F/T0129-1go3F-local-adpstyle5.pw.a2m.gz # 1go3F read from /projects/compbio/experiments/casp5/t0129/1go3F/T0129-1go3F-local-adpstyle5.pw.a2m.gz # found chain 1go3F in template set T0129 106 :FLLGIGLAQPELAKEKGEIGEAVDDLQDIC 1go3F 58 :ELISLGIDEKTAVKIADILPEDLDDLRAIY Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 32 residues other bump:3.06067 Ang L3.CA and L13.CD2 other bump:2.88938 Ang L3.C and L13.CD2 other bump:2.19831 Ang L3.CB and L13.CD2 other bump:2.87113 Ang L8.CB and L13.CD2 other bump:2.62727 Ang L4.CA and L13.CD1 other bump:2.92779 Ang L4.CB and L13.CD1 other bump:2.2915 Ang L4.CG and L13.CD1 other bump:2.68374 Ang L4.N and L13.CD1 other bump:2.02665 Ang L4.CD2 and L13.CD1 other bump:2.58468 Ang L8.O and L13.CD1 T0129 144 :NEEELAEALEEIIEYVR 1go3F 88 :YKRELPENAEEILEIVR Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 19 residues other bump:3.23267 Ang Y16.C and G19.N other bump:2.84427 Ang E12.CG and Y16.CE1 other bump:2.65409 Ang L6.CB and L10.CD1 other bump:2.85328 Ang L6.CD1 and L10.CD1 Number of specific fragments= 2 total=308 Number of alignments=46 # Reading fragments from alignment file # T0129 read from /projects/compbio/experiments/casp5/t0129/1brwA/T0129-1brwA-local-adpstyle5.pw.a2m.gz # 1brwA read from /projects/compbio/experiments/casp5/t0129/1brwA/T0129-1brwA-local-adpstyle5.pw.a2m.gz # found chain 1brwA in template set T0129 13 :KSAGIGFNATELHGFLSGLLCGGLKDQSWLPLLYQFSNDNHAYPTGLVQPVTELYEQISQTLSDVEGFTFELGLTEDEN 1brwA 10 :KRDGKALTKEEIEWIVRGYTNGDIPDYQMSALAMAIYFRGMTEEETAALTMAMVQSGEMLDLSSIRGVKVDKHSTGGVG Fragment has 58 clashes (null) has 58 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 81 residues other bump:2.62825 Ang F69.CE1 and F71.CZ other bump:2.6326 Ang F69.CD1 and F71.CZ other bump:2.58193 Ang F69.CD1 and F71.CE2 other bump:2.46015 Ang F69.CE1 and F71.CE1 other bump:3.08234 Ang F69.CZ and F71.CE1 other bump:2.9949 Ang F69.CD1 and F71.CD2 other bump:2.83679 Ang F69.CE1 and F71.CD1 other bump:2.52171 Ang E54.CD and E57.OE1 other bump:1.87171 Ang E54.OE1 and E57.OE1 other bump:2.92103 Ang E54.CD and E57.CD other bump:2.5786 Ang V52.CG1 and Y56.OH other bump:2.54731 Ang V52.CG1 and Y56.CZ other bump:2.74386 Ang V52.O and Y56.CE2 other bump:3.07767 Ang V52.C and Y56.CE2 other bump:1.92961 Ang V52.CG1 and Y56.CE2 other bump:2.15709 Ang V52.O and Y56.CD2 other bump:2.84261 Ang V52.C and Y56.CD2 other bump:3.04231 Ang V52.CG1 and Y56.CD2 other bump:2.54037 Ang L17.CD2 and E54.OE2 other bump:2.6437 Ang L17.CB and T53.CG2 other bump:2.77343 Ang L17.CG and T53.CG2 other bump:2.10688 Ang L17.CD1 and T53.CG2 other bump:2.29702 Ang L17.CD1 and T53.CB other bump:1.61302 Ang G47.O and P51.CD other bump:2.69728 Ang G47.C and P51.CD other bump:2.89998 Ang L48.C and P51.CD other bump:2.04928 Ang G47.O and P51.CG other bump:3.1854 Ang G47.C and P51.CG neighbor-bump: 1.69632 Ang D40.O and N41.CG neighbor-bump: 2.66016 Ang D40.C and N41.CG other bump:2.07558 Ang K2.O and D40.OD2 other bump:2.89097 Ang Y35.CE2 and N39.ND2 other bump:2.52369 Ang L33.CG and F37.CZ other bump:2.54778 Ang L33.CD1 and F37.CZ other bump:2.75177 Ang L33.CD2 and F37.CZ other bump:2.69204 Ang L33.CD1 and F37.CE2 other bump:2.80975 Ang L33.CG and F37.CE1 other bump:3.04516 Ang K2.CG and F37.CD2 other bump:2.56813 Ang S3.CA and Q36.NE2 other bump:2.44384 Ang S3.CB and Q36.NE2 other bump:3.00279 Ang W30.CZ3 and L34.CD2 other bump:2.93258 Ang W30.CH2 and L34.CD2 other bump:3.19871 Ang W30.CE3 and L34.CD2 other bump:3.06154 Ang W30.CZ2 and L34.CD2 other bump:2.17019 Ang Q28.O and P32.CD other bump:2.95447 Ang Q28.C and P32.CD other bump:3.13787 Ang S29.C and P32.CD other bump:2.23195 Ang Q28.O and P32.CG other bump:2.36288 Ang K26.CD and Q28.NE2 other bump:2.54092 Ang K26.CB and Q28.OE1 other bump:3.1247 Ang K26.CD and Q28.CD other bump:2.85348 Ang N9.OD1 and E12.CD other bump:2.28032 Ang N9.OD1 and E12.CG other bump:2.4375 Ang N9.OD1 and E12.CB other bump:2.68278 Ang K2.CB and F8.CZ other bump:2.41348 Ang K2.CE and F8.CE1 other bump:2.83821 Ang K2.CB and F8.CE1 other bump:2.96882 Ang K2.CE and F8.CD1 T0129 97 :DSLSDWANQFLLGIGLAQPELAKE 1brwA 89 :DTTTLVLGPLVASVGVPVAKMSGR Fragment has 15 clashes (null) has 15 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 26 residues other bump:2.88667 Ang N9.CA and Q19.NE2 other bump:2.89301 Ang N9.C and Q19.NE2 other bump:2.22583 Ang N9.O and Q19.NE2 other bump:2.70254 Ang L12.CB and Q19.OE1 other bump:2.03369 Ang L12.CD2 and Q19.OE1 other bump:2.91281 Ang L13.CD2 and Q19.N other bump:2.20895 Ang L13.CD2 and L17.O other bump:2.76764 Ang L12.CG and L17.CD2 other bump:2.1185 Ang L12.CD1 and L17.CD2 other bump:2.18242 Ang D6.O and Q10.OE1 neighbor-bump: 2.88435 Ang W7.CD2 and A8.N other bump:2.69466 Ang L4.CD2 and W7.CZ2 other bump:2.9446 Ang L4.CA and W7.NE1 other bump:2.56943 Ang L4.CD2 and W7.NE1 other bump:2.88597 Ang L4.CD2 and W7.CE2 T0129 121 :KGEIGEAVDDLQDICQLGYDEDDN 1brwA 114 :LGHTGGTIDKLESVPGFHVEISKD Fragment has 17 clashes (null) has 17 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 26 residues other bump:1.84104 Ang L12.CA and Y20.OH other bump:2.28077 Ang L12.O and Y20.OH other bump:1.61188 Ang L12.C and Y20.OH other bump:2.16533 Ang Q13.N and Y20.OH other bump:1.55793 Ang L12.CB and Y20.OH other bump:3.05307 Ang L12.CA and Y20.CZ other bump:2.88198 Ang L12.C and Y20.CZ other bump:2.96821 Ang Q13.N and Y20.CZ other bump:2.19959 Ang L12.CB and Y20.CZ other bump:2.97828 Ang Q13.N and Y20.CE2 other bump:2.903 Ang V9.O and Y20.CE2 other bump:2.48933 Ang Q13.CG and Y20.CE2 other bump:2.55057 Ang L12.CB and Y20.CE1 other bump:2.43081 Ang L18.CD1 and Y20.CE1 other bump:2.95738 Ang L12.CD1 and Y20.CE1 other bump:3.02695 Ang Q13.CG and Y20.CD2 neighbor-bump: 2.30477 Ang G1.O and K2.CG Number of specific fragments= 3 total=311 Number of alignments=47 # Reading fragments from alignment file # T0129 read from /projects/compbio/experiments/casp5/t0129/1brwA/T0129-1brwA-local-adpstyle1.pw.a2m.gz # 1brwA read from /projects/compbio/experiments/casp5/t0129/1brwA/T0129-1brwA-local-adpstyle1.pw.a2m.gz # found chain 1brwA in template set T0129 13 :KSAGIGFNATELHGFLSGLLCGGLKDQSWLPLLYQFSNDNHAYPTGLVQPVTELYEQISQTLSDVEGFTFE 1brwA 10 :KRDGKALTKEEIEWIVRGYTNGDIPDYQMSALAMAIYFRGMTEEETAALTMAMVQSGEMLDLSSIRGVKVD Fragment has 58 clashes (null) has 58 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 73 residues other bump:2.62825 Ang F69.CE1 and F71.CZ other bump:2.6326 Ang F69.CD1 and F71.CZ other bump:2.58193 Ang F69.CD1 and F71.CE2 other bump:2.46015 Ang F69.CE1 and F71.CE1 other bump:3.08234 Ang F69.CZ and F71.CE1 other bump:2.9949 Ang F69.CD1 and F71.CD2 other bump:2.83679 Ang F69.CE1 and F71.CD1 other bump:2.52171 Ang E54.CD and E57.OE1 other bump:1.87171 Ang E54.OE1 and E57.OE1 other bump:2.92103 Ang E54.CD and E57.CD other bump:2.5786 Ang V52.CG1 and Y56.OH other bump:2.54731 Ang V52.CG1 and Y56.CZ other bump:2.74386 Ang V52.O and Y56.CE2 other bump:3.07767 Ang V52.C and Y56.CE2 other bump:1.92961 Ang V52.CG1 and Y56.CE2 other bump:2.15709 Ang V52.O and Y56.CD2 other bump:2.84261 Ang V52.C and Y56.CD2 other bump:3.04231 Ang V52.CG1 and Y56.CD2 other bump:2.54037 Ang L17.CD2 and E54.OE2 other bump:2.6437 Ang L17.CB and T53.CG2 other bump:2.77343 Ang L17.CG and T53.CG2 other bump:2.10688 Ang L17.CD1 and T53.CG2 other bump:2.29702 Ang L17.CD1 and T53.CB other bump:1.61302 Ang G47.O and P51.CD other bump:2.69728 Ang G47.C and P51.CD other bump:2.89998 Ang L48.C and P51.CD other bump:2.04928 Ang G47.O and P51.CG other bump:3.1854 Ang G47.C and P51.CG neighbor-bump: 1.69632 Ang D40.O and N41.CG neighbor-bump: 2.66016 Ang D40.C and N41.CG other bump:2.07558 Ang K2.O and D40.OD2 other bump:2.89097 Ang Y35.CE2 and N39.ND2 other bump:2.52369 Ang L33.CG and F37.CZ other bump:2.54778 Ang L33.CD1 and F37.CZ other bump:2.75177 Ang L33.CD2 and F37.CZ other bump:2.69204 Ang L33.CD1 and F37.CE2 other bump:2.80975 Ang L33.CG and F37.CE1 other bump:3.04516 Ang K2.CG and F37.CD2 other bump:2.56813 Ang S3.CA and Q36.NE2 other bump:2.44384 Ang S3.CB and Q36.NE2 other bump:3.00279 Ang W30.CZ3 and L34.CD2 other bump:2.93258 Ang W30.CH2 and L34.CD2 other bump:3.19871 Ang W30.CE3 and L34.CD2 other bump:3.06154 Ang W30.CZ2 and L34.CD2 other bump:2.17019 Ang Q28.O and P32.CD other bump:2.95447 Ang Q28.C and P32.CD other bump:3.13787 Ang S29.C and P32.CD other bump:2.23195 Ang Q28.O and P32.CG other bump:2.36288 Ang K26.CD and Q28.NE2 other bump:2.54092 Ang K26.CB and Q28.OE1 other bump:3.1247 Ang K26.CD and Q28.CD other bump:2.85348 Ang N9.OD1 and E12.CD other bump:2.28032 Ang N9.OD1 and E12.CG other bump:2.4375 Ang N9.OD1 and E12.CB other bump:2.68278 Ang K2.CB and F8.CZ other bump:2.83821 Ang K2.CB and F8.CE1 other bump:2.41348 Ang K2.CE and F8.CE1 other bump:2.96882 Ang K2.CE and F8.CD1 Number of specific fragments= 1 total=312 Number of alignments=48 # Reading fragments from alignment file # T0129 read from /projects/compbio/experiments/casp5/t0129/1go3F/T0129-1go3F-2track-local-adpstyle5.pw.a2m.gz # 1go3F read from /projects/compbio/experiments/casp5/t0129/1go3F/T0129-1go3F-2track-local-adpstyle5.pw.a2m.gz # found chain 1go3F in template set T0129 115 :PELAKEKGEIGEAVDDLQDICQL 1go3F 25 :AQIGELSYEQGCALDYLQKFAKL Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 25 residues other bump:1.67435 Ang D17.OD1 and I21.CD1 other bump:2.82692 Ang K8.CD and I11.CD1 other bump:3.09034 Ang E7.CD and I11.CG2 other bump:2.21327 Ang E7.OE1 and I11.CG2 T0129 144 :NEEELAEALEEIIE 1go3F 48 :DKEEAKKLVEELIS Fragment has 14 clashes (null) has 14 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 16 residues other bump:1.90762 Ang E12.O and E15.OE2 other bump:1.94619 Ang E12.CA and E15.OE2 other bump:2.12475 Ang E12.C and E15.OE2 other bump:2.3895 Ang E12.CB and E15.OE2 other bump:1.99862 Ang E12.O and E15.OE1 other bump:1.63478 Ang E11.O and E15.OE1 other bump:2.22261 Ang E11.C and E15.OE1 other bump:2.30914 Ang E12.N and E15.OE1 other bump:1.80836 Ang E12.CA and E15.OE1 other bump:1.87005 Ang E12.C and E15.OE1 other bump:1.61148 Ang E12.O and E15.CD other bump:2.08926 Ang E12.CA and E15.CD other bump:2.03649 Ang E12.C and E15.CD other bump:2.42692 Ang E12.O and E15.CG Number of specific fragments= 2 total=314 Number of alignments=49 # Reading fragments from alignment file # T0129 read from /projects/compbio/experiments/casp5/t0129/1go3F/T0129-1go3F-2track-local-adpstyle1.pw.a2m.gz # 1go3F read from /projects/compbio/experiments/casp5/t0129/1go3F/T0129-1go3F-2track-local-adpstyle1.pw.a2m.gz # found chain 1go3F in template set T0129 114 :QPELAKEKGEIGEAVDDLQDICQL 1go3F 24 :RAQIGELSYEQGCALDYLQKFAKL Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 26 residues other bump:1.67435 Ang D18.OD1 and I22.CD1 other bump:2.82692 Ang K9.CD and I12.CD1 other bump:3.09034 Ang E8.CD and I12.CG2 other bump:2.21327 Ang E8.OE1 and I12.CG2 neighbor-bump: 2.52209 Ang Q2.N and P3.CD self-bump: 1.36687 Ang P3.N and P3.CD T0129 144 :NEEELAEALEEII 1go3F 48 :DKEEAKKLVEELI Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues Number of specific fragments= 2 total=316 Number of alignments=50 # command:# Reading fragments from alignment file # T0129 read from T0129-t2k-2track-undertaker.a2m # 1brwA read from T0129-t2k-2track-undertaker.a2m # found chain 1brwA in template set T0129 11 :QLKSAGIGFNATELHGFLSGLLCGGLKDQSWLPLLYQFSNDNHAYPTGLVQPVTELYEQISQTLSDVEGFTFELGLTEDEN 1brwA 8 :AKKRDGKALTKEEIEWIVRGYTNGDIPDYQMSALAMAIYFRGMTEEETAALTMAMVQSGEMLDLSSIRGVKVDKHSTGGVG Fragment has 58 clashes (null) has 58 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 83 residues other bump:2.62825 Ang F71.CE1 and F73.CZ other bump:2.6326 Ang F71.CD1 and F73.CZ other bump:2.58193 Ang F71.CD1 and F73.CE2 other bump:2.46015 Ang F71.CE1 and F73.CE1 other bump:3.08234 Ang F71.CZ and F73.CE1 other bump:2.9949 Ang F71.CD1 and F73.CD2 other bump:2.83679 Ang F71.CE1 and F73.CD1 other bump:2.52171 Ang E56.CD and E59.OE1 other bump:1.87171 Ang E56.OE1 and E59.OE1 other bump:2.92103 Ang E56.CD and E59.CD other bump:2.5786 Ang V54.CG1 and Y58.OH other bump:2.54731 Ang V54.CG1 and Y58.CZ other bump:2.74386 Ang V54.O and Y58.CE2 other bump:3.07767 Ang V54.C and Y58.CE2 other bump:1.92961 Ang V54.CG1 and Y58.CE2 other bump:2.15709 Ang V54.O and Y58.CD2 other bump:2.84261 Ang V54.C and Y58.CD2 other bump:3.04231 Ang V54.CG1 and Y58.CD2 other bump:2.54037 Ang L19.CD2 and E56.OE2 other bump:2.6437 Ang L19.CB and T55.CG2 other bump:2.77343 Ang L19.CG and T55.CG2 other bump:2.10688 Ang L19.CD1 and T55.CG2 other bump:2.29702 Ang L19.CD1 and T55.CB other bump:1.61302 Ang G49.O and P53.CD other bump:2.69728 Ang G49.C and P53.CD other bump:2.89998 Ang L50.C and P53.CD other bump:2.04928 Ang G49.O and P53.CG other bump:3.1854 Ang G49.C and P53.CG neighbor-bump: 1.69632 Ang D42.O and N43.CG neighbor-bump: 2.66016 Ang D42.C and N43.CG other bump:2.07558 Ang K4.O and D42.OD2 other bump:2.89097 Ang Y37.CE2 and N41.ND2 other bump:2.52369 Ang L35.CG and F39.CZ other bump:2.54778 Ang L35.CD1 and F39.CZ other bump:2.75177 Ang L35.CD2 and F39.CZ other bump:2.69204 Ang L35.CD1 and F39.CE2 other bump:2.80975 Ang L35.CG and F39.CE1 other bump:3.04516 Ang K4.CG and F39.CD2 other bump:2.56813 Ang S5.CA and Q38.NE2 other bump:2.44384 Ang S5.CB and Q38.NE2 other bump:3.00279 Ang W32.CZ3 and L36.CD2 other bump:2.93258 Ang W32.CH2 and L36.CD2 other bump:3.19871 Ang W32.CE3 and L36.CD2 other bump:3.06154 Ang W32.CZ2 and L36.CD2 other bump:2.17019 Ang Q30.O and P34.CD other bump:2.95447 Ang Q30.C and P34.CD other bump:3.13787 Ang S31.C and P34.CD other bump:2.23195 Ang Q30.O and P34.CG other bump:2.36288 Ang K28.CD and Q30.NE2 other bump:2.54092 Ang K28.CB and Q30.OE1 other bump:3.1247 Ang K28.CD and Q30.CD other bump:2.85348 Ang N11.OD1 and E14.CD other bump:2.28032 Ang N11.OD1 and E14.CG other bump:2.4375 Ang N11.OD1 and E14.CB other bump:2.68278 Ang K4.CB and F10.CZ other bump:2.83821 Ang K4.CB and F10.CE1 other bump:2.41348 Ang K4.CE and F10.CE1 other bump:2.96882 Ang K4.CE and F10.CD1 T0129 95 :Q 1brwA 91 :T Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 3 residues T0129 100 :SDWANQFLLGIGLA 1brwA 92 :TLVLGPLVASVGVP Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 16 residues other bump:2.91281 Ang L10.CD2 and G16.N other bump:2.20895 Ang L10.CD2 and L14.O other bump:2.76764 Ang L9.CG and L14.CD2 other bump:2.1185 Ang L9.CD1 and L14.CD2 other bump:2.18242 Ang D3.O and Q7.OE1 neighbor-bump: 2.88435 Ang W4.CD2 and A5.N T0129 114 :QPELAKEKGEIGE 1brwA 111 :GRGLGHTGGTIDK Fragment has 12 clashes (null) has 12 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 15 residues other bump:2.88941 Ang E4.CG and G10.CA other bump:1.83099 Ang E4.CG and G10.N other bump:2.57258 Ang E4.CD and G10.N other bump:3.19969 Ang E4.CB and G10.N other bump:2.1598 Ang E4.CG and K9.C other bump:3.03745 Ang E4.CD and K9.C other bump:3.29596 Ang E4.CB and K9.C other bump:2.61192 Ang E4.OE2 and K9.CB other bump:2.3592 Ang E4.CG and K9.CA other bump:2.663 Ang E4.CD and K9.CA other bump:2.74346 Ang E4.OE2 and K9.CA self-bump: 1.28113 Ang A6.CA and A6.CB Number of specific fragments= 4 total=320 Number of alignments=51 # 1ukz read from T0129-t2k-2track-undertaker.a2m # found chain 1ukz in training set T0129 27 :FLS 1ukz 53 :AEQ Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 5 residues T0129 35 :GLKDQSWLPLLYQFSNDNHAYPTGLVQPV 1ukz 56 :GRAGSQYGELIKNCIKEGQIVPQEITLAL Fragment has 82 clashes (null) has 82 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 31 residues other bump:2.98436 Ang L26.C and P29.CD other bump:1.75151 Ang G25.O and P29.CD other bump:2.7364 Ang G25.C and P29.CD other bump:1.81626 Ang G25.O and P29.CG other bump:3.03199 Ang G25.C and P29.CG other bump:2.22336 Ang W8.CE2 and L26.CD2 other bump:3.10183 Ang W8.CE3 and L26.CD2 other bump:2.5345 Ang W8.CZ2 and L26.CD2 other bump:3.29539 Ang W8.CZ3 and L26.CD2 other bump:3.04244 Ang W8.CH2 and L26.CD2 other bump:2.76512 Ang W8.NE1 and L26.CD2 other bump:2.33348 Ang L12.CA and Y22.OH other bump:1.5977 Ang L12.C and Y22.OH other bump:0.833577 Ang L12.O and Y22.OH other bump:2.37368 Ang L12.CA and Y22.CZ other bump:2.9525 Ang L12.CB and Y22.CZ other bump:2.47829 Ang L12.C and Y22.CZ other bump:2.00362 Ang L12.O and Y22.CZ other bump:2.95467 Ang F15.CB and Y22.CZ other bump:2.89974 Ang F15.CD2 and Y22.CE2 other bump:2.22118 Ang L12.CA and Y22.CE1 other bump:2.8018 Ang L12.C and Y22.CE1 other bump:2.39862 Ang F15.CB and Y22.CE1 other bump:2.92591 Ang L12.CD2 and Y22.CD1 other bump:2.70979 Ang F15.CB and Y22.CD1 other bump:2.81618 Ang F15.CD2 and Y22.CG other bump:2.64173 Ang F15.CE1 and Y22.N other bump:2.74398 Ang F15.CE2 and Y22.N other bump:2.46308 Ang F15.CZ and Y22.N other bump:2.88572 Ang F15.CD1 and A21.C other bump:2.10529 Ang F15.CE1 and A21.C other bump:3.24628 Ang F15.CE2 and A21.C other bump:2.35946 Ang F15.CZ and A21.C other bump:2.03478 Ang F15.CE1 and A21.CA other bump:3.12632 Ang F15.CE2 and A21.CA other bump:1.8609 Ang F15.CZ and A21.CA other bump:2.82222 Ang F15.CD1 and A21.N other bump:1.50353 Ang F15.CE1 and A21.N other bump:1.96041 Ang F15.CZ and A21.N other bump:3.12301 Ang F15.CG and H20.C other bump:2.24699 Ang F15.CD1 and H20.C other bump:1.26515 Ang F15.CE1 and H20.C other bump:2.74367 Ang F15.CE2 and H20.C other bump:1.68992 Ang F15.CZ and H20.C other bump:2.44078 Ang F15.CG and H20.O other bump:2.14164 Ang F15.CD1 and H20.O other bump:2.2224 Ang F15.CD2 and H20.O other bump:1.51397 Ang F15.CE1 and H20.O other bump:1.63662 Ang F15.CE2 and H20.O other bump:1.16186 Ang F15.CZ and H20.O other bump:2.7605 Ang F15.CG and H20.NE2 other bump:2.83613 Ang F15.CD1 and H20.NE2 other bump:1.6304 Ang F15.CA and H20.NE2 other bump:1.9707 Ang F15.CB and H20.NE2 other bump:2.91628 Ang F15.CD1 and H20.CE1 other bump:2.92234 Ang F15.CA and H20.CE1 other bump:2.80967 Ang F15.CB and H20.CE1 other bump:2.57248 Ang F15.CD1 and H20.ND1 other bump:2.6087 Ang F15.CG and H20.CD2 other bump:2.42262 Ang F15.CD1 and H20.CD2 other bump:1.81072 Ang F15.CA and H20.CD2 other bump:2.48022 Ang F15.O and H20.CD2 other bump:2.49841 Ang F15.C and H20.CD2 other bump:2.44941 Ang F15.CB and H20.CD2 other bump:3.07243 Ang F15.CG and H20.CG other bump:2.21486 Ang F15.CD1 and H20.CG other bump:3.114 Ang F15.CA and H20.CG other bump:2.88595 Ang F15.CD1 and H20.CB other bump:2.96865 Ang F15.CE1 and H20.CB other bump:2.88414 Ang F15.CD1 and H20.CA other bump:2.47496 Ang F15.CE1 and H20.CA other bump:3.17034 Ang F15.CZ and H20.CA other bump:2.41908 Ang G1.C and L9.CD2 other bump:1.53092 Ang G1.O and L9.CD2 other bump:1.72333 Ang L3.CB and Q6.NE2 other bump:2.49976 Ang L3.CA and Q6.NE2 other bump:2.27849 Ang L3.CB and Q6.CD other bump:3.02078 Ang L3.CG and Q6.CD other bump:2.8539 Ang L3.CD2 and Q6.CD other bump:2.64619 Ang L3.CB and Q6.CG other bump:2.84251 Ang L3.CG and Q6.CG other bump:2.76268 Ang L3.CD2 and Q6.CG T0129 66 :LYEQISQTLSDVEG 1ukz 85 :LRNAISDNVKANKH Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 16 residues other bump:2.60378 Ang T9.CG2 and E14.CB neighbor-bump: 2.65262 Ang D12.C and V13.CB other bump:2.72056 Ang T9.CA and D12.OD1 other bump:1.53664 Ang T9.O and D12.OD1 other bump:2.38422 Ang T9.C and D12.OD1 other bump:3.16792 Ang T9.CA and D12.CG other bump:3.25766 Ang T9.C and D12.CG T0129 83 :ELGLTEDENVFTQADSLSDWA 1ukz 99 :KFLIDGFPRKMDQAISFERDI Fragment has 25 clashes (null) has 25 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 23 residues other bump:1.77486 Ang D16.O and D20.OD1 other bump:2.58898 Ang D16.C and D20.OD1 other bump:2.34878 Ang S17.CA and D20.OD1 other bump:2.24035 Ang S17.O and D20.OD1 other bump:2.40454 Ang S17.C and D20.OD1 other bump:2.56653 Ang E9.CG and A15.CA other bump:2.68807 Ang E9.CD and A15.CA other bump:2.93209 Ang E9.OE1 and A15.CA other bump:2.97273 Ang E9.CG and A15.N other bump:2.28705 Ang E9.CD and A15.N other bump:2.12059 Ang E9.OE1 and A15.N other bump:2.23317 Ang E9.OE2 and Q14.C other bump:2.30897 Ang E9.CD and Q14.C other bump:2.42794 Ang E9.OE1 and Q14.C other bump:2.11626 Ang E9.OE2 and Q14.O other bump:2.63905 Ang E9.CD and Q14.O other bump:2.814 Ang E9.CD and Q14.CG other bump:2.06085 Ang E9.OE1 and Q14.CG other bump:3.08672 Ang V11.CG2 and Q14.CG other bump:2.64682 Ang E9.OE2 and Q14.CB other bump:3.02444 Ang E9.CD and Q14.CB other bump:2.69536 Ang E9.OE1 and Q14.CB other bump:2.92892 Ang E9.OE2 and Q14.CA other bump:3.15273 Ang E9.CD and Q14.CA other bump:2.84 Ang E9.OE1 and Q14.CA T0129 113 :AQPE 1ukz 120 :VESK Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 6 residues self-bump: 1.39038 Ang E5.CA and E5.CB T0129 117 :LAKEKGEIGEAVDDLQDICQLGYDEDDNEEELAEALEEIIEYV 1ukz 125 :ILFFDCPEDIMLERLLERGKTSGRSDDNIESIKKRFNTFKETS Fragment has 14 clashes (null) has 14 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 45 residues other bump:3.04029 Ang L16.CD1 and L33.CD2 other bump:2.49461 Ang Q17.OE1 and L33.CD1 other bump:2.43327 Ang Q17.CG and E30.OE2 other bump:1.43866 Ang Q17.CD and E30.OE2 other bump:1.67918 Ang Q17.OE1 and E30.OE2 other bump:1.87248 Ang Q17.NE2 and E30.OE2 other bump:2.66602 Ang Q17.CD and E30.CD other bump:2.49395 Ang Q17.OE1 and E30.CD other bump:2.57974 Ang C20.SG and D28.C other bump:1.80608 Ang C20.SG and D28.O other bump:2.53179 Ang C20.CB and D28.O other bump:2.97556 Ang C20.SG and D28.CA other bump:1.84862 Ang E11.O and D14.OD1 other bump:2.66011 Ang E11.C and D14.OD1 T0129 162 :IAMLFYS 1ukz 168 :MPVIEYF Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 9 residues Number of specific fragments= 7 total=327 Number of alignments=52 # command:CPU_time= 41530 msec, elapsed time= 43380.8 msec) # command:# Prefix for output files set to decoys/ # command:# created conformation for T0129 from sequence in target chain replacing old conformation. # command:# naming current conformation T0129-rand # command:# Prefix for input files set to # command:# Prefix for input files set to # command:# Removing conformation named T0129-rand # command:# Reading conformation from PDB file decoys/T0129-try41-opt-moved.pdb # command:# naming current conformation T0129.try42 # command:# CostConform Cost function not defined---use SetCost before CostConform # command:CPU_time= 41720 msec, elapsed time= 43585.6 msec) # command:# Will now start reporting costs to decoys/undertaker-try42.rdb # command:# CostConform Cost function not defined---use SetCost before CostConform # command:CPU_time= 41720 msec, elapsed time= 43586.8 msec) # command:# Prefix for input files set to # command:# Reading fragments from alignment file # T0129 read from T0129.t2k.frag # 1cpcL.1.0 read from T0129.t2k.frag # found chain 1cpcL in template set T0129 1 :MLISHSDLN 1cpcL 1 :MLDAFAKVV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 10 residues Number of specific fragments= 1 total=328 # 1cpcB.1.0 read from T0129.t2k.frag # found chain 1cpcB in template set T0129 1 :MLISHSDLN 1cpcB 1 :MLDAFAKVV Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 10 residues neighbor-bump: 2.41871 Ang I3.CG2 and S4.N Number of specific fragments= 1 total=329 # 1atiA.1.0 read from T0129.t2k.frag # found chain 1atiA in template set T0129 1 :MLISHSDLN 1atiA 1 :AASSLDELV Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 10 residues other bump:2.45958 Ang L2.CD2 and L8.CD1 other bump:2.04387 Ang L2.CD2 and L8.CG Number of specific fragments= 1 total=330 # 1atiB.1.0 read from T0129.t2k.frag # found chain 1atiB in template set T0129 1 :MLISHSDLN 1atiB 1 :AASSLDELV Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 10 residues other bump:2.52933 Ang L2.CD2 and L8.CD1 other bump:2.06931 Ang L2.CD2 and L8.CG Number of specific fragments= 1 total=331 # 1jj2L.1.1 read from T0129.t2k.frag # found chain 1jj2L in template set T0129 1 :MLISHSDLN 1jj2L 2 :RSAYSYIRE Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 10 residues Number of specific fragments= 1 total=332 # 1cpcB.1.1 read from T0129.t2k.frag # found chain 1cpcB in template set T0129 1 :MLISHSDLN 1cpcB 2 :LDAFAKVVS Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 10 residues other bump:2.36172 Ang M1.CE and S6.CA Number of specific fragments= 1 total=333 # 1atiA.2.2 read from T0129.t2k.frag # found chain 1atiA in template set T0129 2 :LISHSDLNQ 1atiA 3 :SSLDELVAL Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.36061 Ang I3.CG2 and S6.OG other bump:2.88717 Ang I3.CG2 and S6.N Number of specific fragments= 1 total=334 # 1atiB.2.2 read from T0129.t2k.frag # found chain 1atiB in template set T0129 2 :LISHSDLNQ 1atiB 3 :SSLDELVAL Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.30766 Ang I3.CG2 and S6.OG other bump:2.87716 Ang I3.CG2 and S6.N Number of specific fragments= 1 total=335 # 1cpcB.2.2 read from T0129.t2k.frag # found chain 1cpcB in template set T0129 2 :LISHSDLNQ 1cpcB 3 :DAFAKVVSQ Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=336 # 1cpcL.2.2 read from T0129.t2k.frag # found chain 1cpcL in template set T0129 2 :LISHSDLNQ 1cpcL 3 :DAFAKVVSQ Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=337 # 1atiA.2.1 read from T0129.t2k.frag # found chain 1atiA in template set T0129 2 :LISHSDLNQ 1atiA 2 :ASSLDELVA Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.84518 Ang L2.CD1 and L8.CD2 Number of specific fragments= 1 total=338 # 1jj2L.2.2 read from T0129.t2k.frag # found chain 1jj2L in template set T0129 2 :LISHSDLNQ 1jj2L 3 :SAYSYIREA Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.94331 Ang L2.CB and H5.CD2 Number of specific fragments= 1 total=339 # 1atiA.3.3 read from T0129.t2k.frag # found chain 1atiA in template set T0129 3 :ISHSDLNQQ 1atiA 4 :SLDELVALC Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=340 # 1atiB.3.3 read from T0129.t2k.frag # found chain 1atiB in template set T0129 3 :ISHSDLNQQ 1atiB 4 :SLDELVALC Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=341 # 1cpcB.3.3 read from T0129.t2k.frag # found chain 1cpcB in template set T0129 3 :ISHSDLNQQ 1cpcB 4 :AFAKVVSQA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=342 # 1cpcL.3.3 read from T0129.t2k.frag # found chain 1cpcL in template set T0129 3 :ISHSDLNQQ 1cpcL 4 :AFAKVVSQA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=343 # 1eia.3.3 read from T0129.t2k.frag # found chain 1eia in template set T0129 3 :ISHSDLNQQ 1eia 19 :GYTTWVNTI Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:3.27061 Ang N8.C and G11.N self-bump: 1.28599 Ang S3.CA and S3.CB Number of specific fragments= 1 total=344 # 1phnB.3.3 read from T0129.t2k.frag # found chain 1phnB in template set T0129 3 :ISHSDLNQQ 1phnB 4 :AFAKVVAQA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=345 # 1atiA.4.4 read from T0129.t2k.frag # found chain 1atiA in template set T0129 4 :SHSDLNQQL 1atiA 5 :LDELVALCK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=346 # 1atiB.4.4 read from T0129.t2k.frag # found chain 1atiB in template set T0129 4 :SHSDLNQQL 1atiB 5 :LDELVALCK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=347 # 1cpcB.4.4 read from T0129.t2k.frag # found chain 1cpcB in template set T0129 4 :SHSDLNQQL 1cpcB 5 :FAKVVSQAD Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=348 # 1cpcL.4.4 read from T0129.t2k.frag # found chain 1cpcL in template set T0129 4 :SHSDLNQQL 1cpcL 5 :FAKVVSQAD Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=349 # 1eia.4.4 read from T0129.t2k.frag # found chain 1eia in template set T0129 4 :SHSDLNQQL 1eia 20 :YTTWVNTIQ Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.68691 Ang L6.CD2 and L10.CD1 other bump:3.27061 Ang N7.C and L10.N self-bump: 1.286 Ang S2.CA and S2.CB Number of specific fragments= 1 total=350 # 1phnB.4.4 read from T0129.t2k.frag # found chain 1phnB in template set T0129 4 :SHSDLNQQL 1phnB 5 :FAKVVAQAD Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=351 # 1cpcB.5.5 read from T0129.t2k.frag # found chain 1cpcB in template set T0129 5 :HSDLNQQLK 1cpcB 6 :AKVVSQADA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=352 # 1cpcL.5.5 read from T0129.t2k.frag # found chain 1cpcL in template set T0129 5 :HSDLNQQLK 1cpcL 6 :AKVVSQADA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=353 # 1atiA.5.5 read from T0129.t2k.frag # found chain 1atiA in template set T0129 5 :HSDLNQQLK 1atiA 6 :DELVALCKR Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=354 # 1atiB.5.5 read from T0129.t2k.frag # found chain 1atiB in template set T0129 5 :HSDLNQQLK 1atiB 6 :DELVALCKR Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=355 # 1eia.5.5 read from T0129.t2k.frag # found chain 1eia in template set T0129 5 :HSDLNQQLK 1eia 21 :TTWVNTIQT Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.65526 Ang L9.C and K10.O other bump:2.68693 Ang L5.CD2 and L9.CD1 other bump:3.27061 Ang N6.C and L9.N Number of specific fragments= 1 total=356 # 1phnB.5.5 read from T0129.t2k.frag # found chain 1phnB in template set T0129 5 :HSDLNQQLK 1phnB 6 :AKVVAQADA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=357 # 1cpcB.6.6 read from T0129.t2k.frag # found chain 1cpcB in template set T0129 6 :SDLNQQLKS 1cpcB 7 :KVVSQADAR Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=358 # 1cpcL.6.6 read from T0129.t2k.frag # found chain 1cpcL in template set T0129 6 :SDLNQQLKS 1cpcL 7 :KVVSQADAR Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=359 # 1atiA.6.6 read from T0129.t2k.frag # found chain 1atiA in template set T0129 6 :SDLNQQLKS 1atiA 7 :ELVALCKRR Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=360 # 1atiB.6.6 read from T0129.t2k.frag # found chain 1atiB in template set T0129 6 :SDLNQQLKS 1atiB 7 :ELVALCKRR Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=361 # 1i9zA.6.6 read from T0129.t2k.frag # found chain 1i9zA in training set T0129 6 :SDLNQQLKS 1i9zA 540 :YVNHELRKR Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=362 # 1i9yA.6.6 read from T0129.t2k.frag # found chain 1i9yA in template set T0129 6 :SDLNQQLKS 1i9yA 540 :YVNHELRKR Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=363 # 1i9zA.7.7 read from T0129.t2k.frag # found chain 1i9zA in training set T0129 7 :DLNQQLKSA 1i9zA 541 :VNHELRKRE Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=364 # 1cpcB.7.7 read from T0129.t2k.frag # found chain 1cpcB in template set T0129 7 :DLNQQLKSA 1cpcB 8 :VVSQADARG Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.18057 Ang S9.O and A10.CB neighbor-bump: 2.47562 Ang S9.C and A10.CB Number of specific fragments= 1 total=365 # 1cpcL.7.7 read from T0129.t2k.frag # found chain 1cpcL in template set T0129 7 :DLNQQLKSA 1cpcL 8 :VVSQADARG Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.6496 Ang S9.C and A10.CB Number of specific fragments= 1 total=366 # 1i9yA.7.7 read from T0129.t2k.frag # found chain 1i9yA in template set T0129 7 :DLNQQLKSA 1i9yA 541 :VNHELRKRE Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=367 # 1atiA.7.7 read from T0129.t2k.frag # found chain 1atiA in template set T0129 7 :DLNQQLKSA 1atiA 8 :LVALCKRRG Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.17881 Ang S9.O and A10.CB neighbor-bump: 2.40462 Ang S9.C and A10.CB Number of specific fragments= 1 total=368 # 1atiB.7.7 read from T0129.t2k.frag # found chain 1atiB in template set T0129 7 :DLNQQLKSA 1atiB 8 :LVALCKRRG Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.11789 Ang S9.O and A10.CB neighbor-bump: 2.37533 Ang S9.C and A10.CB Number of specific fragments= 1 total=369 # 1i9zA.8.8 read from T0129.t2k.frag # found chain 1i9zA in training set T0129 8 :LNQQLKSAG 1i9zA 542 :NHELRKREN Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=370 # 1cpcB.8.8 read from T0129.t2k.frag # found chain 1cpcB in template set T0129 8 :LNQQLKSAG 1cpcB 9 :VSQADARGE Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.18057 Ang S8.O and A9.CB neighbor-bump: 2.47562 Ang S8.C and A9.CB Number of specific fragments= 1 total=371 # 1i9yA.8.8 read from T0129.t2k.frag # found chain 1i9yA in template set T0129 8 :LNQQLKSAG 1i9yA 542 :NHELRKREN Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=372 # 1cpcL.8.8 read from T0129.t2k.frag # found chain 1cpcL in template set T0129 8 :LNQQLKSAG 1cpcL 9 :VSQADARGE Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.64961 Ang S8.C and A9.CB Number of specific fragments= 1 total=373 # 1atiA.8.8 read from T0129.t2k.frag # found chain 1atiA in template set T0129 8 :LNQQLKSAG 1atiA 9 :VALCKRRGF Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.1788 Ang S8.O and A9.CB neighbor-bump: 2.40461 Ang S8.C and A9.CB Number of specific fragments= 1 total=374 # 1atiB.8.8 read from T0129.t2k.frag # found chain 1atiB in template set T0129 8 :LNQQLKSAG 1atiB 9 :VALCKRRGF Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.1179 Ang S8.O and A9.CB neighbor-bump: 2.37533 Ang S8.C and A9.CB Number of specific fragments= 1 total=375 # 1atiA.9.9 read from T0129.t2k.frag # found chain 1atiA in template set T0129 9 :NQQLKSAGI 1atiA 10 :ALCKRRGFI Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.52578 Ang Q4.NE2 and I10.CD1 other bump:3.1311 Ang Q4.NE2 and I10.CG1 neighbor-bump: 2.40461 Ang S7.C and A8.CB neighbor-bump: 2.1788 Ang S7.O and A8.CB Number of specific fragments= 1 total=376 # 1atiB.9.9 read from T0129.t2k.frag # found chain 1atiB in template set T0129 9 :NQQLKSAGI 1atiB 10 :ALCKRRGFI Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.46887 Ang Q4.NE2 and I10.CD1 other bump:3.07972 Ang Q4.NE2 and I10.CG1 neighbor-bump: 2.1179 Ang S7.O and A8.CB neighbor-bump: 2.37533 Ang S7.C and A8.CB Number of specific fragments= 1 total=377 # 1i9zA.9.9 read from T0129.t2k.frag # found chain 1i9zA in training set T0129 9 :NQQLKSAGI 1i9zA 543 :HELRKRENE Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=378 # 1cpcB.9.9 read from T0129.t2k.frag # found chain 1cpcB in template set T0129 9 :NQQLKSAGI 1cpcB 10 :SQADARGEY Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.18057 Ang S7.O and A8.CB neighbor-bump: 2.47562 Ang S7.C and A8.CB Number of specific fragments= 1 total=379 # 1cpcL.9.9 read from T0129.t2k.frag # found chain 1cpcL in template set T0129 9 :NQQLKSAGI 1cpcL 10 :SQADARGEY Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:3.15974 Ang Q4.CD and G11.CA other bump:2.20781 Ang Q4.NE2 and G11.CA neighbor-bump: 2.64961 Ang S7.C and A8.CB Number of specific fragments= 1 total=380 # 1i9yA.9.9 read from T0129.t2k.frag # found chain 1i9yA in template set T0129 9 :NQQLKSAGI 1i9yA 543 :HELRKRENE Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=381 # 1atiA.10.10 read from T0129.t2k.frag # found chain 1atiA in template set T0129 10 :QQLKSAGIG 1atiA 11 :LCKRRGFIF Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.52577 Ang Q3.NE2 and I9.CD1 other bump:3.13109 Ang Q3.NE2 and I9.CG1 neighbor-bump: 2.1788 Ang S6.O and A7.CB neighbor-bump: 2.40461 Ang S6.C and A7.CB Number of specific fragments= 1 total=382 # 1atiB.10.10 read from T0129.t2k.frag # found chain 1atiB in template set T0129 10 :QQLKSAGIG 1atiB 11 :LCKRRGFIF Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.46887 Ang Q3.NE2 and I9.CD1 other bump:3.07972 Ang Q3.NE2 and I9.CG1 neighbor-bump: 2.1179 Ang S6.O and A7.CB neighbor-bump: 2.37533 Ang S6.C and A7.CB Number of specific fragments= 1 total=383 # 1octC.10.11 read from T0129.t2k.frag # found chain 1octC in template set T0129 10 :QQLKSAGIG 1octC 16 :FKQRRIKLG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=384 # 1jsxA.10.6 read from T0129.t2k.frag # found chain 1jsxA in template set T0129 10 :QQLKSAGIG 1jsxA 7 :LLLKDAGIS Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=385 # 1au7A.10.11 read from T0129.t2k.frag # found chain 1au7A in template set T0129 10 :QQLKSAGIG 1au7A 16 :FKVRRIKLG Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.542 Ang K5.O and I9.CD1 self-bump: 1.38815 Ang S6.CA and S6.CB Number of specific fragments= 1 total=386 # 1i9zA.10.10 read from T0129.t2k.frag # found chain 1i9zA in training set T0129 10 :QQLKSAGIG 1i9zA 544 :ELRKRENEF Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.87589 Ang S6.CB and I9.CD1 Number of specific fragments= 1 total=387 # 1octC.11.12 read from T0129.t2k.frag # found chain 1octC in template set T0129 11 :QLKSAGIGF 1octC 17 :KQRRIKLGF Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=388 # 1jsxA.11.7 read from T0129.t2k.frag # found chain 1jsxA in template set T0129 11 :QLKSAGIGF 1jsxA 8 :LLKDAGISL Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.60766 Ang I8.CG2 and F10.CE1 neighbor-bump: 2.20967 Ang G9.O and F10.CD1 Number of specific fragments= 1 total=389 # 1au7A.11.12 read from T0129.t2k.frag # found chain 1au7A in template set T0129 11 :QLKSAGIGF 1au7A 17 :KVRRIKLGY Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.92222 Ang I8.CG2 and F10.CE1 other bump:2.542 Ang K4.O and I8.CD1 self-bump: 1.38815 Ang S5.CA and S5.CB Number of specific fragments= 1 total=390 # 1atiA.11.11 read from T0129.t2k.frag # found chain 1atiA in template set T0129 11 :QLKSAGIGF 1atiA 12 :CKRRGFIFQ Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.52578 Ang Q2.NE2 and I8.CD1 other bump:3.1311 Ang Q2.NE2 and I8.CG1 neighbor-bump: 2.1788 Ang S5.O and A6.CB neighbor-bump: 2.40461 Ang S5.C and A6.CB Number of specific fragments= 1 total=391 # 1atiB.11.11 read from T0129.t2k.frag # found chain 1atiB in template set T0129 11 :QLKSAGIGF 1atiB 12 :CKRRGFIFQ Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.46887 Ang Q2.NE2 and I8.CD1 other bump:3.07972 Ang Q2.NE2 and I8.CG1 neighbor-bump: 2.1179 Ang S5.O and A6.CB neighbor-bump: 2.37533 Ang S5.C and A6.CB Number of specific fragments= 1 total=392 # 1h67A.11.11 read from T0129.t2k.frag # found chain 1h67A in template set T0129 11 :QLKSAGIGF 1h67A 38 :IEGATGRRI Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.24759 Ang L3.CG and F10.CE2 other bump:2.17968 Ang L3.CD2 and F10.CE2 other bump:2.17213 Ang L3.CG and F10.CD2 other bump:2.49305 Ang L3.CD1 and F10.CD2 other bump:1.8454 Ang L3.CD2 and F10.CD2 other bump:2.69019 Ang L3.CD2 and F10.CG other bump:2.30936 Ang L3.CD2 and I8.O Number of specific fragments= 1 total=393 # 2prgA.12.14 read from T0129.t2k.frag # found chain 2prgA in template set T0129 12 :LKSAGIGFN 2prgA 221 :SYIKSFPLT Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=394 # 1prgA.12.14 read from T0129.t2k.frag # found chain 1prgA in template set T0129 12 :LKSAGIGFN 1prgA 221 :SYIKSFPLT Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=395 # 1fw9A.12.12 read from T0129.t2k.frag # found chain 1fw9A in training set T0129 12 :LKSAGIGFN 1fw9A 13 :YSKEIPALD Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.85831 Ang I7.CB and F9.CZ other bump:1.67284 Ang I7.CG2 and F9.CZ other bump:2.41238 Ang I7.CG2 and F9.CE2 other bump:2.46859 Ang I7.CB and F9.CE1 other bump:1.30104 Ang I7.CG2 and F9.CE1 other bump:3.08366 Ang I7.CA and F9.CE1 other bump:2.78597 Ang I7.CG2 and F9.CD2 other bump:1.91198 Ang I7.CG2 and F9.CD1 other bump:2.59886 Ang I7.O and F9.CD1 other bump:2.59977 Ang I7.CG2 and F9.CG Number of specific fragments= 1 total=396 # 1octC.12.13 read from T0129.t2k.frag # found chain 1octC in template set T0129 12 :LKSAGIGFN 1octC 18 :QRRIKLGFT Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=397 # 1jsxA.12.8 read from T0129.t2k.frag # found chain 1jsxA in template set T0129 12 :LKSAGIGFN 1jsxA 9 :LKDAGISLT Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.98257 Ang I7.CG2 and F9.CZ other bump:2.69557 Ang I7.CB and F9.CE2 other bump:2.10604 Ang I7.CG2 and F9.CE2 Number of specific fragments= 1 total=398 # 1h67A.12.12 read from T0129.t2k.frag # found chain 1h67A in template set T0129 12 :LKSAGIGFN 1h67A 39 :EGATGRRIG Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.24759 Ang L2.CG and F9.CE2 other bump:2.17969 Ang L2.CD2 and F9.CE2 other bump:2.17213 Ang L2.CG and F9.CD2 other bump:2.49306 Ang L2.CD1 and F9.CD2 other bump:1.8454 Ang L2.CD2 and F9.CD2 other bump:2.69019 Ang L2.CD2 and F9.CG other bump:2.30936 Ang L2.CD2 and I7.O Number of specific fragments= 1 total=399 # 1prgA.13.15 read from T0129.t2k.frag # found chain 1prgA in template set T0129 13 :KSAGIGFNA 1prgA 222 :YIKSFPLTK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=400 # 2prgA.13.15 read from T0129.t2k.frag # found chain 2prgA in template set T0129 13 :KSAGIGFNA 2prgA 222 :YIKSFPLTK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=401 # 1fw9A.13.13 read from T0129.t2k.frag # found chain 1fw9A in training set T0129 13 :KSAGIGFNA 1fw9A 14 :SKEIPALDP Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.85831 Ang I6.CB and F8.CZ other bump:1.67284 Ang I6.CG2 and F8.CZ other bump:2.41238 Ang I6.CG2 and F8.CE2 other bump:2.46859 Ang I6.CB and F8.CE1 other bump:1.30104 Ang I6.CG2 and F8.CE1 other bump:3.08366 Ang I6.CA and F8.CE1 other bump:2.78597 Ang I6.CG2 and F8.CD2 other bump:1.91198 Ang I6.CG2 and F8.CD1 other bump:2.59886 Ang I6.O and F8.CD1 other bump:2.59977 Ang I6.CG2 and F8.CG Number of specific fragments= 1 total=402 # 1octC.13.14 read from T0129.t2k.frag # found chain 1octC in template set T0129 13 :KSAGIGFNA 1octC 19 :RRIKLGFTQ Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=403 # 1ktpA.13.12 read from T0129.t2k.frag # found chain 1ktpA in template set T0129 13 :KSAGIGFNA 1ktpA 13 :DTQGRFLSN Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.7382 Ang I6.CG2 and G7.N Number of specific fragments= 1 total=404 # 1h67A.13.13 read from T0129.t2k.frag # found chain 1h67A in template set T0129 13 :KSAGIGFNA 1h67A 40 :GATGRRIGD Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=405 # 1fw9A.14.14 read from T0129.t2k.frag # found chain 1fw9A in training set T0129 14 :SAGIGFNAT 1fw9A 15 :KEIPALDPQ Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.85831 Ang I5.CB and F7.CZ other bump:1.67284 Ang I5.CG2 and F7.CZ other bump:2.41238 Ang I5.CG2 and F7.CE2 other bump:2.46859 Ang I5.CB and F7.CE1 other bump:1.30104 Ang I5.CG2 and F7.CE1 other bump:3.08366 Ang I5.CA and F7.CE1 other bump:2.78597 Ang I5.CG2 and F7.CD2 other bump:1.91198 Ang I5.CG2 and F7.CD1 other bump:2.59886 Ang I5.O and F7.CD1 other bump:2.59977 Ang I5.CG2 and F7.CG Number of specific fragments= 1 total=406 # 1prgA.14.16 read from T0129.t2k.frag # found chain 1prgA in template set T0129 14 :SAGIGFNAT 1prgA 223 :IKSFPLTKA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=407 # 2prgA.14.16 read from T0129.t2k.frag # found chain 2prgA in template set T0129 14 :SAGIGFNAT 2prgA 223 :IKSFPLTKA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=408 # 1b9oA.14.15 read from T0129.t2k.frag # found chain 1b9oA in training set T0129 14 :SAGIGFNAT 1b9oA 16 :DGYGGIALP Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.57939 Ang S2.OG and A9.CB neighbor-bump: 2.67143 Ang G4.C and I5.CB neighbor-bump: 2.63655 Ang S2.C and A3.CB Number of specific fragments= 1 total=409 # 1octC.14.15 read from T0129.t2k.frag # found chain 1octC in template set T0129 14 :SAGIGFNAT 1octC 20 :RIKLGFTQG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=410 # 1ktpA.14.13 read from T0129.t2k.frag # found chain 1ktpA in template set T0129 14 :SAGIGFNAT 1ktpA 14 :TQGRFLSNT Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.7382 Ang I5.CG2 and G6.N Number of specific fragments= 1 total=411 # 1prgA.15.17 read from T0129.t2k.frag # found chain 1prgA in template set T0129 15 :AGIGFNATE 1prgA 224 :KSFPLTKAK Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:3.0068 Ang F6.CE2 and G11.CA other bump:2.5067 Ang F6.CZ and G11.CA other bump:2.72279 Ang F6.CZ and G11.N other bump:3.05517 Ang F6.CE1 and E10.C other bump:3.09244 Ang F6.CZ and E10.C other bump:2.91168 Ang F6.CD1 and E10.OE1 other bump:2.69942 Ang N7.OD1 and E10.CB Number of specific fragments= 1 total=412 # 2prgA.15.17 read from T0129.t2k.frag # found chain 2prgA in template set T0129 15 :AGIGFNATE 2prgA 224 :KSFPLTKAK Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.84832 Ang F6.CE1 and G11.CA other bump:2.10253 Ang F6.CZ and G11.CA other bump:2.99138 Ang F6.CE2 and G11.CA other bump:2.67644 Ang F6.CE1 and G11.N other bump:2.64904 Ang F6.CZ and G11.N other bump:2.99213 Ang F6.CE1 and E10.C Number of specific fragments= 1 total=413 # 1fw9A.15.15 read from T0129.t2k.frag # found chain 1fw9A in training set T0129 15 :AGIGFNATE 1fw9A 16 :EIPALDPQL Fragment has 11 clashes (null) has 11 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.53411 Ang F6.CB and E10.OE1 other bump:1.67284 Ang I4.CG2 and F6.CZ other bump:2.85831 Ang I4.CB and F6.CZ other bump:2.41238 Ang I4.CG2 and F6.CE2 other bump:1.30104 Ang I4.CG2 and F6.CE1 other bump:3.08366 Ang I4.CA and F6.CE1 other bump:2.46859 Ang I4.CB and F6.CE1 other bump:2.78597 Ang I4.CG2 and F6.CD2 other bump:1.91198 Ang I4.CG2 and F6.CD1 other bump:2.59886 Ang I4.O and F6.CD1 other bump:2.59977 Ang I4.CG2 and F6.CG Number of specific fragments= 1 total=414 # 1b9oA.15.16 read from T0129.t2k.frag # found chain 1b9oA in training set T0129 15 :AGIGFNATE 1b9oA 17 :GYGGIALPE Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.67143 Ang G3.C and I4.CB neighbor-bump: 2.63655 Ang G1.C and A2.CB Number of specific fragments= 1 total=415 # 1l5jA.15.17 read from T0129.t2k.frag # found chain 1l5jA in template set T0129 15 :AGIGFNATE 1l5jA 18 :APKPLDANQ Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=416 # 1octC.15.16 read from T0129.t2k.frag # found chain 1octC in template set T0129 15 :AGIGFNATE 1octC 21 :IKLGFTQGD Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=417 # 1prgA.16.18 read from T0129.t2k.frag # found chain 1prgA in template set T0129 16 :GIGFNATEL 1prgA 225 :SFPLTKAKA Fragment has 9 clashes (null) has 9 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.91903 Ang F5.CE2 and L10.CD1 other bump:2.8727 Ang F5.CE2 and L10.CB other bump:3.0068 Ang F5.CE2 and L10.CA other bump:2.5067 Ang F5.CZ and L10.CA other bump:2.72279 Ang F5.CZ and L10.N other bump:3.05517 Ang F5.CE1 and E9.C other bump:3.09244 Ang F5.CZ and E9.C other bump:2.91167 Ang F5.CD1 and E9.OE1 other bump:2.69942 Ang N6.OD1 and E9.CB Number of specific fragments= 1 total=418 # 2prgA.16.18 read from T0129.t2k.frag # found chain 2prgA in template set T0129 16 :GIGFNATEL 2prgA 225 :SFPLTKAKA Fragment has 11 clashes (null) has 11 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.03922 Ang F5.CE2 and L10.CD1 other bump:2.51238 Ang F5.CZ and L10.CD1 other bump:2.67352 Ang F5.CE2 and L10.CG other bump:2.50374 Ang F5.CE2 and L10.CB other bump:2.42344 Ang F5.CZ and L10.CB other bump:2.84832 Ang F5.CE1 and L10.CA other bump:2.99138 Ang F5.CE2 and L10.CA other bump:2.10253 Ang F5.CZ and L10.CA other bump:2.67644 Ang F5.CE1 and L10.N other bump:2.64904 Ang F5.CZ and L10.N other bump:2.99213 Ang F5.CE1 and E9.C Number of specific fragments= 1 total=419 # 1fw9A.16.16 read from T0129.t2k.frag # found chain 1fw9A in training set T0129 16 :GIGFNATEL 1fw9A 17 :IPALDPQLL Fragment has 11 clashes (null) has 11 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.53412 Ang F5.CB and E9.OE1 other bump:1.67284 Ang I3.CG2 and F5.CZ other bump:2.85831 Ang I3.CB and F5.CZ other bump:2.41238 Ang I3.CG2 and F5.CE2 other bump:1.30104 Ang I3.CG2 and F5.CE1 other bump:3.08366 Ang I3.CA and F5.CE1 other bump:2.46859 Ang I3.CB and F5.CE1 other bump:2.78597 Ang I3.CG2 and F5.CD2 other bump:1.91198 Ang I3.CG2 and F5.CD1 other bump:2.59886 Ang I3.O and F5.CD1 other bump:2.59977 Ang I3.CG2 and F5.CG Number of specific fragments= 1 total=420 # 1b9oA.16.17 read from T0129.t2k.frag # found chain 1b9oA in training set T0129 16 :GIGFNATEL 1b9oA 18 :YGGIALPEL Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.67143 Ang G2.C and I3.CB Number of specific fragments= 1 total=421 # 1alvA.16.16 read from T0129.t2k.frag # found chain 1alvA in template set T0129 16 :GIGFNATEL 1alvA 110 :DMEVSATEL Fragment has 16 clashes (null) has 16 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:3.15871 Ang F5.CZ and L10.C other bump:2.82056 Ang F5.CZ and L10.CB other bump:2.08409 Ang F5.CE1 and L10.CB other bump:3.11798 Ang F5.CD1 and L10.CB other bump:1.88544 Ang F5.CZ and L10.CA other bump:1.88046 Ang F5.CE1 and L10.CA other bump:2.01096 Ang F5.CZ and L10.N other bump:1.8171 Ang F5.CE1 and L10.N other bump:3.15622 Ang F5.CE2 and E9.C other bump:2.32929 Ang F5.CZ and E9.C other bump:2.72443 Ang F5.CE1 and E9.C other bump:2.50868 Ang F5.CZ and E9.O other bump:2.47762 Ang N6.OD1 and E9.CG other bump:2.59043 Ang N6.OD1 and E9.CB other bump:2.27 Ang N6.OD1 and E9.N neighbor-bump: 2.68351 Ang G2.C and I3.CB Number of specific fragments= 1 total=422 # 1phnA.16.15 read from T0129.t2k.frag # found chain 1phnA in template set T0129 16 :GIGFNATEL 1phnA 16 :GRFLSNTEL Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.56327 Ang N6.OD1 and E9.CD Number of specific fragments= 1 total=423 # 1prgA.17.19 read from T0129.t2k.frag # found chain 1prgA in template set T0129 17 :IGFNATELH 1prgA 226 :FPLTKAKAR Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.51961 Ang A6.O and H10.CD2 other bump:2.91903 Ang F4.CE2 and L9.CD1 other bump:2.8727 Ang F4.CE2 and L9.CB other bump:2.5067 Ang F4.CZ and L9.CA other bump:3.0068 Ang F4.CE2 and L9.CA other bump:2.72279 Ang F4.CZ and L9.N other bump:3.05517 Ang F4.CE1 and E8.C other bump:3.09244 Ang F4.CZ and E8.C other bump:2.91167 Ang F4.CD1 and E8.OE1 other bump:2.69942 Ang N5.OD1 and E8.CB Number of specific fragments= 1 total=424 # 2prgA.17.19 read from T0129.t2k.frag # found chain 2prgA in template set T0129 17 :IGFNATELH 2prgA 226 :FPLTKAKAR Fragment has 20 clashes (null) has 20 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.45444 Ang A6.O and H10.CD2 other bump:3.09174 Ang A6.C and H10.CD2 other bump:1.59078 Ang F4.CZ and L9.CD2 other bump:2.64276 Ang F4.CG and L9.CD2 other bump:3.04443 Ang F4.CD1 and L9.CD2 other bump:1.52297 Ang F4.CD2 and L9.CD2 other bump:0.283894 Ang F4.CE2 and L9.CD2 other bump:2.74517 Ang F4.CD2 and L9.CD1 other bump:2.54272 Ang F4.CE2 and L9.CD1 other bump:3.05313 Ang F4.CG and L9.CG other bump:2.14874 Ang F4.CD2 and L9.CG other bump:1.45671 Ang F4.CE2 and L9.CG other bump:2.38526 Ang F4.CZ and L9.CB other bump:2.47122 Ang F4.CE2 and L9.CB other bump:2.84832 Ang F4.CE1 and L9.CA other bump:2.10253 Ang F4.CZ and L9.CA other bump:2.99138 Ang F4.CE2 and L9.CA other bump:2.67644 Ang F4.CE1 and L9.N other bump:2.64904 Ang F4.CZ and L9.N other bump:2.99213 Ang F4.CE1 and E8.C Number of specific fragments= 1 total=425 # 1fw9A.17.17 read from T0129.t2k.frag # found chain 1fw9A in training set T0129 17 :IGFNATELH 1fw9A 18 :PALDPQLLD Fragment has 12 clashes (null) has 12 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.65641 Ang A6.O and H10.CD2 other bump:2.53412 Ang F4.CB and E8.OE1 other bump:1.67284 Ang I2.CG2 and F4.CZ other bump:2.8583 Ang I2.CB and F4.CZ other bump:2.41238 Ang I2.CG2 and F4.CE2 other bump:1.30103 Ang I2.CG2 and F4.CE1 other bump:3.08366 Ang I2.CA and F4.CE1 other bump:2.46858 Ang I2.CB and F4.CE1 other bump:2.78597 Ang I2.CG2 and F4.CD2 other bump:1.91197 Ang I2.CG2 and F4.CD1 other bump:2.59886 Ang I2.O and F4.CD1 other bump:2.59977 Ang I2.CG2 and F4.CG Number of specific fragments= 1 total=426 # 1b9oA.17.18 read from T0129.t2k.frag # found chain 1b9oA in training set T0129 17 :IGFNATELH 1b9oA 19 :GGIALPELI Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.67143 Ang G1.C and I2.CB Number of specific fragments= 1 total=427 # 1hfx.17.18 read from T0129.t2k.frag # found chain 1hfx in template set T0129 17 :IGFNATELH 1hfx 19 :RDITLPEWL Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.32632 Ang N5.OD1 and E8.CB Number of specific fragments= 1 total=428 # 1mhyD.17.15 read from T0129.t2k.frag # found chain 1mhyD in template set T0129 17 :IGFNATELH 1mhyD 21 :VGVEPQEVH Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=429 # 1fw9A.18.18 read from T0129.t2k.frag # found chain 1fw9A in training set T0129 18 :GFNATELHG 1fw9A 19 :ALDPQLLDW Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.65641 Ang A5.O and H9.CD2 other bump:2.53412 Ang F3.CB and E7.OE1 other bump:2.59886 Ang G1.O and F3.CD1 Number of specific fragments= 1 total=430 # 1prgA.18.20 read from T0129.t2k.frag # found chain 1prgA in template set T0129 18 :GFNATELHG 1prgA 227 :PLTKAKARA Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.51961 Ang A5.O and H9.CD2 other bump:2.91903 Ang F3.CE2 and L8.CD1 other bump:2.8727 Ang F3.CE2 and L8.CB other bump:2.5067 Ang F3.CZ and L8.CA other bump:3.0068 Ang F3.CE2 and L8.CA other bump:2.72279 Ang F3.CZ and L8.N other bump:3.05517 Ang F3.CE1 and E7.C other bump:3.09244 Ang F3.CZ and E7.C other bump:2.91167 Ang F3.CD1 and E7.OE1 other bump:2.69942 Ang N4.OD1 and E7.CB Number of specific fragments= 1 total=431 # 2prgA.18.20 read from T0129.t2k.frag # found chain 2prgA in template set T0129 18 :GFNATELHG 2prgA 227 :PLTKAKARA Fragment has 20 clashes (null) has 20 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.45443 Ang A5.O and H9.CD2 other bump:3.09173 Ang A5.C and H9.CD2 other bump:1.59078 Ang F3.CZ and L8.CD2 other bump:2.64276 Ang F3.CG and L8.CD2 other bump:3.04443 Ang F3.CD1 and L8.CD2 other bump:1.52297 Ang F3.CD2 and L8.CD2 other bump:0.283894 Ang F3.CE2 and L8.CD2 other bump:2.74517 Ang F3.CD2 and L8.CD1 other bump:2.54272 Ang F3.CE2 and L8.CD1 other bump:3.05313 Ang F3.CG and L8.CG other bump:2.14874 Ang F3.CD2 and L8.CG other bump:1.45671 Ang F3.CE2 and L8.CG other bump:2.38526 Ang F3.CZ and L8.CB other bump:2.47122 Ang F3.CE2 and L8.CB other bump:2.84832 Ang F3.CE1 and L8.CA other bump:2.10253 Ang F3.CZ and L8.CA other bump:2.99138 Ang F3.CE2 and L8.CA other bump:2.67644 Ang F3.CE1 and L8.N other bump:2.64904 Ang F3.CZ and L8.N other bump:2.99213 Ang F3.CE1 and E7.C Number of specific fragments= 1 total=432 # 1b9oA.18.19 read from T0129.t2k.frag # found chain 1b9oA in training set T0129 18 :GFNATELHG 1b9oA 20 :GIALPELIC Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=433 # 1hfx.18.19 read from T0129.t2k.frag # found chain 1hfx in template set T0129 18 :GFNATELHG 1hfx 20 :DITLPEWLC Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.32632 Ang N4.OD1 and E7.CB Number of specific fragments= 1 total=434 # 1h67A.18.18 read from T0129.t2k.frag # found chain 1h67A in template set T0129 18 :GFNATELHG 1h67A 45 :RIGDNFMDG Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.159 Ang T6.OG1 and H9.CB Number of specific fragments= 1 total=435 # 1prgA.19.21 read from T0129.t2k.frag # found chain 1prgA in template set T0129 19 :FNATELHGF 1prgA 228 :LTKAKARAI Fragment has 15 clashes (null) has 15 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.68905 Ang E6.CG and F10.CZ other bump:2.29078 Ang F2.CE1 and F10.CE1 other bump:2.93405 Ang F2.CZ and F10.CE1 other bump:2.78302 Ang F2.CE1 and F10.CD1 other bump:2.74861 Ang F2.CZ and F10.CD1 other bump:2.51961 Ang A4.O and H8.CD2 other bump:2.91903 Ang F2.CE2 and L7.CD1 other bump:2.8727 Ang F2.CE2 and L7.CB other bump:2.5067 Ang F2.CZ and L7.CA other bump:3.00681 Ang F2.CE2 and L7.CA other bump:2.72278 Ang F2.CZ and L7.N other bump:3.05518 Ang F2.CE1 and E6.C other bump:3.09244 Ang F2.CZ and E6.C other bump:2.91167 Ang F2.CD1 and E6.OE1 other bump:2.69942 Ang N3.OD1 and E6.CB Number of specific fragments= 1 total=436 # 2prgA.19.21 read from T0129.t2k.frag # found chain 2prgA in template set T0129 19 :FNATELHGF 2prgA 228 :LTKAKARAI Fragment has 21 clashes (null) has 21 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.78575 Ang F2.CE1 and F10.CE1 other bump:2.45443 Ang A4.O and H8.CD2 other bump:3.09173 Ang A4.C and H8.CD2 other bump:0.283891 Ang F2.CE2 and L7.CD2 other bump:1.59077 Ang F2.CZ and L7.CD2 other bump:2.64275 Ang F2.CG and L7.CD2 other bump:3.04442 Ang F2.CD1 and L7.CD2 other bump:1.52296 Ang F2.CD2 and L7.CD2 other bump:2.54272 Ang F2.CE2 and L7.CD1 other bump:2.74516 Ang F2.CD2 and L7.CD1 other bump:1.4567 Ang F2.CE2 and L7.CG other bump:3.05312 Ang F2.CG and L7.CG other bump:2.14873 Ang F2.CD2 and L7.CG other bump:2.47121 Ang F2.CE2 and L7.CB other bump:2.38524 Ang F2.CZ and L7.CB other bump:2.8483 Ang F2.CE1 and L7.CA other bump:2.99138 Ang F2.CE2 and L7.CA other bump:2.10252 Ang F2.CZ and L7.CA other bump:2.67643 Ang F2.CE1 and L7.N other bump:2.64903 Ang F2.CZ and L7.N other bump:2.99213 Ang F2.CE1 and E6.C Number of specific fragments= 1 total=437 # 1fw9A.19.19 read from T0129.t2k.frag # found chain 1fw9A in training set T0129 19 :FNATELHGF 1fw9A 20 :LDPQLLDWL Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.20064 Ang E6.OE2 and F10.CZ other bump:1.23534 Ang E6.OE2 and F10.CE1 other bump:2.24605 Ang E6.CD and F10.CE1 other bump:2.22005 Ang E6.OE2 and F10.CD1 other bump:2.68465 Ang E6.CD and F10.CD1 other bump:2.65641 Ang A4.O and H8.CD2 other bump:2.53411 Ang F2.CB and E6.OE1 Number of specific fragments= 1 total=438 # 1b9oA.19.20 read from T0129.t2k.frag # found chain 1b9oA in training set T0129 19 :FNATELHGF 1b9oA 21 :IALPELICT Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=439 # 1octC.19.19 read from T0129.t2k.frag # found chain 1octC in template set T0129 19 :FNATELHGF 1octC 24 :GFTQGDVGL Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.70659 Ang N3.CB and H8.NE2 other bump:2.82353 Ang N3.CB and H8.CD2 Number of specific fragments= 1 total=440 # 1hfx.19.20 read from T0129.t2k.frag # found chain 1hfx in template set T0129 19 :FNATELHGF 1hfx 21 :ITLPEWLCI Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.84285 Ang E6.CG and F10.CZ other bump:2.62467 Ang E6.OE2 and F10.CZ other bump:2.32632 Ang N3.OD1 and E6.CB Number of specific fragments= 1 total=441 # 1prgA.20.22 read from T0129.t2k.frag # found chain 1prgA in template set T0129 20 :NATELHGFL 1prgA 229 :TKAKARAIL Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.68905 Ang E5.CG and F9.CZ other bump:2.51961 Ang A3.O and H7.CD2 Number of specific fragments= 1 total=442 # 2prgA.20.22 read from T0129.t2k.frag # found chain 2prgA in template set T0129 20 :NATELHGFL 2prgA 229 :TKAKARAIL Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.45443 Ang A3.O and H7.CD2 other bump:3.09173 Ang A3.C and H7.CD2 Number of specific fragments= 1 total=443 # 1fw9A.20.20 read from T0129.t2k.frag # found chain 1fw9A in training set T0129 20 :NATELHGFL 1fw9A 21 :DPQLLDWLL Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.31555 Ang E5.OE2 and F9.CZ other bump:2.12868 Ang E5.CD and F9.CE1 other bump:1.23797 Ang E5.OE2 and F9.CE1 other bump:2.49858 Ang E5.CD and F9.CD1 other bump:2.16079 Ang E5.OE2 and F9.CD1 other bump:2.65641 Ang A3.O and H7.CD2 Number of specific fragments= 1 total=444 # 1octC.20.20 read from T0129.t2k.frag # found chain 1octC in template set T0129 20 :NATELHGFL 1octC 25 :FTQGDVGLA Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.70294 Ang N2.CB and H7.NE2 other bump:2.81178 Ang N2.CB and H7.CD2 Number of specific fragments= 1 total=445 # 1b9oA.20.21 read from T0129.t2k.frag # found chain 1b9oA in training set T0129 20 :NATELHGFL 1b9oA 22 :ALPELICTM Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=446 # 1eia.20.20 read from T0129.t2k.frag # found chain 1eia in template set T0129 20 :NATELHGFL 1eia 36 :ASQNLFGIL Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.11843 Ang G1.O and E5.OE1 other bump:1.976 Ang G1.C and E5.OE1 other bump:2.20777 Ang G1.O and E5.CD other bump:3.0484 Ang G1.C and E5.CD Number of specific fragments= 1 total=447 # 1octC.21.21 read from T0129.t2k.frag # found chain 1octC in template set T0129 21 :ATELHGFLS 1octC 26 :TQGDVGLAM Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=448 # 1prgA.21.23 read from T0129.t2k.frag # found chain 1prgA in template set T0129 21 :ATELHGFLS 1prgA 230 :KAKARAILT Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.68905 Ang E4.CG and F8.CZ other bump:2.51961 Ang A2.O and H6.CD2 Number of specific fragments= 1 total=449 # 2prgA.21.23 read from T0129.t2k.frag # found chain 2prgA in template set T0129 21 :ATELHGFLS 2prgA 230 :KAKARAILT Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.45443 Ang A2.O and H6.CD2 other bump:3.09173 Ang A2.C and H6.CD2 Number of specific fragments= 1 total=450 # 1fw9A.21.21 read from T0129.t2k.frag # found chain 1fw9A in training set T0129 21 :ATELHGFLS 1fw9A 22 :PQLLDWLLL Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.31555 Ang E4.OE2 and F8.CZ other bump:2.12868 Ang E4.CD and F8.CE1 other bump:1.23797 Ang E4.OE2 and F8.CE1 other bump:2.49858 Ang E4.CD and F8.CD1 other bump:2.16079 Ang E4.OE2 and F8.CD1 other bump:2.65641 Ang A2.O and H6.CD2 Number of specific fragments= 1 total=451 # 1b9oA.21.22 read from T0129.t2k.frag # found chain 1b9oA in training set T0129 21 :ATELHGFLS 1b9oA 23 :LPELICTMF Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=452 # 1eia.21.21 read from T0129.t2k.frag # found chain 1eia in template set T0129 21 :ATELHGFLS 1eia 37 :SQNLFGILS Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=453 # 1octC.22.22 read from T0129.t2k.frag # found chain 1octC in template set T0129 22 :TELHGFLSG 1octC 27 :QGDVGLAMG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=454 # 1prgA.22.24 read from T0129.t2k.frag # found chain 1prgA in template set T0129 22 :TELHGFLSG 1prgA 231 :AKARAILTG Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.68905 Ang E3.CG and F7.CZ other bump:2.5196 Ang G1.O and H5.CD2 Number of specific fragments= 1 total=455 # 2prgA.22.24 read from T0129.t2k.frag # found chain 2prgA in template set T0129 22 :TELHGFLSG 2prgA 231 :AKARAILTG Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.45443 Ang G1.O and H5.CD2 other bump:3.09173 Ang G1.C and H5.CD2 Number of specific fragments= 1 total=456 # 1fw9A.22.22 read from T0129.t2k.frag # found chain 1fw9A in training set T0129 22 :TELHGFLSG 1fw9A 23 :QLLDWLLLE Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.31554 Ang E3.OE2 and F7.CZ other bump:1.23797 Ang E3.OE2 and F7.CE1 other bump:2.12867 Ang E3.CD and F7.CE1 other bump:2.16079 Ang E3.OE2 and F7.CD1 other bump:2.49858 Ang E3.CD and F7.CD1 other bump:2.65641 Ang G1.O and H5.CD2 Number of specific fragments= 1 total=457 # 1eia.22.22 read from T0129.t2k.frag # found chain 1eia in template set T0129 22 :TELHGFLSG 1eia 38 :QNLFGILSV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=458 # 1b9oA.22.23 read from T0129.t2k.frag # found chain 1b9oA in training set T0129 22 :TELHGFLSG 1b9oA 24 :PELICTMFH Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=459 # 1octC.23.23 read from T0129.t2k.frag # found chain 1octC in template set T0129 23 :ELHGFLSGL 1octC 28 :GDVGLAMGK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=460 # 2prgA.23.25 read from T0129.t2k.frag # found chain 2prgA in template set T0129 23 :ELHGFLSGL 2prgA 232 :KARAILTGK Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.91593 Ang G5.CA and L10.CD1 other bump:2.92642 Ang G5.CA and L10.CG Number of specific fragments= 1 total=461 # 1prgA.23.25 read from T0129.t2k.frag # found chain 1prgA in template set T0129 23 :ELHGFLSGL 1prgA 232 :KARAILTGK Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.68905 Ang E2.CG and F6.CZ Number of specific fragments= 1 total=462 # 1eia.23.23 read from T0129.t2k.frag # found chain 1eia in template set T0129 23 :ELHGFLSGL 1eia 39 :NLFGILSVD Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=463 # 1fw9A.23.23 read from T0129.t2k.frag # found chain 1fw9A in training set T0129 23 :ELHGFLSGL 1fw9A 24 :LLDWLLLED Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.31555 Ang E2.OE2 and F6.CZ other bump:1.23798 Ang E2.OE2 and F6.CE1 other bump:2.12868 Ang E2.CD and F6.CE1 other bump:2.1608 Ang E2.OE2 and F6.CD1 other bump:2.49858 Ang E2.CD and F6.CD1 Number of specific fragments= 1 total=464 # 1pou.23.23 read from T0129.t2k.frag # found chain 1pou in template set T0129 23 :ELHGFLSGL 1pou 28 :GDVGLAMGK Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.44459 Ang G1.O and E2.CG Number of specific fragments= 1 total=465 # 1octC.24.24 read from T0129.t2k.frag # found chain 1octC in template set T0129 24 :LHGFLSGLL 1octC 29 :DVGLAMGKL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=466 # 2prgA.24.26 read from T0129.t2k.frag # found chain 2prgA in template set T0129 24 :LHGFLSGLL 2prgA 233 :ARAILTGKT Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.44181 Ang L9.CB and L10.N self-bump: 2.18149 Ang L9.CB and L9.C self-bump: 1.25285 Ang L9.CA and L9.CB Number of specific fragments= 1 total=467 # 1prgA.24.26 read from T0129.t2k.frag # found chain 1prgA in template set T0129 24 :LHGFLSGLL 1prgA 233 :ARAILTGKT Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=468 # 1pou.24.24 read from T0129.t2k.frag # found chain 1pou in template set T0129 24 :LHGFLSGLL 1pou 29 :DVGLAMGKL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=469 # 1eia.24.24 read from T0129.t2k.frag # found chain 1eia in template set T0129 24 :LHGFLSGLL 1eia 40 :LFGILSVDC Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=470 # 1h67A.24.24 read from T0129.t2k.frag # found chain 1h67A in template set T0129 24 :LHGFLSGLL 1h67A 51 :MDGLKDGVI Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=471 # 1octC.25.25 read from T0129.t2k.frag # found chain 1octC in template set T0129 25 :HGFLSGLLC 1octC 30 :VGLAMGKLY Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=472 # 1pou.25.25 read from T0129.t2k.frag # found chain 1pou in template set T0129 25 :HGFLSGLLC 1pou 30 :VGLAMGKLY Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.97747 Ang H2.CE1 and S6.OG Number of specific fragments= 1 total=473 # 1prgA.25.27 read from T0129.t2k.frag # found chain 1prgA in template set T0129 25 :HGFLSGLLC 1prgA 234 :RAILTGKTT Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=474 # 2prgA.25.27 read from T0129.t2k.frag # found chain 2prgA in template set T0129 25 :HGFLSGLLC 2prgA 234 :RAILTGKTT Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.44181 Ang L8.CB and L9.N self-bump: 2.18149 Ang L8.CB and L8.C self-bump: 1.25285 Ang L8.CA and L8.CB Number of specific fragments= 1 total=475 # 1eia.25.25 read from T0129.t2k.frag # found chain 1eia in template set T0129 25 :HGFLSGLLC 1eia 41 :FGILSVDCT Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=476 # 1h67A.25.25 read from T0129.t2k.frag # found chain 1h67A in template set T0129 25 :HGFLSGLLC 1h67A 52 :DGLKDGVIL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=477 # 1octC.26.26 read from T0129.t2k.frag # found chain 1octC in template set T0129 26 :GFLSGLLCG 1octC 31 :GLAMGKLYG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=478 # 1pou.26.26 read from T0129.t2k.frag # found chain 1pou in template set T0129 26 :GFLSGLLCG 1pou 31 :GLAMGKLYG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=479 # 2prgA.26.28 read from T0129.t2k.frag # found chain 2prgA in template set T0129 26 :GFLSGLLCG 2prgA 235 :AILTGKTTD Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.44181 Ang L7.CB and L8.N self-bump: 2.18149 Ang L7.CB and L7.C self-bump: 1.25285 Ang L7.CA and L7.CB Number of specific fragments= 1 total=480 # 1prgA.26.28 read from T0129.t2k.frag # found chain 1prgA in template set T0129 26 :GFLSGLLCG 1prgA 235 :AILTGKTTD Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=481 # 1hfx.26.27 read from T0129.t2k.frag # found chain 1hfx in template set T0129 26 :GFLSGLLCG 1hfx 28 :CIIFHISGY Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.61337 Ang L8.C and C9.CB Number of specific fragments= 1 total=482 # 1eia.26.26 read from T0129.t2k.frag # found chain 1eia in template set T0129 26 :GFLSGLLCG 1eia 42 :GILSVDCTS Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=483 # 1octC.27.27 read from T0129.t2k.frag # found chain 1octC in template set T0129 27 :FLSGLLCGG 1octC 32 :LAMGKLYGN Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=484 # 1pou.27.27 read from T0129.t2k.frag # found chain 1pou in template set T0129 27 :FLSGLLCGG 1pou 32 :LAMGKLYGN Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=485 # 1prgA.27.29 read from T0129.t2k.frag # found chain 1prgA in template set T0129 27 :FLSGLLCGG 1prgA 236 :ILTGKTTDK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=486 # 2prgA.27.29 read from T0129.t2k.frag # found chain 2prgA in template set T0129 27 :FLSGLLCGG 2prgA 236 :ILTGKTTDK Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.44181 Ang L6.CB and L7.N self-bump: 2.18149 Ang L6.CB and L6.C self-bump: 1.25285 Ang L6.CA and L6.CB Number of specific fragments= 1 total=487 # 1au7A.27.27 read from T0129.t2k.frag # found chain 1au7A in template set T0129 27 :FLSGLLCGG 1au7A 32 :EALAAVHGS Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.74061 Ang G1.C and S4.OG Number of specific fragments= 1 total=488 # 1hfx.27.28 read from T0129.t2k.frag # found chain 1hfx in template set T0129 27 :FLSGLLCGG 1hfx 29 :IIFHISGYD Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.61337 Ang L7.C and C8.CB Number of specific fragments= 1 total=489 # 1octC.28.28 read from T0129.t2k.frag # found chain 1octC in template set T0129 28 :LSGLLCGGL 1octC 33 :AMGKLYGND Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.61654 Ang G4.N and L10.CD2 other bump:2.04888 Ang G4.CA and L10.CD2 other bump:2.90341 Ang G4.CA and L10.CG Number of specific fragments= 1 total=490 # 1pou.28.28 read from T0129.t2k.frag # found chain 1pou in template set T0129 28 :LSGLLCGGL 1pou 33 :AMGKLYGND Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=491 # 1ft9A.28.29 read from T0129.t2k.frag # found chain 1ft9A in template set T0129 28 :LSGLLCGGL 1ft9A 30 :KGSLVCTGE Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.59643 Ang L2.C and S3.CB Number of specific fragments= 1 total=492 # 1au7A.28.28 read from T0129.t2k.frag # found chain 1au7A in template set T0129 28 :LSGLLCGGL 1au7A 33 :ALAAVHGSE Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=493 # 1ql3A.28.31 read from T0129.t2k.frag # found chain 1ql3A in template set T0129 28 :LSGLLCGGL 1ql3A 33 :VVGRTVAGV Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.57041 Ang G1.O and L5.CD1 other bump:2.25329 Ang G1.C and L5.CD1 other bump:2.7443 Ang L2.N and L5.CD1 other bump:2.69631 Ang L2.CA and L5.CD1 other bump:2.04969 Ang G1.O and L5.CG other bump:3.18124 Ang G1.C and L5.CG self-bump: 1.25404 Ang S3.CA and S3.CB Number of specific fragments= 1 total=494 # 1icfI.28.28 read from T0129.t2k.frag # found chain 1icfI in template set T0129 28 :LSGLLCGGL 1icfI 222 :YLPLQCYGS Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=495 # 1octC.29.29 read from T0129.t2k.frag # found chain 1octC in template set T0129 29 :SGLLCGGLK 1octC 34 :MGKLYGNDF Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=496 # 1pou.29.29 read from T0129.t2k.frag # found chain 1pou in template set T0129 29 :SGLLCGGLK 1pou 34 :MGKLYGNDF Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.42856 Ang L9.CB and K10.N self-bump: 2.16061 Ang L9.CB and L9.C self-bump: 1.24135 Ang L9.CA and L9.CB Number of specific fragments= 1 total=497 # 1ft9A.29.30 read from T0129.t2k.frag # found chain 1ft9A in template set T0129 29 :SGLLCGGLK 1ft9A 31 :GSLVCTGEG Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.62192 Ang G7.O and K10.CB Number of specific fragments= 1 total=498 # 1au7A.29.29 read from T0129.t2k.frag # found chain 1au7A in template set T0129 29 :SGLLCGGLK 1au7A 34 :LAAVHGSEF Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=499 # 2abk.29.34 read from T0129.t2k.frag # found chain 2abk in training set T0129 29 :SGLLCGGLK 2abk 35 :AVLLSAQAT Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.3991 Ang L5.O and L9.CD1 Number of specific fragments= 1 total=500 # 1ll1.29.31 read from T0129.t2k.frag # found chain 1ll1 in template set T0129 29 :SGLLCGGLK 1ll1 42 :PGAIFSCFH Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=501 # 1octC.30.30 read from T0129.t2k.frag # found chain 1octC in template set T0129 30 :GLLCGGLKD 1octC 35 :GKLYGNDFS Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=502 # 1pou.30.30 read from T0129.t2k.frag # found chain 1pou in template set T0129 30 :GLLCGGLKD 1pou 35 :GKLYGNDFS Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.42856 Ang L8.CB and K9.N self-bump: 2.16061 Ang L8.CB and L8.C self-bump: 1.24135 Ang L8.CA and L8.CB Number of specific fragments= 1 total=503 # 1ft9A.30.31 read from T0129.t2k.frag # found chain 1ft9A in template set T0129 30 :GLLCGGLKD 1ft9A 32 :SLVCTGEGD Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.62193 Ang G6.O and K9.CB Number of specific fragments= 1 total=504 # 2abk.30.35 read from T0129.t2k.frag # found chain 2abk in training set T0129 30 :GLLCGGLKD 2abk 36 :VLLSAQATD Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.3991 Ang L4.O and L8.CD1 Number of specific fragments= 1 total=505 # 1au7A.30.30 read from T0129.t2k.frag # found chain 1au7A in template set T0129 30 :GLLCGGLKD 1au7A 35 :AAVHGSEFS Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=506 # 1ll1.30.32 read from T0129.t2k.frag # found chain 1ll1 in template set T0129 30 :GLLCGGLKD 1ll1 43 :GAIFSCFHP Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=507 # 1octC.31.31 read from T0129.t2k.frag # found chain 1octC in template set T0129 31 :LLCGGLKDQ 1octC 36 :KLYGNDFSQ Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=508 # 1pou.31.31 read from T0129.t2k.frag # found chain 1pou in template set T0129 31 :LLCGGLKDQ 1pou 36 :KLYGNDFSQ Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.42856 Ang L7.CB and K8.N self-bump: 2.16061 Ang L7.CB and L7.C self-bump: 1.24135 Ang L7.CA and L7.CB Number of specific fragments= 1 total=509 # 1ft9A.31.32 read from T0129.t2k.frag # found chain 1ft9A in template set T0129 31 :LLCGGLKDQ 1ft9A 33 :LVCTGEGDE Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.11681 Ang K8.CE and Q10.NE2 other bump:1.1383 Ang K8.NZ and Q10.NE2 other bump:2.98763 Ang K8.CE and Q10.CD other bump:2.12267 Ang K8.NZ and Q10.CD other bump:2.89095 Ang K8.CE and Q10.CB other bump:2.62193 Ang G5.O and K8.CB Number of specific fragments= 1 total=510 # 2abk.31.36 read from T0129.t2k.frag # found chain 2abk in training set T0129 31 :LLCGGLKDQ 2abk 37 :LLSAQATDV Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.3991 Ang L3.O and L7.CD1 Number of specific fragments= 1 total=511 # 1ofgA.31.33 read from T0129.t2k.frag # found chain 1ofgA in template set T0129 31 :LLCGGLKDQ 1ofgA 34 :YAIVGLGKY Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=512 # 1ll1.31.33 read from T0129.t2k.frag # found chain 1ll1 in template set T0129 31 :LLCGGLKDQ 1ll1 44 :AIFSCFHPD Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=513 # 1octC.32.32 read from T0129.t2k.frag # found chain 1octC in template set T0129 32 :LCGGLKDQS 1octC 37 :LYGNDFSQT Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=514 # 1pou.32.32 read from T0129.t2k.frag # found chain 1pou in template set T0129 32 :LCGGLKDQS 1pou 37 :LYGNDFSQT Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.42856 Ang L6.CB and K7.N self-bump: 2.16061 Ang L6.CB and L6.C self-bump: 1.24135 Ang L6.CA and L6.CB Number of specific fragments= 1 total=515 # 2abk.32.37 read from T0129.t2k.frag # found chain 2abk in training set T0129 32 :LCGGLKDQS 2abk 38 :LSAQATDVS Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.3991 Ang L2.O and L6.CD1 Number of specific fragments= 1 total=516 # 1ft9A.32.33 read from T0129.t2k.frag # found chain 1ft9A in template set T0129 32 :LCGGLKDQS 1ft9A 34 :VCTGEGDEN Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.64039 Ang K7.NZ and Q9.NE2 other bump:2.85973 Ang K7.CE and Q9.NE2 other bump:2.66736 Ang K7.NZ and Q9.CD other bump:2.62193 Ang G4.O and K7.CB Number of specific fragments= 1 total=517 # 1f0iA.32.33 read from T0129.t2k.frag # found chain 1f0iA in training set T0129 32 :LCGGLKDQS 1f0iA 39 :DGSAADPSD Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.98681 Ang C3.CB and D8.C other bump:2.81603 Ang C3.SG and D8.C other bump:2.23891 Ang C3.CB and D8.O other bump:1.63259 Ang C3.SG and D8.O other bump:3.23705 Ang C3.CB and D8.CA Number of specific fragments= 1 total=518 # 1ofgA.32.34 read from T0129.t2k.frag # found chain 1ofgA in template set T0129 32 :LCGGLKDQS 1ofgA 35 :AIVGLGKYA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=519 # 1octC.33.33 read from T0129.t2k.frag # found chain 1octC in template set T0129 33 :CGGLKDQSW 1octC 38 :YGNDFSQTT Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=520 # 2abk.33.38 read from T0129.t2k.frag # found chain 2abk in training set T0129 33 :CGGLKDQSW 2abk 39 :SAQATDVSV Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.3991 Ang G1.O and L5.CD1 Number of specific fragments= 1 total=521 # 1pou.33.33 read from T0129.t2k.frag # found chain 1pou in template set T0129 33 :CGGLKDQSW 1pou 38 :YGNDFSQTT Fragment has 32 clashes (null) has 32 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:0.881621 Ang L5.CD1 and W10.CH2 other bump:2.95566 Ang L5.CA and W10.CH2 other bump:1.95023 Ang L5.CB and W10.CH2 other bump:0.965807 Ang L5.CG and W10.CH2 other bump:2.35544 Ang L5.CD2 and W10.CH2 other bump:1.94231 Ang L5.CD1 and W10.CZ3 other bump:3.20601 Ang L5.N and W10.CZ3 other bump:1.98686 Ang L5.CA and W10.CZ3 other bump:0.954064 Ang L5.CB and W10.CZ3 other bump:1.53427 Ang L5.CG and W10.CZ3 other bump:2.87986 Ang L5.CD2 and W10.CZ3 other bump:2.97883 Ang L5.C and W10.CZ3 other bump:3.09726 Ang K6.N and W10.CZ3 other bump:0.541777 Ang L5.CD1 and W10.CZ2 other bump:2.89309 Ang L5.CB and W10.CZ2 other bump:1.82616 Ang L5.CG and W10.CZ2 other bump:2.48302 Ang L5.CD2 and W10.CZ2 other bump:2.88327 Ang L5.CD1 and W10.NE1 other bump:2.52203 Ang L5.CD1 and W10.CE3 other bump:2.61722 Ang L5.CA and W10.CE3 other bump:1.61138 Ang L5.CB and W10.CE3 other bump:2.50355 Ang L5.CG and W10.CE3 other bump:2.87195 Ang L5.C and W10.CE3 other bump:2.39429 Ang K6.N and W10.CE3 other bump:1.6301 Ang L5.CD1 and W10.CE2 other bump:2.65154 Ang L5.CG and W10.CE2 other bump:2.40743 Ang L5.CD1 and W10.CD2 other bump:2.6666 Ang L5.CB and W10.CD2 other bump:2.94078 Ang L5.CG and W10.CD2 neighbor-bump: 2.42856 Ang L5.CB and K6.N self-bump: 2.16061 Ang L5.CB and L5.C self-bump: 1.24135 Ang L5.CA and L5.CB Number of specific fragments= 1 total=522 # 1f0iA.33.34 read from T0129.t2k.frag # found chain 1f0iA in training set T0129 33 :CGGLKDQSW 1f0iA 40 :GSAADPSDW Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.23059 Ang C2.SG and W10.CD1 other bump:3.04992 Ang C2.SG and W10.CG other bump:2.98681 Ang C2.CB and D7.C other bump:2.81603 Ang C2.SG and D7.C other bump:2.23891 Ang C2.CB and D7.O other bump:1.63259 Ang C2.SG and D7.O other bump:3.23705 Ang C2.CB and D7.CA Number of specific fragments= 1 total=523 # 1ofgA.33.35 read from T0129.t2k.frag # found chain 1ofgA in template set T0129 33 :CGGLKDQSW 1ofgA 36 :IVGLGKYAL Fragment has 9 clashes (null) has 9 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.60338 Ang L5.O and W10.CH2 other bump:2.01932 Ang L5.O and W10.CZ2 other bump:3.11254 Ang L5.CB and W10.CZ2 other bump:3.01217 Ang L5.C and W10.CZ2 other bump:2.68404 Ang L5.CB and W10.NE1 other bump:3.10329 Ang L5.CA and W10.NE1 other bump:3.10909 Ang L5.C and W10.NE1 other bump:2.42278 Ang L5.O and W10.CE2 other bump:2.95066 Ang L5.C and W10.CE2 Number of specific fragments= 1 total=524 # 1ft9A.33.34 read from T0129.t2k.frag # found chain 1ft9A in template set T0129 33 :CGGLKDQSW 1ft9A 35 :CTGEGDENG Fragment has 21 clashes (null) has 21 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:3.13182 Ang K6.NZ and W10.CH2 other bump:2.63355 Ang Q8.CD and W10.CH2 other bump:3.11742 Ang Q8.NE2 and W10.CH2 other bump:2.92945 Ang K6.CE and W10.CH2 other bump:2.71181 Ang Q8.OE1 and W10.CH2 other bump:2.59584 Ang Q8.CB and W10.CH2 other bump:3.0523 Ang Q8.CG and W10.CH2 other bump:2.27979 Ang Q8.CB and W10.CZ3 other bump:3.02174 Ang Q8.C and W10.CZ3 neighbor-bump: 2.48874 Ang S9.N and W10.CZ3 other bump:3.13192 Ang Q8.CG and W10.CZ3 other bump:3.10722 Ang Q8.CA and W10.CZ3 neighbor-bump: 2.43234 Ang S9.N and W10.CE3 neighbor-bump: 2.81615 Ang S9.CA and W10.CE3 neighbor-bump: 2.16876 Ang S9.O and W10.CE3 neighbor-bump: 2.45064 Ang S9.C and W10.CE3 neighbor-bump: 2.91356 Ang S9.C and W10.CD2 other bump:1.64039 Ang K6.NZ and Q8.NE2 other bump:2.85973 Ang K6.CE and Q8.NE2 other bump:2.66736 Ang K6.NZ and Q8.CD other bump:2.62193 Ang G3.O and K6.CB Number of specific fragments= 1 total=525 # 1octC.34.34 read from T0129.t2k.frag # found chain 1octC in template set T0129 34 :GGLKDQSWL 1octC 39 :GNDFSQTTI Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.66585 Ang D6.OD1 and W9.CD1 Number of specific fragments= 1 total=526 # 1pou.34.34 read from T0129.t2k.frag # found chain 1pou in template set T0129 34 :GGLKDQSWL 1pou 39 :GNDFSQTTI Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.24319 Ang L4.CD1 and W9.NE1 other bump:3.14442 Ang L4.CG and W9.NE1 other bump:3.24131 Ang L4.CD2 and W9.NE1 other bump:2.81982 Ang L4.CD1 and W9.CD1 neighbor-bump: 2.42856 Ang L4.CB and K5.N self-bump: 2.16061 Ang L4.CB and L4.C self-bump: 1.24135 Ang L4.CA and L4.CB Number of specific fragments= 1 total=527 # 2abk.34.39 read from T0129.t2k.frag # found chain 2abk in training set T0129 34 :GGLKDQSWL 2abk 40 :AQATDVSVN Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=528 # 1rec.34.40 read from T0129.t2k.frag # found chain 1rec in template set T0129 34 :GGLKDQSWL 1rec 42 :GRITRQEFQ Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=529 # 1f0iA.34.35 read from T0129.t2k.frag # found chain 1f0iA in training set T0129 34 :GGLKDQSWL 1f0iA 41 :SAADPSDWL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=530 # 1g8iA.34.40 read from T0129.t2k.frag # found chain 1g8iA in template set T0129 34 :GGLKDQSWL 1g8iA 41 :GQLDAAGFQ Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.30221 Ang L4.CD1 and S8.OG Number of specific fragments= 1 total=531 # 1rec.35.41 read from T0129.t2k.frag # found chain 1rec in template set T0129 35 :GLKDQSWLP 1rec 43 :RITRQEFQT Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.53362 Ang L9.N and P10.CD other bump:2.89556 Ang Q6.C and P10.CD other bump:2.84323 Ang S7.C and P10.CD other bump:1.83469 Ang Q6.O and P10.CD other bump:3.09353 Ang Q6.C and P10.CG other bump:1.98615 Ang Q6.O and P10.CG Number of specific fragments= 1 total=532 # 2abk.35.40 read from T0129.t2k.frag # found chain 2abk in training set T0129 35 :GLKDQSWLP 2abk 41 :QATDVSVNK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=533 # 1octC.35.35 read from T0129.t2k.frag # found chain 1octC in template set T0129 35 :GLKDQSWLP 1octC 40 :NDFSQTTIS Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.34189 Ang Q6.O and P10.CD other bump:2.55703 Ang Q6.C and P10.CD other bump:3.07491 Ang S7.C and P10.CD other bump:2.1624 Ang Q6.O and P10.CG other bump:3.12904 Ang Q6.C and P10.CG other bump:2.66585 Ang D5.OD1 and W8.CD1 Number of specific fragments= 1 total=534 # 1g8iA.35.41 read from T0129.t2k.frag # found chain 1g8iA in template set T0129 35 :GLKDQSWLP 1g8iA 42 :QLDAAGFQK Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.30221 Ang L3.CD1 and S7.OG Number of specific fragments= 1 total=535 # 1f0iA.35.36 read from T0129.t2k.frag # found chain 1f0iA in training set T0129 35 :GLKDQSWLP 1f0iA 42 :AADPSDWLL Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.28648 Ang W8.O and P10.CD self-bump: 1.39158 Ang P10.CA and P10.CB Number of specific fragments= 1 total=536 # 1pou.35.35 read from T0129.t2k.frag # found chain 1pou in template set T0129 35 :GLKDQSWLP 1pou 40 :NDFSQTTIS Fragment has 13 clashes (null) has 13 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.60643 Ang S7.O and P10.CD other bump:1.37211 Ang Q6.O and P10.CD other bump:2.57766 Ang Q6.C and P10.CD other bump:2.97613 Ang S7.C and P10.CD other bump:2.13612 Ang Q6.O and P10.CG other bump:3.10214 Ang Q6.C and P10.CG other bump:2.24319 Ang L3.CD1 and W8.NE1 other bump:3.14442 Ang L3.CG and W8.NE1 other bump:3.24131 Ang L3.CD2 and W8.NE1 other bump:2.81982 Ang L3.CD1 and W8.CD1 neighbor-bump: 2.42856 Ang L3.CB and K4.N self-bump: 2.16061 Ang L3.CB and L3.C self-bump: 1.24135 Ang L3.CA and L3.CB Number of specific fragments= 1 total=537 # 1rec.36.42 read from T0129.t2k.frag # found chain 1rec in template set T0129 36 :LKDQSWLPL 1rec 44 :ITRQEFQTI Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.53363 Ang L8.N and P9.CD other bump:1.83469 Ang Q5.O and P9.CD other bump:2.89555 Ang Q5.C and P9.CD other bump:2.84323 Ang S6.C and P9.CD other bump:1.98615 Ang Q5.O and P9.CG other bump:3.09353 Ang Q5.C and P9.CG Number of specific fragments= 1 total=538 # 1g8iA.36.42 read from T0129.t2k.frag # found chain 1g8iA in template set T0129 36 :LKDQSWLPL 1g8iA 43 :LDAAGFQKI Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.30221 Ang L2.CD1 and S6.OG Number of specific fragments= 1 total=539 # 2abk.36.41 read from T0129.t2k.frag # found chain 2abk in training set T0129 36 :LKDQSWLPL 2abk 42 :ATDVSVNKA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=540 # 1octC.36.36 read from T0129.t2k.frag # found chain 1octC in template set T0129 36 :LKDQSWLPL 1octC 41 :DFSQTTISR Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.34189 Ang Q5.O and P9.CD other bump:2.55703 Ang Q5.C and P9.CD other bump:3.07491 Ang S6.C and P9.CD other bump:2.1624 Ang Q5.O and P9.CG other bump:3.12904 Ang Q5.C and P9.CG other bump:2.66586 Ang D4.OD1 and W7.CD1 Number of specific fragments= 1 total=541 # 1f0iA.36.37 read from T0129.t2k.frag # found chain 1f0iA in training set T0129 36 :LKDQSWLPL 1f0iA 43 :ADPSDWLLQ Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.28648 Ang W7.O and P9.CD self-bump: 1.39158 Ang P9.CA and P9.CB Number of specific fragments= 1 total=542 # 1jb0A.36.41 read from T0129.t2k.frag # found chain 1jb0A in template set T0129 36 :LKDQSWLPL 1jb0A 42 :PQTTTWIWN Fragment has 8 clashes (null) has 8 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.44246 Ang Q5.O and P9.CD other bump:3.09917 Ang L2.CG and W7.CZ3 other bump:2.61536 Ang L2.CD2 and W7.CZ3 other bump:2.60448 Ang L2.CG and W7.CE3 other bump:1.54384 Ang L2.CD2 and W7.CE3 other bump:2.20607 Ang L2.CD2 and W7.CD2 other bump:2.7921 Ang L2.CD2 and W7.CG other bump:2.97698 Ang L2.CD2 and W7.CB Number of specific fragments= 1 total=543 # 1rec.37.43 read from T0129.t2k.frag # found chain 1rec in template set T0129 37 :KDQSWLPLL 1rec 45 :TRQEFQTIY Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.53363 Ang L7.N and P8.CD other bump:2.89555 Ang Q4.C and P8.CD other bump:2.84323 Ang S5.C and P8.CD other bump:1.83469 Ang Q4.O and P8.CD other bump:3.09353 Ang Q4.C and P8.CG other bump:1.98615 Ang Q4.O and P8.CG Number of specific fragments= 1 total=544 # 1g8iA.37.43 read from T0129.t2k.frag # found chain 1g8iA in template set T0129 37 :KDQSWLPLL 1g8iA 44 :DAAGFQKIY Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=545 # 2abk.37.42 read from T0129.t2k.frag # found chain 2abk in training set T0129 37 :KDQSWLPLL 2abk 43 :TDVSVNKAT Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=546 # 1jb0A.37.42 read from T0129.t2k.frag # found chain 1jb0A in template set T0129 37 :KDQSWLPLL 1jb0A 43 :QTTTWIWNL Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.44246 Ang Q4.O and P8.CD Number of specific fragments= 1 total=547 # 1hu4A.37.37 read from T0129.t2k.frag # found chain 1hu4A in template set T0129 37 :KDQSWLPLL 1hu4A 38 :DVARGQAAV Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:3.16051 Ang S5.C and P8.CD other bump:1.47851 Ang Q4.O and P8.CD other bump:2.63928 Ang Q4.C and P8.CD other bump:1.92113 Ang Q4.O and P8.CG other bump:3.06576 Ang Q4.C and P8.CG other bump:2.06962 Ang K2.CE and S5.OG Number of specific fragments= 1 total=548 # 1octC.37.37 read from T0129.t2k.frag # found chain 1octC in template set T0129 37 :KDQSWLPLL 1octC 42 :FSQTTISRF Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.55703 Ang Q4.C and P8.CD other bump:1.34189 Ang Q4.O and P8.CD other bump:3.07491 Ang S5.C and P8.CD other bump:3.12904 Ang Q4.C and P8.CG other bump:2.1624 Ang Q4.O and P8.CG other bump:2.66585 Ang D3.OD1 and W6.CD1 Number of specific fragments= 1 total=549 # 1rec.38.44 read from T0129.t2k.frag # found chain 1rec in template set T0129 38 :DQSWLPLLY 1rec 46 :RQEFQTIYS Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.53363 Ang L6.N and P7.CD other bump:2.89555 Ang Q3.C and P7.CD other bump:2.84323 Ang S4.C and P7.CD other bump:1.83469 Ang Q3.O and P7.CD other bump:3.09353 Ang Q3.C and P7.CG other bump:1.98615 Ang Q3.O and P7.CG Number of specific fragments= 1 total=550 # 1g8iA.38.44 read from T0129.t2k.frag # found chain 1g8iA in template set T0129 38 :DQSWLPLLY 1g8iA 45 :AAGFQKIYK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=551 # 1hu4A.38.38 read from T0129.t2k.frag # found chain 1hu4A in template set T0129 38 :DQSWLPLLY 1hu4A 39 :VARGQAAVK Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:3.16051 Ang S4.C and P7.CD other bump:2.63928 Ang Q3.C and P7.CD other bump:1.47851 Ang Q3.O and P7.CD other bump:3.06576 Ang Q3.C and P7.CG other bump:1.92113 Ang Q3.O and P7.CG Number of specific fragments= 1 total=552 # 1jb0A.38.43 read from T0129.t2k.frag # found chain 1jb0A in template set T0129 38 :DQSWLPLLY 1jb0A 44 :TTTWIWNLH Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.44246 Ang Q3.O and P7.CD Number of specific fragments= 1 total=553 # 2abk.38.43 read from T0129.t2k.frag # found chain 2abk in training set T0129 38 :DQSWLPLLY 2abk 44 :DVSVNKATA Fragment has 14 clashes (null) has 14 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.64816 Ang L6.O and Y10.CE1 other bump:3.12972 Ang L6.C and Y10.CE1 other bump:1.84492 Ang L6.O and Y10.CD1 other bump:2.7315 Ang L6.C and Y10.CD1 other bump:2.45029 Ang W5.CH2 and L9.CD2 other bump:2.59638 Ang W5.CZ2 and L9.CD2 other bump:3.23594 Ang W5.CZ3 and L9.CD2 other bump:2.8996 Ang W5.CD2 and L9.CD1 other bump:2.02814 Ang W5.CE2 and L9.CD1 other bump:2.27097 Ang W5.NE1 and L9.CD1 other bump:2.22878 Ang W5.CZ2 and L9.CD1 other bump:2.87524 Ang W5.CH2 and L9.CG other bump:2.82188 Ang W5.CE2 and L9.CG other bump:2.64522 Ang W5.CZ2 and L9.CG Number of specific fragments= 1 total=554 # 1l5jA.38.41 read from T0129.t2k.frag # found chain 1l5jA in template set T0129 38 :DQSWLPLLY 1l5jA 42 :EEFLLDLLT Fragment has 9 clashes (null) has 9 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.17923 Ang L6.O and Y10.CD1 other bump:1.53672 Ang Q3.O and P7.CD other bump:2.63606 Ang Q3.C and P7.CD other bump:3.26945 Ang S4.CA and P7.CD other bump:2.55892 Ang S4.O and P7.CD other bump:2.82662 Ang S4.C and P7.CD other bump:1.9993 Ang Q3.O and P7.CG other bump:3.11354 Ang Q3.C and P7.CG other bump:2.66808 Ang G1.O and W5.CD1 Number of specific fragments= 1 total=555 # 1rec.39.45 read from T0129.t2k.frag # found chain 1rec in template set T0129 39 :QSWLPLLYQ 1rec 47 :QEFQTIYSK Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.53363 Ang L5.N and P6.CD other bump:2.89555 Ang Q2.C and P6.CD other bump:1.83469 Ang Q2.O and P6.CD other bump:2.84323 Ang S3.C and P6.CD other bump:3.09353 Ang Q2.C and P6.CG other bump:1.98615 Ang Q2.O and P6.CG Number of specific fragments= 1 total=556 # 1hu4A.39.39 read from T0129.t2k.frag # found chain 1hu4A in template set T0129 39 :QSWLPLLYQ 1hu4A 40 :ARGQAAVKQ Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.63928 Ang Q2.C and P6.CD other bump:3.16051 Ang S3.C and P6.CD other bump:1.47851 Ang Q2.O and P6.CD other bump:3.06576 Ang Q2.C and P6.CG other bump:1.92113 Ang Q2.O and P6.CG Number of specific fragments= 1 total=557 # 1g8iA.39.45 read from T0129.t2k.frag # found chain 1g8iA in template set T0129 39 :QSWLPLLYQ 1g8iA 46 :AGFQKIYKQ Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=558 # 1hh7A.39.41 read from T0129.t2k.frag # found chain 1hh7A in template set T0129 39 :QSWLPLLYQ 1hh7A 42 :FTYSPLNHN Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.68311 Ang W4.CG and L8.CD2 other bump:2.11678 Ang W4.CD2 and L8.CD2 other bump:2.3455 Ang W4.CE3 and L8.CD2 other bump:2.97643 Ang W4.CZ3 and L8.CD2 other bump:2.50951 Ang W4.CE3 and L8.CD1 other bump:2.33943 Ang W4.CZ3 and L8.CD1 other bump:2.92818 Ang W4.CE3 and L8.CG other bump:3.22814 Ang W4.CZ3 and L8.CG other bump:2.89609 Ang Q2.OE1 and W4.CH2 other bump:2.79927 Ang Q2.OE1 and W4.CZ2 Number of specific fragments= 1 total=559 # 2abk.39.44 read from T0129.t2k.frag # found chain 2abk in training set T0129 39 :QSWLPLLYQ 2abk 45 :VSVNKATAK Fragment has 14 clashes (null) has 14 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.64816 Ang L5.O and Y9.CE1 other bump:3.12972 Ang L5.C and Y9.CE1 other bump:1.84492 Ang L5.O and Y9.CD1 other bump:2.7315 Ang L5.C and Y9.CD1 other bump:2.59638 Ang W4.CZ2 and L8.CD2 other bump:3.23594 Ang W4.CZ3 and L8.CD2 other bump:2.45029 Ang W4.CH2 and L8.CD2 other bump:2.02814 Ang W4.CE2 and L8.CD1 other bump:2.22878 Ang W4.CZ2 and L8.CD1 other bump:2.8996 Ang W4.CD2 and L8.CD1 other bump:2.27097 Ang W4.NE1 and L8.CD1 other bump:2.82188 Ang W4.CE2 and L8.CG other bump:2.64522 Ang W4.CZ2 and L8.CG other bump:2.87524 Ang W4.CH2 and L8.CG Number of specific fragments= 1 total=560 # 1lre.39.40 read from T0129.t2k.frag # found chain 1lre in template set T0129 39 :QSWLPLLYQ 1lre 57 :LAWKKLKLD Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.74128 Ang P6.CD and Q10.OE1 other bump:2.13738 Ang P6.O and Q10.OE1 other bump:2.74808 Ang P6.CD and Q10.CD other bump:2.20198 Ang L5.O and Y9.CD1 other bump:2.98383 Ang W4.CH2 and L8.CD2 other bump:3.13453 Ang W4.CZ2 and L8.CB other bump:3.23156 Ang W4.C and L7.N neighbor-bump: 2.70706 Ang W4.CE3 and L5.CD1 neighbor-bump: 2.68109 Ang W4.CZ3 and L5.CD1 other bump:2.66637 Ang G1.O and L5.CD1 Number of specific fragments= 1 total=561 # 1hu4A.40.40 read from T0129.t2k.frag # found chain 1hu4A in template set T0129 40 :SWLPLLYQF 1hu4A 41 :RGQAAVKQL Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.63928 Ang G1.C and P5.CD other bump:3.16051 Ang S2.C and P5.CD other bump:1.47851 Ang G1.O and P5.CD other bump:3.06576 Ang G1.C and P5.CG other bump:1.92113 Ang G1.O and P5.CG Number of specific fragments= 1 total=562 # 1rec.40.46 read from T0129.t2k.frag # found chain 1rec in template set T0129 40 :SWLPLLYQF 1rec 48 :EFQTIYSKF Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.53363 Ang L4.N and P5.CD other bump:2.89555 Ang G1.C and P5.CD other bump:2.84323 Ang S2.C and P5.CD other bump:1.83469 Ang G1.O and P5.CD other bump:3.09353 Ang G1.C and P5.CG other bump:1.98615 Ang G1.O and P5.CG Number of specific fragments= 1 total=563 # 1g8iA.40.46 read from T0129.t2k.frag # found chain 1g8iA in template set T0129 40 :SWLPLLYQF 1g8iA 47 :GFQKIYKQF Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=564 # 3nul.40.44 read from T0129.t2k.frag # found chain 3nul in training set T0129 40 :SWLPLLYQF 3nul 46 :EIDGIKKDF Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.48207 Ang G1.O and P5.CD other bump:2.51984 Ang G1.C and P5.CD other bump:3.13553 Ang S2.CA and P5.CD other bump:2.86679 Ang S2.C and P5.CD other bump:1.8427 Ang G1.O and P5.CG other bump:2.96753 Ang G1.C and P5.CG Number of specific fragments= 1 total=565 # 1eyhA.40.40 read from T0129.t2k.frag # found chain 1eyhA in template set T0129 40 :SWLPLLYQF 1eyhA 55 :EIMSMIWKR Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.55991 Ang L4.O and Y8.CD1 other bump:1.54852 Ang G1.O and P5.CD other bump:2.67653 Ang G1.C and P5.CD other bump:1.84303 Ang G1.O and P5.CG other bump:3.03016 Ang G1.C and P5.CG Number of specific fragments= 1 total=566 # 1l5jA.40.43 read from T0129.t2k.frag # found chain 1l5jA in template set T0129 40 :SWLPLLYQF 1l5jA 44 :FLLDLLTNR Fragment has 16 clashes (null) has 16 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.71163 Ang L4.CD1 and Y8.OH other bump:2.53163 Ang L4.O and Y8.CE1 other bump:3.08658 Ang L4.CA and Y8.CE1 other bump:3.05323 Ang L4.CB and Y8.CE1 other bump:3.11367 Ang L4.C and Y8.CE1 other bump:2.57637 Ang L4.CG and Y8.CE1 other bump:2.83598 Ang L4.CD1 and Y8.CE1 other bump:1.70492 Ang L4.O and Y8.CD1 other bump:2.72354 Ang L4.C and Y8.CD1 other bump:3.26945 Ang S2.CA and P5.CD other bump:2.55892 Ang S2.O and P5.CD other bump:2.82662 Ang S2.C and P5.CD other bump:1.53672 Ang G1.O and P5.CD other bump:2.63606 Ang G1.C and P5.CD other bump:1.9993 Ang G1.O and P5.CG other bump:3.11354 Ang G1.C and P5.CG Number of specific fragments= 1 total=567 # 1hu4A.41.41 read from T0129.t2k.frag # found chain 1hu4A in template set T0129 41 :WLPLLYQFS 1hu4A 42 :GQAAVKQLQ Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:3.16051 Ang G1.C and P4.CD Number of specific fragments= 1 total=568 # 1rec.41.47 read from T0129.t2k.frag # found chain 1rec in template set T0129 41 :WLPLLYQFS 1rec 49 :FQTIYSKFF Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.53363 Ang L3.N and P4.CD other bump:2.84323 Ang G1.C and P4.CD Number of specific fragments= 1 total=569 # 1g8iA.41.47 read from T0129.t2k.frag # found chain 1g8iA in template set T0129 41 :WLPLLYQFS 1g8iA 48 :FQKIYKQFF Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=570 # 3nul.41.45 read from T0129.t2k.frag # found chain 3nul in training set T0129 41 :WLPLLYQFS 3nul 47 :IDGIKKDFE Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.8668 Ang G1.C and P4.CD Number of specific fragments= 1 total=571 # 1l5jA.41.44 read from T0129.t2k.frag # found chain 1l5jA in template set T0129 41 :WLPLLYQFS 1l5jA 45 :LLDLLTNRV Fragment has 11 clashes (null) has 11 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.71163 Ang L3.CD1 and Y7.OH other bump:2.53163 Ang L3.O and Y7.CE1 other bump:3.08658 Ang L3.CA and Y7.CE1 other bump:3.05323 Ang L3.CB and Y7.CE1 other bump:3.11367 Ang L3.C and Y7.CE1 other bump:2.57637 Ang L3.CG and Y7.CE1 other bump:2.83598 Ang L3.CD1 and Y7.CE1 other bump:1.70492 Ang L3.O and Y7.CD1 other bump:2.72354 Ang L3.C and Y7.CD1 other bump:2.55892 Ang G1.O and P4.CD other bump:2.82662 Ang G1.C and P4.CD Number of specific fragments= 1 total=572 # 1eyhA.41.41 read from T0129.t2k.frag # found chain 1eyhA in template set T0129 41 :WLPLLYQFS 1eyhA 56 :IMSMIWKRL Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.55991 Ang L3.O and Y7.CD1 Number of specific fragments= 1 total=573 # 1hu4A.42.42 read from T0129.t2k.frag # found chain 1hu4A in template set T0129 42 :LPLLYQFSN 1hu4A 43 :QAAVKQLQA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=574 # 1rec.42.48 read from T0129.t2k.frag # found chain 1rec in template set T0129 42 :LPLLYQFSN 1rec 50 :QTIYSKFFP Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.53363 Ang L2.N and P3.CD Number of specific fragments= 1 total=575 # 3nul.42.46 read from T0129.t2k.frag # found chain 3nul in training set T0129 42 :LPLLYQFSN 3nul 48 :DGIKKDFEE Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=576 # 1eyhA.42.42 read from T0129.t2k.frag # found chain 1eyhA in template set T0129 42 :LPLLYQFSN 1eyhA 57 :MSMIWKRLN Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.55991 Ang L2.O and Y6.CD1 Number of specific fragments= 1 total=577 # 1l5jA.42.45 read from T0129.t2k.frag # found chain 1l5jA in template set T0129 42 :LPLLYQFSN 1l5jA 46 :LDLLTNRVP Fragment has 9 clashes (null) has 9 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.71163 Ang L2.CD1 and Y6.OH other bump:3.11367 Ang L2.C and Y6.CE1 other bump:3.08658 Ang L2.CA and Y6.CE1 other bump:3.05323 Ang L2.CB and Y6.CE1 other bump:2.53163 Ang L2.O and Y6.CE1 other bump:2.57637 Ang L2.CG and Y6.CE1 other bump:2.83598 Ang L2.CD1 and Y6.CE1 other bump:2.72354 Ang L2.C and Y6.CD1 other bump:1.70492 Ang L2.O and Y6.CD1 Number of specific fragments= 1 total=578 # 1g8iA.42.48 read from T0129.t2k.frag # found chain 1g8iA in template set T0129 42 :LPLLYQFSN 1g8iA 49 :QKIYKQFFP Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=579 # 1hu4A.43.43 read from T0129.t2k.frag # found chain 1hu4A in template set T0129 43 :PLLYQFSND 1hu4A 44 :AAVKQLQAE Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=580 # 3nul.43.47 read from T0129.t2k.frag # found chain 3nul in training set T0129 43 :PLLYQFSND 3nul 49 :GIKKDFEEP Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.21507 Ang Q6.NE2 and G11.N Number of specific fragments= 1 total=581 # 1eyhA.43.43 read from T0129.t2k.frag # found chain 1eyhA in template set T0129 43 :PLLYQFSND 1eyhA 58 :SMIWKRLND Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.55991 Ang G1.O and Y5.CD1 Number of specific fragments= 1 total=582 # 1rec.43.49 read from T0129.t2k.frag # found chain 1rec in template set T0129 43 :PLLYQFSND 1rec 51 :TIYSKFFPE Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=583 # 1qmtA.43.50 read from T0129.t2k.frag # found chain 1qmtA in template set T0129 43 :PLLYQFSND 1qmtA 50 :NVVNVCGNQ Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues self-bump: 1.38068 Ang P2.N and P2.CD Number of specific fragments= 1 total=584 # 1l5jA.43.46 read from T0129.t2k.frag # found chain 1l5jA in template set T0129 43 :PLLYQFSND 1l5jA 47 :DLLTNRVPP Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.53163 Ang G1.O and Y5.CE1 other bump:3.11367 Ang G1.C and Y5.CE1 other bump:1.70492 Ang G1.O and Y5.CD1 other bump:2.72354 Ang G1.C and Y5.CD1 self-bump: 1.3719 Ang P2.CA and P2.CB Number of specific fragments= 1 total=585 # 1hu4A.44.44 read from T0129.t2k.frag # found chain 1hu4A in template set T0129 44 :LLYQFSNDN 1hu4A 45 :AVKQLQAEG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=586 # 3nul.44.48 read from T0129.t2k.frag # found chain 3nul in training set T0129 44 :LLYQFSNDN 3nul 50 :IKKDFEEPG Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.74014 Ang Q5.OE1 and G11.CA other bump:3.0707 Ang Q5.CD and G11.N other bump:2.21507 Ang Q5.NE2 and N10.N Number of specific fragments= 1 total=587 # 1eyhA.44.44 read from T0129.t2k.frag # found chain 1eyhA in template set T0129 44 :LLYQFSNDN 1eyhA 59 :MIWKRLNDH Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=588 # 1qmtA.44.51 read from T0129.t2k.frag # found chain 1qmtA in template set T0129 44 :LLYQFSNDN 1qmtA 51 :VVNVCGNQS Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=589 # 1l5jA.44.47 read from T0129.t2k.frag # found chain 1l5jA in template set T0129 44 :LLYQFSNDN 1l5jA 48 :LLTNRVPPG Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues self-bump: 2.21226 Ang N10.CB and N10.C self-bump: 1.33614 Ang N10.CA and N10.CB Number of specific fragments= 1 total=590 # 1kblA.44.44 read from T0129.t2k.frag # found chain 1kblA in template set T0129 44 :LLYQFSNDN 1kblA 46 :ACTEYYNSG Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.68698 Ang D9.C and N10.CB other bump:1.51001 Ang F6.O and D9.OD2 other bump:2.32482 Ang F6.C and D9.OD2 other bump:2.84919 Ang F6.CA and D9.OD2 other bump:3.25108 Ang F6.C and D9.CG Number of specific fragments= 1 total=591 # 1hu4A.45.45 read from T0129.t2k.frag # found chain 1hu4A in template set T0129 45 :LYQFSNDNH 1hu4A 46 :VKQLQAEGL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=592 # 3nul.45.49 read from T0129.t2k.frag # found chain 3nul in training set T0129 45 :LYQFSNDNH 3nul 51 :KKDFEEPGF Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:3.12627 Ang Q4.CD and G11.N other bump:1.97819 Ang Q4.OE1 and G11.N other bump:2.73217 Ang Q4.OE1 and H10.C other bump:3.22467 Ang Y3.CE1 and H10.CE1 other bump:3.03168 Ang Y3.CD1 and H10.ND1 other bump:2.74565 Ang Y3.CE1 and H10.ND1 other bump:2.77763 Ang Q4.OE1 and H10.CB other bump:2.74014 Ang Q4.OE1 and H10.CA other bump:3.0707 Ang Q4.CD and H10.N other bump:2.21507 Ang Q4.NE2 and N9.N Number of specific fragments= 1 total=593 # 1eyhA.45.45 read from T0129.t2k.frag # found chain 1eyhA in template set T0129 45 :LYQFSNDNH 1eyhA 60 :IWKRLNDHG Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues self-bump: 1.36418 Ang H10.CA and H10.CB Number of specific fragments= 1 total=594 # 1kblA.45.45 read from T0129.t2k.frag # found chain 1kblA in template set T0129 45 :LYQFSNDNH 1kblA 47 :CTEYYNSGK Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.51001 Ang F5.O and D8.OD2 other bump:2.32482 Ang F5.C and D8.OD2 other bump:2.84919 Ang F5.CA and D8.OD2 other bump:3.25108 Ang F5.C and D8.CG Number of specific fragments= 1 total=595 # 1hh7A.45.47 read from T0129.t2k.frag # found chain 1hh7A in template set T0129 45 :LYQFSNDNH 1hh7A 48 :NHNSGEAGL Fragment has 17 clashes (null) has 17 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.46944 Ang F5.CE1 and H10.NE2 other bump:2.66964 Ang F5.CZ and H10.NE2 other bump:2.86513 Ang F5.CE1 and H10.CE1 other bump:3.01075 Ang F5.CD1 and H10.ND1 other bump:2.3327 Ang F5.CE1 and H10.ND1 other bump:2.7817 Ang F5.CD1 and H10.CD2 other bump:1.40746 Ang F5.CE1 and H10.CD2 other bump:1.51315 Ang F5.CZ and H10.CD2 other bump:2.22702 Ang F5.CD1 and H10.CG other bump:1.21951 Ang F5.CE1 and H10.CG other bump:2.10546 Ang F5.CD1 and H10.CB other bump:1.8 Ang F5.CE1 and H10.CB other bump:2.80588 Ang F5.CZ and H10.CB other bump:2.43139 Ang F5.C and D8.OD2 other bump:1.48216 Ang F5.O and D8.OD2 other bump:3.27064 Ang F5.C and D8.CG other bump:2.13531 Ang Y3.CE2 and N7.OD1 Number of specific fragments= 1 total=596 # 1i8oA.45.47 read from T0129.t2k.frag # found chain 1i8oA in training set T0129 45 :LYQFSNDNH 1i8oA 48 :NHNSGEAGL Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.36288 Ang F5.C and D8.OD2 other bump:1.37726 Ang F5.O and D8.OD2 other bump:3.17079 Ang F5.C and D8.CG other bump:2.48075 Ang F5.O and D8.CG other bump:2.12066 Ang Y3.CE2 and N7.OD1 Number of specific fragments= 1 total=597 # 1eyhA.46.46 read from T0129.t2k.frag # found chain 1eyhA in template set T0129 46 :YQFSNDNHA 1eyhA 61 :WKRLNDHGK Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues self-bump: 1.36418 Ang H9.CA and H9.CB Number of specific fragments= 1 total=598 # 1hu4A.46.46 read from T0129.t2k.frag # found chain 1hu4A in template set T0129 46 :YQFSNDNHA 1hu4A 47 :KQLQAEGLS Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=599 # 3nul.46.50 read from T0129.t2k.frag # found chain 3nul in training set T0129 46 :YQFSNDNHA 3nul 52 :KDFEEPGFL Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:3.09275 Ang Q3.CD and A10.CB other bump:1.92068 Ang Q3.OE1 and A10.CB other bump:2.93445 Ang Q3.OE1 and A10.CA other bump:3.10368 Ang Y2.CD2 and H9.ND1 other bump:3.16163 Ang Y2.CE2 and H9.ND1 Number of specific fragments= 1 total=600 # 1h97A.46.49 read from T0129.t2k.frag # found chain 1h97A in training set T0129 46 :YQFSNDNHA 1h97A 50 :EGHTIENVM Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.61424 Ang Y2.CD1 and Q3.CG Number of specific fragments= 1 total=601 # 1hh7A.46.48 read from T0129.t2k.frag # found chain 1hh7A in template set T0129 46 :YQFSNDNHA 1hh7A 49 :HNSGEAGLV Fragment has 14 clashes (null) has 14 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.80496 Ang F4.CE1 and H9.CE1 other bump:3.06477 Ang F4.CD1 and H9.ND1 other bump:1.88416 Ang F4.CE1 and H9.ND1 other bump:2.55901 Ang F4.CZ and H9.ND1 other bump:2.67776 Ang F4.CD1 and H9.CD2 other bump:2.51387 Ang F4.CE1 and H9.CD2 other bump:2.18618 Ang F4.CD1 and H9.CG other bump:1.58716 Ang F4.CE1 and H9.CG other bump:2.06576 Ang F4.CD1 and H9.CB other bump:1.91266 Ang F4.CE1 and H9.CB other bump:2.43139 Ang F4.C and D7.OD2 other bump:1.48216 Ang F4.O and D7.OD2 other bump:3.27064 Ang F4.C and D7.CG other bump:2.49029 Ang Y2.CE2 and N6.OD1 Number of specific fragments= 1 total=602 # 1kblA.46.46 read from T0129.t2k.frag # found chain 1kblA in template set T0129 46 :YQFSNDNHA 1kblA 48 :TEYYNSGKQ Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.8634 Ang D7.OD1 and A10.C other bump:2.45755 Ang D7.CG and A10.O other bump:1.66437 Ang D7.OD1 and A10.O other bump:1.51001 Ang F4.O and D7.OD2 other bump:2.32482 Ang F4.C and D7.OD2 other bump:2.84919 Ang F4.CA and D7.OD2 other bump:3.25108 Ang F4.C and D7.CG Number of specific fragments= 1 total=603 # 1eyhA.47.47 read from T0129.t2k.frag # found chain 1eyhA in template set T0129 47 :QFSNDNHAY 1eyhA 62 :KRLNDHGKN Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.75237 Ang D6.OD1 and Y10.CD2 self-bump: 1.36418 Ang H8.CA and H8.CB Number of specific fragments= 1 total=604 # 1h97A.47.50 read from T0129.t2k.frag # found chain 1h97A in training set T0129 47 :QFSNDNHAY 1h97A 51 :GHTIENVMQ Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=605 # 3nul.47.51 read from T0129.t2k.frag # found chain 3nul in training set T0129 47 :QFSNDNHAY 3nul 53 :DFEEPGFLA Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.5902 Ang N7.O and Y10.CD2 other bump:3.04588 Ang Q2.CD and A9.CB Number of specific fragments= 1 total=606 # 1hu4A.47.47 read from T0129.t2k.frag # found chain 1hu4A in template set T0129 47 :QFSNDNHAY 1hu4A 48 :QLQAEGLSP Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.45226 Ang F3.CD1 and Y10.CE1 other bump:2.86249 Ang F3.CB and Y10.CE1 Number of specific fragments= 1 total=607 # 1hh7A.47.49 read from T0129.t2k.frag # found chain 1hh7A in template set T0129 47 :QFSNDNHAY 1hh7A 50 :NSGEAGLVW Fragment has 26 clashes (null) has 26 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:3.01871 Ang F3.CD1 and Y10.OH other bump:2.18222 Ang H8.CD2 and Y10.OH other bump:3.06658 Ang H8.CG and Y10.CZ other bump:1.75383 Ang H8.CD2 and Y10.CZ other bump:2.2624 Ang H8.NE2 and Y10.CZ other bump:2.93676 Ang H8.CG and Y10.CE2 other bump:1.6818 Ang H8.CD2 and Y10.CE2 other bump:3.26654 Ang H8.ND1 and Y10.CE2 other bump:2.5255 Ang H8.CE1 and Y10.CE2 other bump:1.23064 Ang H8.NE2 and Y10.CE2 other bump:2.67481 Ang H8.CD2 and Y10.CE1 other bump:1.60958 Ang H8.NE2 and Y10.CD2 other bump:2.72084 Ang H8.NE2 and Y10.CG other bump:2.80496 Ang F3.CE1 and H8.CE1 other bump:3.06477 Ang F3.CD1 and H8.ND1 other bump:1.88416 Ang F3.CE1 and H8.ND1 other bump:2.55901 Ang F3.CZ and H8.ND1 other bump:2.67776 Ang F3.CD1 and H8.CD2 other bump:2.51387 Ang F3.CE1 and H8.CD2 other bump:2.18618 Ang F3.CD1 and H8.CG other bump:1.58716 Ang F3.CE1 and H8.CG other bump:2.06576 Ang F3.CD1 and H8.CB other bump:1.91266 Ang F3.CE1 and H8.CB other bump:2.43139 Ang F3.C and D6.OD2 other bump:1.48216 Ang F3.O and D6.OD2 other bump:3.27064 Ang F3.C and D6.CG Number of specific fragments= 1 total=608 # 1i8oA.47.49 read from T0129.t2k.frag # found chain 1i8oA in training set T0129 47 :QFSNDNHAY 1i8oA 50 :NSGEAGLVW Fragment has 13 clashes (null) has 13 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.27264 Ang H8.CD2 and Y10.OH other bump:1.87214 Ang H8.CD2 and Y10.CZ other bump:2.37497 Ang H8.NE2 and Y10.CZ other bump:3.05161 Ang H8.CG and Y10.CE2 other bump:1.77285 Ang H8.CD2 and Y10.CE2 other bump:2.6733 Ang H8.CE1 and Y10.CE2 other bump:1.37445 Ang H8.NE2 and Y10.CE2 other bump:2.77722 Ang H8.CD2 and Y10.CE1 other bump:1.72863 Ang H8.NE2 and Y10.CD2 other bump:2.36288 Ang F3.C and D6.OD2 other bump:1.37726 Ang F3.O and D6.OD2 other bump:3.17079 Ang F3.C and D6.CG other bump:2.48075 Ang F3.O and D6.CG Number of specific fragments= 1 total=609 # 1eyhA.48.48 read from T0129.t2k.frag # found chain 1eyhA in template set T0129 48 :FSNDNHAYP 1eyhA 63 :RLNDHGKNW Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.40719 Ang A8.C and P10.CD neighbor-bump: 2.53287 Ang Y9.N and P10.CD other bump:3.08656 Ang A8.CA and P10.CD other bump:2.04034 Ang H7.O and P10.CD other bump:3.04369 Ang H7.C and P10.CD self-bump: 1.36418 Ang H7.CA and H7.CB Number of specific fragments= 1 total=610 # 1h97A.48.51 read from T0129.t2k.frag # found chain 1h97A in training set T0129 48 :FSNDNHAYP 1h97A 52 :HTIENVMQS Fragment has 9 clashes (null) has 9 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.72308 Ang A8.C and P10.CD neighbor-bump: 2.2197 Ang Y9.N and P10.CD other bump:3.29415 Ang A8.CA and P10.CD other bump:3.30458 Ang H7.CA and P10.CD other bump:1.74733 Ang H7.O and P10.CD other bump:2.34904 Ang H7.C and P10.CD other bump:2.94818 Ang H7.CA and P10.CG other bump:1.9773 Ang H7.O and P10.CG other bump:2.61649 Ang H7.C and P10.CG Number of specific fragments= 1 total=611 # 3nul.48.52 read from T0129.t2k.frag # found chain 3nul in training set T0129 48 :FSNDNHAYP 3nul 54 :FEEPGFLAP Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.5902 Ang N6.O and Y9.CD2 Number of specific fragments= 1 total=612 # 1hh7A.48.50 read from T0129.t2k.frag # found chain 1hh7A in template set T0129 48 :FSNDNHAYP 1hh7A 51 :SGEAGLVWT Fragment has 29 clashes (null) has 29 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.74758 Ang A8.O and P10.CD other bump:2.33223 Ang A8.C and P10.CD other bump:2.18224 Ang H7.CD2 and Y9.OH other bump:3.0666 Ang H7.CG and Y9.CZ other bump:1.75385 Ang H7.CD2 and Y9.CZ other bump:2.26241 Ang H7.NE2 and Y9.CZ other bump:2.93678 Ang H7.CG and Y9.CE2 other bump:1.68181 Ang H7.CD2 and Y9.CE2 other bump:3.26655 Ang H7.ND1 and Y9.CE2 other bump:2.52551 Ang H7.CE1 and Y9.CE2 other bump:1.23066 Ang H7.NE2 and Y9.CE2 other bump:2.67482 Ang H7.CD2 and Y9.CE1 other bump:1.60959 Ang H7.NE2 and Y9.CD2 other bump:2.72084 Ang H7.NE2 and Y9.CG other bump:2.69857 Ang F2.CE2 and H7.NE2 other bump:2.57117 Ang F2.CE2 and H7.CE1 other bump:3.13209 Ang F2.CZ and H7.CE1 other bump:3.17896 Ang F2.CD2 and H7.ND1 other bump:1.94157 Ang F2.CE2 and H7.ND1 other bump:2.25218 Ang F2.CZ and H7.ND1 other bump:2.21532 Ang F2.CE2 and H7.CD2 other bump:2.35766 Ang F2.CD2 and H7.CG other bump:1.63779 Ang F2.CE2 and H7.CG other bump:2.52534 Ang F2.CD2 and H7.CB other bump:2.30672 Ang F2.CE2 and H7.CB other bump:2.75721 Ang F2.CZ and H7.CB other bump:1.48216 Ang F2.O and D5.OD2 other bump:2.43139 Ang F2.C and D5.OD2 other bump:3.27064 Ang F2.C and D5.CG Number of specific fragments= 1 total=613 # 1i8oA.48.50 read from T0129.t2k.frag # found chain 1i8oA in training set T0129 48 :FSNDNHAYP 1i8oA 51 :SGEAGLVWT Fragment has 35 clashes (null) has 35 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.75456 Ang A8.O and P10.CD other bump:2.31331 Ang A8.C and P10.CD other bump:2.28593 Ang F2.CD2 and Y9.OH other bump:2.73859 Ang F2.CE2 and Y9.OH other bump:2.27265 Ang H7.CD2 and Y9.OH other bump:3.01077 Ang F2.CE2 and Y9.CZ other bump:1.87215 Ang H7.CD2 and Y9.CZ other bump:2.37498 Ang H7.NE2 and Y9.CZ other bump:3.05162 Ang H7.CG and Y9.CE2 other bump:1.77286 Ang H7.CD2 and Y9.CE2 other bump:2.67331 Ang H7.CE1 and Y9.CE2 other bump:1.37446 Ang H7.NE2 and Y9.CE2 other bump:2.77723 Ang H7.CD2 and Y9.CE1 other bump:1.72863 Ang H7.NE2 and Y9.CD2 other bump:2.36643 Ang F2.CE2 and H7.NE2 other bump:2.97396 Ang F2.CZ and H7.NE2 other bump:2.59871 Ang F2.CE2 and H7.CE1 other bump:2.54092 Ang F2.CZ and H7.CE1 other bump:2.98159 Ang F2.CE1 and H7.ND1 other bump:2.02047 Ang F2.CE2 and H7.ND1 other bump:1.64353 Ang F2.CZ and H7.ND1 other bump:2.37778 Ang F2.CD2 and H7.CD2 other bump:1.47608 Ang F2.CE2 and H7.CD2 other bump:2.58324 Ang F2.CZ and H7.CD2 other bump:2.34704 Ang F2.CD2 and H7.CG other bump:1.10056 Ang F2.CE2 and H7.CG other bump:1.66864 Ang F2.CZ and H7.CG other bump:2.42428 Ang F2.CD2 and H7.CB other bump:2.89942 Ang F2.CE1 and H7.CB other bump:1.87745 Ang F2.CE2 and H7.CB other bump:2.18762 Ang F2.CZ and H7.CB other bump:1.37726 Ang F2.O and D5.OD2 other bump:2.36288 Ang F2.C and D5.OD2 other bump:2.48075 Ang F2.O and D5.CG other bump:3.17079 Ang F2.C and D5.CG Number of specific fragments= 1 total=614 # 1hu4A.48.48 read from T0129.t2k.frag # found chain 1hu4A in template set T0129 48 :FSNDNHAYP 1hu4A 49 :LQAEGLSPR Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=615 # 1h97A.49.52 read from T0129.t2k.frag # found chain 1h97A in training set T0129 49 :SNDNHAYPT 1h97A 53 :TIENVMQSE Fragment has 8 clashes (null) has 8 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.77635 Ang A7.C and P9.CD other bump:1.70721 Ang H6.O and P9.CD neighbor-bump: 2.301 Ang Y8.N and P9.CD other bump:3.29875 Ang H6.CA and P9.CD other bump:2.34979 Ang H6.C and P9.CD other bump:2.10204 Ang H6.O and P9.CG other bump:2.98078 Ang H6.CA and P9.CG other bump:2.70687 Ang H6.C and P9.CG Number of specific fragments= 1 total=616 # 1eyhA.49.49 read from T0129.t2k.frag # found chain 1eyhA in template set T0129 49 :SNDNHAYPT 1eyhA 64 :LNDHGKNWR Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.40719 Ang A7.C and P9.CD neighbor-bump: 2.53287 Ang Y8.N and P9.CD other bump:3.08655 Ang A7.CA and P9.CD other bump:3.04369 Ang H6.C and P9.CD other bump:2.04034 Ang H6.O and P9.CD self-bump: 1.36418 Ang H6.CA and H6.CB Number of specific fragments= 1 total=617 # 1hh7A.49.51 read from T0129.t2k.frag # found chain 1hh7A in template set T0129 49 :SNDNHAYPT 1hh7A 52 :GEAGLVWTA Fragment has 17 clashes (null) has 17 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.7379 Ang A7.O and P9.CD other bump:2.42819 Ang A7.C and P9.CD other bump:2.18224 Ang H6.CD2 and Y8.OH other bump:3.0666 Ang H6.CG and Y8.CZ other bump:1.75385 Ang H6.CD2 and Y8.CZ other bump:2.26241 Ang H6.NE2 and Y8.CZ other bump:2.93678 Ang H6.CG and Y8.CE2 other bump:1.68181 Ang H6.CD2 and Y8.CE2 other bump:3.26655 Ang H6.ND1 and Y8.CE2 other bump:2.52551 Ang H6.CE1 and Y8.CE2 other bump:1.23066 Ang H6.NE2 and Y8.CE2 other bump:2.67482 Ang H6.CD2 and Y8.CE1 other bump:1.60959 Ang H6.NE2 and Y8.CD2 other bump:2.72084 Ang H6.NE2 and Y8.CG other bump:1.48216 Ang G1.O and D4.OD2 other bump:2.43139 Ang G1.C and D4.OD2 other bump:3.27064 Ang G1.C and D4.CG Number of specific fragments= 1 total=618 # 1i8oA.49.51 read from T0129.t2k.frag # found chain 1i8oA in training set T0129 49 :SNDNHAYPT 1i8oA 52 :GEAGLVWTA Fragment has 15 clashes (null) has 15 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.73002 Ang A7.O and P9.CD other bump:2.40027 Ang A7.C and P9.CD other bump:2.27265 Ang H6.CD2 and Y8.OH other bump:1.87215 Ang H6.CD2 and Y8.CZ other bump:2.37498 Ang H6.NE2 and Y8.CZ other bump:3.05162 Ang H6.CG and Y8.CE2 other bump:1.77286 Ang H6.CD2 and Y8.CE2 other bump:2.67331 Ang H6.CE1 and Y8.CE2 other bump:1.37446 Ang H6.NE2 and Y8.CE2 other bump:2.77723 Ang H6.CD2 and Y8.CE1 other bump:1.72863 Ang H6.NE2 and Y8.CD2 other bump:1.37726 Ang G1.O and D4.OD2 other bump:2.36288 Ang G1.C and D4.OD2 other bump:2.48075 Ang G1.O and D4.CG other bump:3.17079 Ang G1.C and D4.CG Number of specific fragments= 1 total=619 # 3nul.49.53 read from T0129.t2k.frag # found chain 3nul in training set T0129 49 :SNDNHAYPT 3nul 55 :EEPGFLAPT Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.5902 Ang N5.O and Y8.CD2 Number of specific fragments= 1 total=620 # 1bd3A.49.50 read from T0129.t2k.frag # found chain 1bd3A in template set T0129 49 :SNDNHAYPT 1bd3A 52 :IRDKETPKE Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.61065 Ang N5.ND2 and H6.CD2 Number of specific fragments= 1 total=621 # 1h97A.50.53 read from T0129.t2k.frag # found chain 1h97A in training set T0129 50 :NDNHAYPTG 1h97A 54 :IENVMQSEG Fragment has 8 clashes (null) has 8 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.77635 Ang A6.C and P8.CD other bump:1.70721 Ang H5.O and P8.CD other bump:2.34979 Ang H5.C and P8.CD neighbor-bump: 2.301 Ang Y7.N and P8.CD other bump:3.29875 Ang H5.CA and P8.CD other bump:2.10204 Ang H5.O and P8.CG other bump:2.70687 Ang H5.C and P8.CG other bump:2.98078 Ang H5.CA and P8.CG Number of specific fragments= 1 total=622 # 1eyhA.50.50 read from T0129.t2k.frag # found chain 1eyhA in template set T0129 50 :NDNHAYPTG 1eyhA 65 :NDHGKNWRH Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.40719 Ang A6.C and P8.CD neighbor-bump: 2.53287 Ang Y7.N and P8.CD other bump:3.08655 Ang A6.CA and P8.CD other bump:3.04369 Ang H5.C and P8.CD other bump:2.04034 Ang H5.O and P8.CD self-bump: 1.36418 Ang H5.CA and H5.CB Number of specific fragments= 1 total=623 # 1hh7A.50.52 read from T0129.t2k.frag # found chain 1hh7A in template set T0129 50 :NDNHAYPTG 1hh7A 53 :EAGLVWTAD Fragment has 14 clashes (null) has 14 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.7379 Ang A6.O and P8.CD other bump:2.42819 Ang A6.C and P8.CD other bump:2.18224 Ang H5.CD2 and Y7.OH other bump:3.0666 Ang H5.CG and Y7.CZ other bump:1.75385 Ang H5.CD2 and Y7.CZ other bump:2.26241 Ang H5.NE2 and Y7.CZ other bump:2.93678 Ang H5.CG and Y7.CE2 other bump:1.68181 Ang H5.CD2 and Y7.CE2 other bump:3.26655 Ang H5.ND1 and Y7.CE2 other bump:2.52551 Ang H5.CE1 and Y7.CE2 other bump:1.23066 Ang H5.NE2 and Y7.CE2 other bump:2.67482 Ang H5.CD2 and Y7.CE1 other bump:1.60959 Ang H5.NE2 and Y7.CD2 other bump:2.72084 Ang H5.NE2 and Y7.CG Number of specific fragments= 1 total=624 # 1i8oA.50.52 read from T0129.t2k.frag # found chain 1i8oA in training set T0129 50 :NDNHAYPTG 1i8oA 53 :EAGLVWTAD Fragment has 11 clashes (null) has 11 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.73002 Ang A6.O and P8.CD other bump:2.40027 Ang A6.C and P8.CD other bump:2.27265 Ang H5.CD2 and Y7.OH other bump:1.87215 Ang H5.CD2 and Y7.CZ other bump:2.37498 Ang H5.NE2 and Y7.CZ other bump:3.05162 Ang H5.CG and Y7.CE2 other bump:1.77286 Ang H5.CD2 and Y7.CE2 other bump:2.67331 Ang H5.CE1 and Y7.CE2 other bump:1.37446 Ang H5.NE2 and Y7.CE2 other bump:2.77723 Ang H5.CD2 and Y7.CE1 other bump:1.72863 Ang H5.NE2 and Y7.CD2 Number of specific fragments= 1 total=625 # 1bd3A.50.51 read from T0129.t2k.frag # found chain 1bd3A in template set T0129 50 :NDNHAYPTG 1bd3A 53 :RDKETPKEE Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.61065 Ang N4.ND2 and H5.CD2 Number of specific fragments= 1 total=626 # 3nul.50.54 read from T0129.t2k.frag # found chain 3nul in training set T0129 50 :NDNHAYPTG 3nul 56 :EPGFLAPTG Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.5902 Ang N4.O and Y7.CD2 Number of specific fragments= 1 total=627 # 1h97A.51.54 read from T0129.t2k.frag # found chain 1h97A in training set T0129 51 :DNHAYPTGL 1h97A 55 :ENVMQSEGI Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:3.01997 Ang A5.CA and L10.CD2 other bump:2.62091 Ang H4.NE2 and L10.CD1 other bump:2.77635 Ang A5.C and P7.CD neighbor-bump: 2.301 Ang Y6.N and P7.CD other bump:3.29875 Ang H4.CA and P7.CD other bump:2.34979 Ang H4.C and P7.CD other bump:1.70721 Ang H4.O and P7.CD other bump:2.98078 Ang H4.CA and P7.CG other bump:2.70687 Ang H4.C and P7.CG other bump:2.10204 Ang H4.O and P7.CG Number of specific fragments= 1 total=628 # 1eyhA.51.51 read from T0129.t2k.frag # found chain 1eyhA in template set T0129 51 :DNHAYPTGL 1eyhA 66 :DHGKNWRHV Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.40719 Ang A5.C and P7.CD neighbor-bump: 2.53287 Ang Y6.N and P7.CD other bump:3.08655 Ang A5.CA and P7.CD other bump:3.04369 Ang H4.C and P7.CD other bump:2.04034 Ang H4.O and P7.CD self-bump: 1.36418 Ang H4.CA and H4.CB Number of specific fragments= 1 total=629 # 1bd3A.51.52 read from T0129.t2k.frag # found chain 1bd3A in template set T0129 51 :DNHAYPTGL 1bd3A 54 :DKETPKEEF Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.61065 Ang N3.ND2 and H4.CD2 Number of specific fragments= 1 total=630 # 1hh7A.51.53 read from T0129.t2k.frag # found chain 1hh7A in template set T0129 51 :DNHAYPTGL 1hh7A 54 :AGLVWTADN Fragment has 16 clashes (null) has 16 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.50154 Ang A5.O and L10.CD1 other bump:3.04372 Ang P7.CD and L10.CD1 other bump:1.7379 Ang A5.O and P7.CD other bump:2.42819 Ang A5.C and P7.CD other bump:2.18224 Ang H4.CD2 and Y6.OH other bump:3.0666 Ang H4.CG and Y6.CZ other bump:1.75385 Ang H4.CD2 and Y6.CZ other bump:2.26241 Ang H4.NE2 and Y6.CZ other bump:2.93678 Ang H4.CG and Y6.CE2 other bump:1.68181 Ang H4.CD2 and Y6.CE2 other bump:2.52551 Ang H4.CE1 and Y6.CE2 other bump:1.23066 Ang H4.NE2 and Y6.CE2 other bump:3.26655 Ang H4.ND1 and Y6.CE2 other bump:2.67482 Ang H4.CD2 and Y6.CE1 other bump:1.60959 Ang H4.NE2 and Y6.CD2 other bump:2.72084 Ang H4.NE2 and Y6.CG Number of specific fragments= 1 total=631 # 1co6A.51.53 read from T0129.t2k.frag # found chain 1co6A in training set T0129 51 :DNHAYPTGL 1co6A 54 :SGITWTEEV Fragment has 23 clashes (null) has 23 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:3.02216 Ang P7.CD and L10.CD1 other bump:2.93768 Ang P7.CG and L10.CG other bump:1.79166 Ang A5.O and P7.CD other bump:2.62098 Ang A5.C and P7.CD other bump:2.57918 Ang H4.CG and Y6.OH other bump:1.56995 Ang H4.CD2 and Y6.OH other bump:1.7797 Ang H4.CE1 and Y6.OH other bump:0.589521 Ang H4.NE2 and Y6.OH other bump:2.87717 Ang H4.CG and Y6.CZ other bump:1.63641 Ang H4.CD2 and Y6.CZ other bump:2.99594 Ang H4.CE1 and Y6.CZ other bump:1.79335 Ang H4.NE2 and Y6.CZ other bump:1.90484 Ang H4.CD2 and Y6.CE2 other bump:2.56778 Ang H4.NE2 and Y6.CE2 other bump:2.7229 Ang H4.CD2 and Y6.CE1 other bump:1.77165 Ang D2.OD2 and H4.CE1 other bump:2.31089 Ang D2.CG and H4.CE1 other bump:2.44131 Ang D2.OD1 and H4.CE1 other bump:1.63037 Ang D2.OD2 and H4.ND1 other bump:1.71898 Ang D2.CG and H4.ND1 other bump:1.61099 Ang D2.OD1 and H4.ND1 other bump:2.54075 Ang D2.OD2 and H4.CG other bump:2.89675 Ang D2.CG and H4.CG Number of specific fragments= 1 total=632 # 1i8oA.51.53 read from T0129.t2k.frag # found chain 1i8oA in training set T0129 51 :DNHAYPTGL 1i8oA 54 :AGLVWTADN Fragment has 13 clashes (null) has 13 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.38872 Ang A5.O and L10.CD1 other bump:3.0148 Ang P7.CD and L10.CD1 other bump:1.73002 Ang A5.O and P7.CD other bump:2.40027 Ang A5.C and P7.CD other bump:2.27265 Ang H4.CD2 and Y6.OH other bump:1.87215 Ang H4.CD2 and Y6.CZ other bump:2.37498 Ang H4.NE2 and Y6.CZ other bump:3.05162 Ang H4.CG and Y6.CE2 other bump:1.77286 Ang H4.CD2 and Y6.CE2 other bump:2.67331 Ang H4.CE1 and Y6.CE2 other bump:1.37446 Ang H4.NE2 and Y6.CE2 other bump:2.77723 Ang H4.CD2 and Y6.CE1 other bump:1.72863 Ang H4.NE2 and Y6.CD2 Number of specific fragments= 1 total=633 # 1h97A.52.55 read from T0129.t2k.frag # found chain 1h97A in training set T0129 52 :NHAYPTGLV 1h97A 56 :NVMQSEGIK Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:3.01996 Ang A4.CA and L9.CD2 other bump:2.62091 Ang H3.NE2 and L9.CD1 other bump:2.77635 Ang A4.C and P6.CD other bump:1.70721 Ang H3.O and P6.CD neighbor-bump: 2.301 Ang Y5.N and P6.CD other bump:3.29875 Ang H3.CA and P6.CD other bump:2.34979 Ang H3.C and P6.CD other bump:2.10204 Ang H3.O and P6.CG other bump:2.98078 Ang H3.CA and P6.CG other bump:2.70687 Ang H3.C and P6.CG Number of specific fragments= 1 total=634 # 1eyhA.52.52 read from T0129.t2k.frag # found chain 1eyhA in template set T0129 52 :NHAYPTGLV 1eyhA 67 :HGKNWRHVY Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.40719 Ang A4.C and P6.CD neighbor-bump: 2.53287 Ang Y5.N and P6.CD other bump:2.04034 Ang H3.O and P6.CD other bump:3.04369 Ang H3.C and P6.CD other bump:3.08655 Ang A4.CA and P6.CD self-bump: 1.36418 Ang H3.CA and H3.CB Number of specific fragments= 1 total=635 # 1bd3A.52.53 read from T0129.t2k.frag # found chain 1bd3A in template set T0129 52 :NHAYPTGLV 1bd3A 55 :KETPKEEFV Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 3.03844 Ang N2.ND2 and H3.CD2 Number of specific fragments= 1 total=636 # 1k04A.52.52 read from T0129.t2k.frag # found chain 1k04A in template set T0129 52 :NHAYPTGLV 1k04A 943 :QPAPPEEYV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=637 # 1co6A.52.54 read from T0129.t2k.frag # found chain 1co6A in training set T0129 52 :NHAYPTGLV 1co6A 55 :GITWTEEVF Fragment has 15 clashes (null) has 15 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:3.02216 Ang P6.CD and L9.CD1 other bump:2.93768 Ang P6.CG and L9.CG other bump:1.79166 Ang A4.O and P6.CD other bump:2.62098 Ang A4.C and P6.CD other bump:0.589521 Ang H3.NE2 and Y5.OH other bump:1.7797 Ang H3.CE1 and Y5.OH other bump:2.57918 Ang H3.CG and Y5.OH other bump:1.56995 Ang H3.CD2 and Y5.OH other bump:1.79335 Ang H3.NE2 and Y5.CZ other bump:2.99594 Ang H3.CE1 and Y5.CZ other bump:2.87717 Ang H3.CG and Y5.CZ other bump:1.63641 Ang H3.CD2 and Y5.CZ other bump:2.56778 Ang H3.NE2 and Y5.CE2 other bump:1.90484 Ang H3.CD2 and Y5.CE2 other bump:2.7229 Ang H3.CD2 and Y5.CE1 Number of specific fragments= 1 total=638 # 1i5nA.52.53 read from T0129.t2k.frag # found chain 1i5nA in template set T0129 52 :NHAYPTGLV 1i5nA 54 :AGTFGFTIL Fragment has 17 clashes (null) has 17 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:3.14265 Ang N2.CG and G11.CA other bump:2.05763 Ang N2.ND2 and G11.CA other bump:2.67674 Ang N2.CG and G11.N other bump:1.7735 Ang N2.ND2 and G11.N other bump:2.87161 Ang N2.OD1 and T7.C other bump:2.43906 Ang N2.CG and T7.O other bump:2.14832 Ang N2.ND2 and T7.O other bump:2.16969 Ang N2.OD1 and T7.O other bump:2.6473 Ang N2.CA and T7.OG1 other bump:2.79329 Ang N2.CB and T7.OG1 other bump:2.11487 Ang N2.CG and T7.OG1 other bump:1.40131 Ang N2.OD1 and T7.OG1 other bump:2.08075 Ang N2.OD1 and T7.CB neighbor-bump: 1.9176 Ang Y5.O and P6.CD neighbor-bump: 1.49681 Ang Y5.C and P6.CD self-bump: 2.18139 Ang P6.CA and P6.CD neighbor-bump: 2.85126 Ang Y5.C and P6.CG Number of specific fragments= 1 total=639 # 1h97A.53.56 read from T0129.t2k.frag # found chain 1h97A in training set T0129 53 :HAYPTGLVQ 1h97A 57 :VMQSEGIKH Fragment has 9 clashes (null) has 9 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:3.01996 Ang A3.CA and L8.CD2 neighbor-bump: 2.301 Ang Y4.N and P5.CD other bump:3.29875 Ang H2.CA and P5.CD other bump:2.77635 Ang A3.C and P5.CD other bump:1.70721 Ang H2.O and P5.CD other bump:2.34979 Ang H2.C and P5.CD other bump:2.98078 Ang H2.CA and P5.CG other bump:2.10204 Ang H2.O and P5.CG other bump:2.70687 Ang H2.C and P5.CG Number of specific fragments= 1 total=640 # 1i5nA.53.54 read from T0129.t2k.frag # found chain 1i5nA in template set T0129 53 :HAYPTGLVQ 1i5nA 55 :GTFGFTILQ Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 1.9176 Ang Y4.O and P5.CD neighbor-bump: 1.49681 Ang Y4.C and P5.CD self-bump: 2.18139 Ang P5.CA and P5.CD neighbor-bump: 2.85126 Ang Y4.C and P5.CG Number of specific fragments= 1 total=641 # 1k04A.53.53 read from T0129.t2k.frag # found chain 1k04A in template set T0129 53 :HAYPTGLVQ 1k04A 944 :PAPPEEYVP Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=642 # 1eyhA.53.53 read from T0129.t2k.frag # found chain 1eyhA in template set T0129 53 :HAYPTGLVQ 1eyhA 68 :GKNWRHVYK Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:3.04369 Ang H2.C and P5.CD other bump:2.40719 Ang A3.C and P5.CD other bump:2.04034 Ang H2.O and P5.CD neighbor-bump: 2.53287 Ang Y4.N and P5.CD other bump:3.08655 Ang A3.CA and P5.CD self-bump: 1.36418 Ang H2.CA and H2.CB Number of specific fragments= 1 total=643 # 1bd3A.53.54 read from T0129.t2k.frag # found chain 1bd3A in template set T0129 53 :HAYPTGLVQ 1bd3A 56 :ETPKEEFVF Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=644 # 1co6A.53.55 read from T0129.t2k.frag # found chain 1co6A in training set T0129 53 :HAYPTGLVQ 1co6A 56 :ITWTEEVFR Fragment has 18 clashes (null) has 18 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:3.02216 Ang P5.CD and L8.CD1 other bump:2.93768 Ang P5.CG and L8.CG other bump:2.92836 Ang H2.CE1 and L8.CB other bump:1.79166 Ang A3.O and P5.CD other bump:2.62098 Ang A3.C and P5.CD other bump:2.97213 Ang H2.CG and Y4.CZ other bump:2.1571 Ang H2.CD2 and Y4.CZ other bump:2.68598 Ang H2.CG and Y4.CE2 other bump:1.74357 Ang H2.CD2 and Y4.CE2 other bump:2.33316 Ang H2.NE2 and Y4.CE2 other bump:2.58449 Ang H2.CD2 and Y4.CE1 other bump:3.05388 Ang H2.CG and Y4.CD2 other bump:1.81215 Ang H2.CD2 and Y4.CD2 other bump:1.62429 Ang H2.NE2 and Y4.CD2 other bump:2.60622 Ang H2.CD2 and Y4.CD1 other bump:2.29714 Ang H2.CD2 and Y4.CG other bump:2.1856 Ang H2.NE2 and Y4.CG other bump:2.96973 Ang H2.NE2 and Y4.CA Number of specific fragments= 1 total=645 # 1h97A.54.57 read from T0129.t2k.frag # found chain 1h97A in training set T0129 54 :AYPTGLVQP 1h97A 58 :MQSEGIKHY Fragment has 8 clashes (null) has 8 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.05233 Ang G6.O and P10.CD other bump:3.01996 Ang A2.CA and L7.CD2 other bump:2.77635 Ang A2.C and P4.CD neighbor-bump: 2.301 Ang Y3.N and P4.CD other bump:1.70721 Ang G1.O and P4.CD other bump:2.34979 Ang G1.C and P4.CD other bump:2.10204 Ang G1.O and P4.CG other bump:2.70687 Ang G1.C and P4.CG Number of specific fragments= 1 total=646 # 1i5nA.54.55 read from T0129.t2k.frag # found chain 1i5nA in template set T0129 54 :AYPTGLVQP 1i5nA 56 :TFGFTILQE Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 1.9176 Ang Y3.O and P4.CD neighbor-bump: 1.49681 Ang Y3.C and P4.CD self-bump: 2.18139 Ang P4.CA and P4.CD neighbor-bump: 2.85126 Ang Y3.C and P4.CG Number of specific fragments= 1 total=647 # 1k04A.54.54 read from T0129.t2k.frag # found chain 1k04A in template set T0129 54 :AYPTGLVQP 1k04A 945 :APPEEYVPM Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:3.08235 Ang L7.C and P10.CD other bump:1.69456 Ang G6.O and P10.CD other bump:2.91168 Ang G6.C and P10.CD other bump:2.20719 Ang G6.O and P10.CG other bump:3.25347 Ang G6.C and P10.CG Number of specific fragments= 1 total=648 # 1eyhA.54.54 read from T0129.t2k.frag # found chain 1eyhA in template set T0129 54 :AYPTGLVQP 1eyhA 69 :KNWRHVYKA Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.48183 Ang G6.O and P10.CD other bump:2.56656 Ang G6.C and P10.CD other bump:3.0186 Ang L7.C and P10.CD other bump:1.59501 Ang G6.O and P10.CG other bump:2.76517 Ang G6.C and P10.CG other bump:3.04369 Ang G1.C and P4.CD other bump:3.08655 Ang A2.CA and P4.CD other bump:2.40719 Ang A2.C and P4.CD other bump:2.04034 Ang G1.O and P4.CD neighbor-bump: 2.53287 Ang Y3.N and P4.CD Number of specific fragments= 1 total=649 # 1bd3A.54.55 read from T0129.t2k.frag # found chain 1bd3A in template set T0129 54 :AYPTGLVQP 1bd3A 57 :TPKEEFVFY Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.92279 Ang G6.C and P10.CD other bump:1.73073 Ang G6.O and P10.CD other bump:2.31295 Ang G6.O and P10.CG Number of specific fragments= 1 total=650 # 1ltsD.54.55 read from T0129.t2k.frag # found chain 1ltsD in template set T0129 54 :AYPTGLVQP 1ltsD 56 :QHIDSQKKA Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.59 Ang Q9.N and P10.CD other bump:2.94252 Ang L7.C and P10.CD other bump:2.42676 Ang G6.O and P10.CD other bump:2.51325 Ang P4.CG and L7.CD1 other bump:2.21343 Ang P4.CD and L7.CD1 other bump:2.80407 Ang P4.CG and L7.CG Number of specific fragments= 1 total=651 # 1h97A.55.58 read from T0129.t2k.frag # found chain 1h97A in training set T0129 55 :YPTGLVQPV 1h97A 59 :QSEGIKHYA Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.05233 Ang G5.O and P9.CD other bump:2.77635 Ang G1.C and P3.CD neighbor-bump: 2.301 Ang Y2.N and P3.CD Number of specific fragments= 1 total=652 # 1i5nA.55.56 read from T0129.t2k.frag # found chain 1i5nA in template set T0129 55 :YPTGLVQPV 1i5nA 57 :FGFTILQET Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 1.9176 Ang Y2.O and P3.CD neighbor-bump: 1.49682 Ang Y2.C and P3.CD self-bump: 2.18138 Ang P3.CA and P3.CD neighbor-bump: 2.85126 Ang Y2.C and P3.CG Number of specific fragments= 1 total=653 # 1k04A.55.55 read from T0129.t2k.frag # found chain 1k04A in template set T0129 55 :YPTGLVQPV 1k04A 946 :PPEEYVPMV Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:3.08235 Ang L6.C and P9.CD other bump:1.69456 Ang G5.O and P9.CD other bump:2.91168 Ang G5.C and P9.CD other bump:2.20719 Ang G5.O and P9.CG other bump:3.25348 Ang G5.C and P9.CG Number of specific fragments= 1 total=654 # 1ltsD.55.56 read from T0129.t2k.frag # found chain 1ltsD in template set T0129 55 :YPTGLVQPV 1ltsD 57 :HIDSQKKAI Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.59001 Ang Q8.N and P9.CD other bump:2.94252 Ang L6.C and P9.CD other bump:2.42675 Ang G5.O and P9.CD other bump:2.21344 Ang P3.CD and L6.CD1 other bump:2.51325 Ang P3.CG and L6.CD1 other bump:2.80407 Ang P3.CG and L6.CG Number of specific fragments= 1 total=655 # 1eyhA.55.55 read from T0129.t2k.frag # found chain 1eyhA in template set T0129 55 :YPTGLVQPV 1eyhA 70 :NWRHVYKAM Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.48183 Ang G5.O and P9.CD other bump:2.56656 Ang G5.C and P9.CD other bump:3.0186 Ang L6.C and P9.CD other bump:1.59501 Ang G5.O and P9.CG other bump:2.76517 Ang G5.C and P9.CG other bump:2.40718 Ang G1.C and P3.CD neighbor-bump: 2.53287 Ang Y2.N and P3.CD Number of specific fragments= 1 total=656 # 1djrD.55.56 read from T0129.t2k.frag # found chain 1djrD in template set T0129 55 :YPTGLVQPV 1djrD 57 :HIDSQKKAI Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.61815 Ang Q8.N and P9.CD other bump:2.99286 Ang L6.C and P9.CD other bump:2.4867 Ang P3.CG and L6.CD1 other bump:2.1374 Ang P3.CD and L6.CD1 other bump:2.913 Ang P3.CG and L6.CG Number of specific fragments= 1 total=657 # 1h97A.56.59 read from T0129.t2k.frag # found chain 1h97A in training set T0129 56 :PTGLVQPVT 1h97A 60 :SEGIKHYAR Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.05233 Ang G4.O and P8.CD Number of specific fragments= 1 total=658 # 1i5nA.56.57 read from T0129.t2k.frag # found chain 1i5nA in template set T0129 56 :PTGLVQPVT 1i5nA 58 :GFTILQETT Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 1.9176 Ang G1.O and P2.CD neighbor-bump: 1.49681 Ang G1.C and P2.CD self-bump: 2.18138 Ang P2.CA and P2.CD neighbor-bump: 2.85126 Ang G1.C and P2.CG Number of specific fragments= 1 total=659 # 1k04A.56.56 read from T0129.t2k.frag # found chain 1k04A in template set T0129 56 :PTGLVQPVT 1k04A 947 :PEEYVPMVK Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.69456 Ang G4.O and P8.CD other bump:2.91168 Ang G4.C and P8.CD other bump:3.08235 Ang L5.C and P8.CD other bump:2.20719 Ang G4.O and P8.CG other bump:3.25348 Ang G4.C and P8.CG Number of specific fragments= 1 total=660 # 1ltsD.56.57 read from T0129.t2k.frag # found chain 1ltsD in template set T0129 56 :PTGLVQPVT 1ltsD 58 :IDSQKKAIE Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.59001 Ang Q7.N and P8.CD other bump:2.94252 Ang L5.C and P8.CD other bump:2.42675 Ang G4.O and P8.CD other bump:2.1606 Ang P2.CD and L5.CD1 other bump:3.09473 Ang P2.CD and L5.CG Number of specific fragments= 1 total=661 # 1djrD.56.57 read from T0129.t2k.frag # found chain 1djrD in template set T0129 56 :PTGLVQPVT 1djrD 58 :IDSQKKAIE Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.99286 Ang L5.C and P8.CD neighbor-bump: 2.61815 Ang Q7.N and P8.CD other bump:2.083 Ang P2.CD and L5.CD1 other bump:3.11502 Ang P2.CD and L5.CG Number of specific fragments= 1 total=662 # 1avoB.56.57 read from T0129.t2k.frag # found chain 1avoB in template set T0129 56 :PTGLVQPVT 1avoB 160 :MTSLHTKLE Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=663 # 1h97A.57.60 read from T0129.t2k.frag # found chain 1h97A in training set T0129 57 :TGLVQPVTE 1h97A 61 :EGIKHYART Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.05233 Ang G3.O and P7.CD Number of specific fragments= 1 total=664 # 1i5nA.57.58 read from T0129.t2k.frag # found chain 1i5nA in template set T0129 57 :TGLVQPVTE 1i5nA 59 :FTILQETTH Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=665 # 1ltsD.57.58 read from T0129.t2k.frag # found chain 1ltsD in template set T0129 57 :TGLVQPVTE 1ltsD 59 :DSQKKAIER Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.59001 Ang Q6.N and P7.CD other bump:2.94252 Ang L4.C and P7.CD other bump:2.42675 Ang G3.O and P7.CD Number of specific fragments= 1 total=666 # 1avoB.57.58 read from T0129.t2k.frag # found chain 1avoB in template set T0129 57 :TGLVQPVTE 1avoB 161 :TSLHTKLEG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=667 # 1k04A.57.57 read from T0129.t2k.frag # found chain 1k04A in template set T0129 57 :TGLVQPVTE 1k04A 948 :EEYVPMVKE Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.69456 Ang G3.O and P7.CD other bump:2.91168 Ang G3.C and P7.CD other bump:3.08235 Ang L4.C and P7.CD other bump:2.20719 Ang G3.O and P7.CG other bump:3.25348 Ang G3.C and P7.CG Number of specific fragments= 1 total=668 # 1djrD.57.58 read from T0129.t2k.frag # found chain 1djrD in template set T0129 57 :TGLVQPVTE 1djrD 59 :DSQKKAIER Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.61815 Ang Q6.N and P7.CD other bump:2.99286 Ang L4.C and P7.CD Number of specific fragments= 1 total=669 # 1h97A.58.61 read from T0129.t2k.frag # found chain 1h97A in training set T0129 58 :GLVQPVTEL 1h97A 62 :GIKHYARTL Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.05233 Ang G2.O and P6.CD Number of specific fragments= 1 total=670 # 1i5nA.58.59 read from T0129.t2k.frag # found chain 1i5nA in template set T0129 58 :GLVQPVTEL 1i5nA 60 :TILQETTHL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=671 # 1avoB.58.59 read from T0129.t2k.frag # found chain 1avoB in template set T0129 58 :GLVQPVTEL 1avoB 162 :SLHTKLEGF Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=672 # 1ltsD.58.59 read from T0129.t2k.frag # found chain 1ltsD in template set T0129 58 :GLVQPVTEL 1ltsD 60 :SQKKAIERM Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.59001 Ang Q5.N and P6.CD other bump:2.94252 Ang L3.C and P6.CD other bump:2.42675 Ang G2.O and P6.CD Number of specific fragments= 1 total=673 # 1djrD.58.59 read from T0129.t2k.frag # found chain 1djrD in template set T0129 58 :GLVQPVTEL 1djrD 60 :SQKKAIERM Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.61815 Ang Q5.N and P6.CD other bump:2.99286 Ang L3.C and P6.CD Number of specific fragments= 1 total=674 # 1k04A.58.58 read from T0129.t2k.frag # found chain 1k04A in template set T0129 58 :GLVQPVTEL 1k04A 949 :EYVPMVKEV Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:3.08235 Ang L3.C and P6.CD other bump:1.69456 Ang G2.O and P6.CD other bump:2.91168 Ang G2.C and P6.CD other bump:2.20719 Ang G2.O and P6.CG other bump:3.25348 Ang G2.C and P6.CG Number of specific fragments= 1 total=675 # 1h97A.59.62 read from T0129.t2k.frag # found chain 1h97A in training set T0129 59 :LVQPVTELY 1h97A 63 :IKHYARTLT Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.05233 Ang G1.O and P5.CD Number of specific fragments= 1 total=676 # 1i5nA.59.60 read from T0129.t2k.frag # found chain 1i5nA in template set T0129 59 :LVQPVTELY 1i5nA 61 :ILQETTHLM Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=677 # 1avoB.59.60 read from T0129.t2k.frag # found chain 1avoB in template set T0129 59 :LVQPVTELY 1avoB 163 :LHTKLEGFH Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=678 # 1ltsD.59.60 read from T0129.t2k.frag # found chain 1ltsD in template set T0129 59 :LVQPVTELY 1ltsD 61 :QKKAIERMK Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.94252 Ang L2.C and P5.CD neighbor-bump: 2.59001 Ang Q4.N and P5.CD other bump:2.42675 Ang G1.O and P5.CD Number of specific fragments= 1 total=679 # 1djrD.59.60 read from T0129.t2k.frag # found chain 1djrD in template set T0129 59 :LVQPVTELY 1djrD 61 :QKKAIERMK Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.99286 Ang L2.C and P5.CD neighbor-bump: 2.61815 Ang Q4.N and P5.CD Number of specific fragments= 1 total=680 # 1dxtB.59.60 read from T0129.t2k.frag # found chain 1dxtB in template set T0129 59 :LVQPVTELY 1dxtB 61 :VKAHGKKVL Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:3.12415 Ang L2.C and P5.CD other bump:1.36881 Ang G1.O and P5.CD other bump:2.57678 Ang G1.C and P5.CD other bump:2.01788 Ang G1.O and P5.CG other bump:3.15168 Ang G1.C and P5.CG Number of specific fragments= 1 total=681 # 1h97A.60.63 read from T0129.t2k.frag # found chain 1h97A in training set T0129 60 :VQPVTELYE 1h97A 64 :KHYARTLTE Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=682 # 1i5nA.60.61 read from T0129.t2k.frag # found chain 1i5nA in template set T0129 60 :VQPVTELYE 1i5nA 62 :LQETTHLME Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=683 # 1avoB.60.61 read from T0129.t2k.frag # found chain 1avoB in template set T0129 60 :VQPVTELYE 1avoB 164 :HTKLEGFHT Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=684 # 1ltsD.60.61 read from T0129.t2k.frag # found chain 1ltsD in template set T0129 60 :VQPVTELYE 1ltsD 62 :KKAIERMKD Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.59001 Ang Q3.N and P4.CD other bump:2.94252 Ang G1.C and P4.CD Number of specific fragments= 1 total=685 # 1dxtB.60.61 read from T0129.t2k.frag # found chain 1dxtB in template set T0129 60 :VQPVTELYE 1dxtB 62 :KAHGKKVLG Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:3.12414 Ang G1.C and P4.CD Number of specific fragments= 1 total=686 # 1djrD.60.61 read from T0129.t2k.frag # found chain 1djrD in template set T0129 60 :VQPVTELYE 1djrD 62 :KKAIERMKD Fragment has 8 clashes (null) has 8 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.45171 Ang T6.CG2 and E10.OE2 other bump:1.27613 Ang T6.O and E10.OE1 other bump:2.07741 Ang T6.C and E10.OE1 other bump:2.41163 Ang E7.CA and E10.OE1 other bump:2.04211 Ang T6.O and E10.CD other bump:2.92371 Ang T6.C and E10.CD other bump:2.99286 Ang G1.C and P4.CD neighbor-bump: 2.61815 Ang Q3.N and P4.CD Number of specific fragments= 1 total=687 # 1h97A.61.64 read from T0129.t2k.frag # found chain 1h97A in training set T0129 61 :QPVTELYEQ 1h97A 65 :HYARTLTEA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=688 # 1i5nA.61.62 read from T0129.t2k.frag # found chain 1i5nA in template set T0129 61 :QPVTELYEQ 1i5nA 63 :QETTHLMEN Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=689 # 1dxtB.61.62 read from T0129.t2k.frag # found chain 1dxtB in template set T0129 61 :QPVTELYEQ 1dxtB 63 :AHGKKVLGA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=690 # 1avoB.61.62 read from T0129.t2k.frag # found chain 1avoB in template set T0129 61 :QPVTELYEQ 1avoB 165 :TKLEGFHTQ Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=691 # 1ltsD.61.62 read from T0129.t2k.frag # found chain 1ltsD in template set T0129 61 :QPVTELYEQ 1ltsD 63 :KAIERMKDT Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.59 Ang Q2.N and P3.CD Number of specific fragments= 1 total=692 # 1djrD.61.62 read from T0129.t2k.frag # found chain 1djrD in template set T0129 61 :QPVTELYEQ 1djrD 63 :KAIERMKDT Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.45172 Ang T5.CG2 and E9.OE2 other bump:1.27613 Ang T5.O and E9.OE1 other bump:2.07741 Ang T5.C and E9.OE1 other bump:2.41164 Ang E6.CA and E9.OE1 other bump:2.04211 Ang T5.O and E9.CD other bump:2.92371 Ang T5.C and E9.CD neighbor-bump: 2.61815 Ang Q2.N and P3.CD Number of specific fragments= 1 total=693 # 1h97A.62.65 read from T0129.t2k.frag # found chain 1h97A in training set T0129 62 :PVTELYEQI 1h97A 66 :YARTLTEAI Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=694 # 1i5nA.62.63 read from T0129.t2k.frag # found chain 1i5nA in template set T0129 62 :PVTELYEQI 1i5nA 64 :ETTHLMENL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=695 # 1dxtB.62.63 read from T0129.t2k.frag # found chain 1dxtB in template set T0129 62 :PVTELYEQI 1dxtB 64 :HGKKVLGAF Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=696 # 1avoB.62.63 read from T0129.t2k.frag # found chain 1avoB in template set T0129 62 :PVTELYEQI 1avoB 166 :KLEGFHTQI Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=697 # 1ltsD.62.63 read from T0129.t2k.frag # found chain 1ltsD in template set T0129 62 :PVTELYEQI 1ltsD 64 :AIERMKDTL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=698 # 1djrD.62.63 read from T0129.t2k.frag # found chain 1djrD in template set T0129 62 :PVTELYEQI 1djrD 64 :AIERMKDTL Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.45172 Ang T4.CG2 and E8.OE2 other bump:1.27613 Ang T4.O and E8.OE1 other bump:2.07741 Ang T4.C and E8.OE1 other bump:2.41164 Ang E5.CA and E8.OE1 other bump:2.04211 Ang T4.O and E8.CD other bump:2.92371 Ang T4.C and E8.CD Number of specific fragments= 1 total=699 # 1h97A.63.66 read from T0129.t2k.frag # found chain 1h97A in training set T0129 63 :VTELYEQIS 1h97A 67 :ARTLTEAIV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=700 # 1i5nA.63.64 read from T0129.t2k.frag # found chain 1i5nA in template set T0129 63 :VTELYEQIS 1i5nA 65 :TTHLMENLL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=701 # 1dxtB.63.64 read from T0129.t2k.frag # found chain 1dxtB in template set T0129 63 :VTELYEQIS 1dxtB 65 :GKKVLGAFS Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=702 # 1ltsD.63.64 read from T0129.t2k.frag # found chain 1ltsD in template set T0129 63 :VTELYEQIS 1ltsD 65 :IERMKDTLR Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=703 # 1avoB.63.64 read from T0129.t2k.frag # found chain 1avoB in template set T0129 63 :VTELYEQIS 1avoB 167 :LEGFHTQIS Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=704 # 1djrD.63.64 read from T0129.t2k.frag # found chain 1djrD in template set T0129 63 :VTELYEQIS 1djrD 65 :IERMKDTLR Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.45172 Ang T3.CG2 and E7.OE2 other bump:1.27613 Ang T3.O and E7.OE1 other bump:2.07741 Ang T3.C and E7.OE1 other bump:2.41164 Ang E4.CA and E7.OE1 other bump:2.04211 Ang T3.O and E7.CD other bump:2.92371 Ang T3.C and E7.CD Number of specific fragments= 1 total=705 # 1h97A.64.67 read from T0129.t2k.frag # found chain 1h97A in training set T0129 64 :TELYEQISQ 1h97A 68 :RTLTEAIVH Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=706 # 1dxtB.64.65 read from T0129.t2k.frag # found chain 1dxtB in template set T0129 64 :TELYEQISQ 1dxtB 66 :KKVLGAFSD Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=707 # 1i5nA.64.65 read from T0129.t2k.frag # found chain 1i5nA in template set T0129 64 :TELYEQISQ 1i5nA 66 :THLMENLLD Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=708 # 1ltsD.64.65 read from T0129.t2k.frag # found chain 1ltsD in template set T0129 64 :TELYEQISQ 1ltsD 66 :ERMKDTLRI Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=709 # 1avoB.64.65 read from T0129.t2k.frag # found chain 1avoB in template set T0129 64 :TELYEQISQ 1avoB 168 :EGFHTQISK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=710 # 1djrD.64.65 read from T0129.t2k.frag # found chain 1djrD in template set T0129 64 :TELYEQISQ 1djrD 66 :ERMKDTLRI Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.45172 Ang T2.CG2 and E6.OE2 other bump:2.07741 Ang T2.C and E6.OE1 other bump:1.27613 Ang T2.O and E6.OE1 other bump:2.41163 Ang E3.CA and E6.OE1 other bump:2.92371 Ang T2.C and E6.CD other bump:2.04211 Ang T2.O and E6.CD Number of specific fragments= 1 total=711 # 1h97A.65.68 read from T0129.t2k.frag # found chain 1h97A in training set T0129 65 :ELYEQISQT 1h97A 69 :TLTEAIVHM Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=712 # 1dxtB.65.66 read from T0129.t2k.frag # found chain 1dxtB in template set T0129 65 :ELYEQISQT 1dxtB 67 :KVLGAFSDG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=713 # 1i5nA.65.66 read from T0129.t2k.frag # found chain 1i5nA in template set T0129 65 :ELYEQISQT 1i5nA 67 :HLMENLLDE Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=714 # 1ltsD.65.66 read from T0129.t2k.frag # found chain 1ltsD in template set T0129 65 :ELYEQISQT 1ltsD 67 :RMKDTLRIT Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=715 # 1f4qA.65.66 read from T0129.t2k.frag # found chain 1f4qA in template set T0129 65 :ELYEQISQT 1f4qA 119 :AALNAWKEN Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=716 # 1avoB.65.66 read from T0129.t2k.frag # found chain 1avoB in template set T0129 65 :ELYEQISQT 1avoB 169 :GFHTQISKY Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.36364 Ang E2.CG and Q6.NE2 other bump:2.60704 Ang E2.CD and Q6.NE2 Number of specific fragments= 1 total=717 # 1h97A.66.69 read from T0129.t2k.frag # found chain 1h97A in training set T0129 66 :LYEQISQTL 1h97A 70 :LTEAIVHML Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=718 # 1dxtB.66.67 read from T0129.t2k.frag # found chain 1dxtB in template set T0129 66 :LYEQISQTL 1dxtB 68 :VLGAFSDGL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=719 # 1i5nA.66.67 read from T0129.t2k.frag # found chain 1i5nA in template set T0129 66 :LYEQISQTL 1i5nA 68 :LMENLLDEA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=720 # 1f4qA.66.67 read from T0129.t2k.frag # found chain 1f4qA in template set T0129 66 :LYEQISQTL 1f4qA 120 :ALNAWKENF Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=721 # 1ltsD.66.67 read from T0129.t2k.frag # found chain 1ltsD in template set T0129 66 :LYEQISQTL 1ltsD 68 :MKDTLRITY Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=722 # 1irdB.66.66 read from T0129.t2k.frag # found chain 1irdB in template set T0129 66 :LYEQISQTL 1irdB 267 :VLGAFSDGL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=723 # 1h97A.67.70 read from T0129.t2k.frag # found chain 1h97A in training set T0129 67 :YEQISQTLS 1h97A 71 :TEAIVHMLK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=724 # 1dxtB.67.68 read from T0129.t2k.frag # found chain 1dxtB in template set T0129 67 :YEQISQTLS 1dxtB 69 :LGAFSDGLA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=725 # 1i5nA.67.68 read from T0129.t2k.frag # found chain 1i5nA in template set T0129 67 :YEQISQTLS 1i5nA 69 :MENLLDEAR Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=726 # 1f4qA.67.68 read from T0129.t2k.frag # found chain 1f4qA in template set T0129 67 :YEQISQTLS 1f4qA 121 :LNAWKENFM Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=727 # 1irdB.67.67 read from T0129.t2k.frag # found chain 1irdB in template set T0129 67 :YEQISQTLS 1irdB 268 :LGAFSDGLA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=728 # 1babB.67.67 read from T0129.t2k.frag # found chain 1babB in template set T0129 67 :YEQISQTLS 1babB 68 :LGAFSDGLA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=729 # 1h97A.68.71 read from T0129.t2k.frag # found chain 1h97A in training set T0129 68 :EQISQTLSD 1h97A 72 :EAIVHMLKE Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=730 # 1dxtB.68.69 read from T0129.t2k.frag # found chain 1dxtB in template set T0129 68 :EQISQTLSD 1dxtB 70 :GAFSDGLAH Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=731 # 1i5nA.68.69 read from T0129.t2k.frag # found chain 1i5nA in template set T0129 68 :EQISQTLSD 1i5nA 70 :ENLLDEARR Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=732 # 1f4qA.68.69 read from T0129.t2k.frag # found chain 1f4qA in template set T0129 68 :EQISQTLSD 1f4qA 122 :NAWKENFMT Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.6131 Ang Q6.C and D10.OD1 other bump:2.52789 Ang T7.CA and D10.OD1 other bump:2.79739 Ang T7.C and D10.OD1 other bump:1.83487 Ang Q6.O and D10.OD1 other bump:3.22154 Ang Q6.C and D10.CG other bump:2.32402 Ang Q6.O and D10.CG Number of specific fragments= 1 total=733 # 1hdcA.68.70 read from T0129.t2k.frag # found chain 1hdcA in template set T0129 68 :EQISQTLSD 1hdcA 72 :AYAREEFGS Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 1.98123 Ang L8.O and S9.OG neighbor-bump: 2.64209 Ang L8.C and S9.OG neighbor-bump: 2.15959 Ang L8.O and S9.CB neighbor-bump: 2.61547 Ang L8.C and S9.CB self-bump: 1.37147 Ang Q6.CA and Q6.CB Number of specific fragments= 1 total=734 # 2hsdA.68.70 read from T0129.t2k.frag # found chain 2hsdA in template set T0129 68 :EQISQTLSD 2hsdA 72 :AYAREEFGS Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 1.87298 Ang L8.O and S9.OG neighbor-bump: 2.63254 Ang L8.C and S9.OG Number of specific fragments= 1 total=735 # 1h97A.69.72 read from T0129.t2k.frag # found chain 1h97A in training set T0129 69 :QISQTLSDV 1h97A 73 :AIVHMLKEI Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=736 # 1dxtB.69.70 read from T0129.t2k.frag # found chain 1dxtB in template set T0129 69 :QISQTLSDV 1dxtB 71 :AFSDGLAHL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=737 # 1i5nA.69.70 read from T0129.t2k.frag # found chain 1i5nA in template set T0129 69 :QISQTLSDV 1i5nA 71 :NLLDEARRG Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.48911 Ang D9.C and V10.CB neighbor-bump: 2.17032 Ang D9.O and V10.CB Number of specific fragments= 1 total=738 # 1f4qA.69.70 read from T0129.t2k.frag # found chain 1f4qA in template set T0129 69 :QISQTLSDV 1f4qA 123 :AWKENFMTV Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.62559 Ang T6.CG2 and V10.CG1 Number of specific fragments= 1 total=739 # 1hdcA.69.71 read from T0129.t2k.frag # found chain 1hdcA in template set T0129 69 :QISQTLSDV 1hdcA 73 :YAREEFGSV Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 1.98123 Ang L7.O and S8.OG neighbor-bump: 2.64209 Ang L7.C and S8.OG neighbor-bump: 2.15959 Ang L7.O and S8.CB neighbor-bump: 2.61547 Ang L7.C and S8.CB self-bump: 1.37147 Ang Q5.CA and Q5.CB Number of specific fragments= 1 total=740 # 2hsdA.69.71 read from T0129.t2k.frag # found chain 2hsdA in template set T0129 69 :QISQTLSDV 2hsdA 73 :YAREEFGSV Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.74579 Ang S4.OG and V10.CG2 neighbor-bump: 1.87298 Ang L7.O and S8.OG neighbor-bump: 2.63254 Ang L7.C and S8.OG Number of specific fragments= 1 total=741 # 1h97A.70.73 read from T0129.t2k.frag # found chain 1h97A in training set T0129 70 :ISQTLSDVE 1h97A 74 :IVHMLKEIS Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=742 # 1dxtB.70.71 read from T0129.t2k.frag # found chain 1dxtB in template set T0129 70 :ISQTLSDVE 1dxtB 72 :FSDGLAHLD Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=743 # 1hdcA.70.72 read from T0129.t2k.frag # found chain 1hdcA in template set T0129 70 :ISQTLSDVE 1hdcA 74 :AREEFGSVD Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 1.98123 Ang L6.O and S7.OG neighbor-bump: 2.64209 Ang L6.C and S7.OG neighbor-bump: 2.15959 Ang L6.O and S7.CB neighbor-bump: 2.61547 Ang L6.C and S7.CB self-bump: 1.37147 Ang Q4.CA and Q4.CB Number of specific fragments= 1 total=744 # 2hsdA.70.72 read from T0129.t2k.frag # found chain 2hsdA in template set T0129 70 :ISQTLSDVE 2hsdA 74 :AREEFGSVD Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.74579 Ang S3.OG and V9.CG2 neighbor-bump: 1.87298 Ang L6.O and S7.OG neighbor-bump: 2.63254 Ang L6.C and S7.OG Number of specific fragments= 1 total=745 # 1f4qA.70.71 read from T0129.t2k.frag # found chain 1f4qA in template set T0129 70 :ISQTLSDV 1f4qA 124 :WKENFMTV Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 10 residues other bump:2.62559 Ang T5.CG2 and V9.CG1 Number of specific fragments= 1 total=746 # 1i5nA.70.71 read from T0129.t2k.frag # found chain 1i5nA in template set T0129 70 :ISQTLSDVE 1i5nA 72 :LLDEARRGE Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.17032 Ang D8.O and V9.CB neighbor-bump: 2.4891 Ang D8.C and V9.CB Number of specific fragments= 1 total=747 # 1h97A.71.74 read from T0129.t2k.frag # found chain 1h97A in training set T0129 71 :SQTLSDVEG 1h97A 75 :VHMLKEISN Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=748 # 1dxtB.71.72 read from T0129.t2k.frag # found chain 1dxtB in template set T0129 71 :SQTLSDVEG 1dxtB 73 :SDGLAHLDN Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=749 # 2hsdA.71.73 read from T0129.t2k.frag # found chain 2hsdA in template set T0129 71 :SQTLSDVEG 2hsdA 75 :REEFGSVDG Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.74579 Ang S2.OG and V8.CG2 neighbor-bump: 1.87298 Ang L5.O and S6.OG neighbor-bump: 2.63254 Ang L5.C and S6.OG Number of specific fragments= 1 total=750 # 1hdcA.71.73 read from T0129.t2k.frag # found chain 1hdcA in template set T0129 71 :SQTLSDVEG 1hdcA 75 :REEFGSVDG Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 1.98123 Ang L5.O and S6.OG neighbor-bump: 2.64209 Ang L5.C and S6.OG neighbor-bump: 2.15959 Ang L5.O and S6.CB neighbor-bump: 2.61547 Ang L5.C and S6.CB self-bump: 1.37147 Ang Q3.CA and Q3.CB Number of specific fragments= 1 total=751 # 1f4qA.71.72 read from T0129.t2k.frag # found chain 1f4qA in template set T0129 71 :SQTLSDV 1f4qA 125 :KENFMTV Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 9 residues other bump:2.62559 Ang T4.CG2 and V8.CG1 Number of specific fragments= 1 total=752 # 1i5nA.71.72 read from T0129.t2k.frag # found chain 1i5nA in template set T0129 71 :SQTLSDVEG 1i5nA 73 :LDEARRGEM Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.17032 Ang D7.O and V8.CB neighbor-bump: 2.4891 Ang D7.C and V8.CB Number of specific fragments= 1 total=753 # 1h97A.72.75 read from T0129.t2k.frag # found chain 1h97A in training set T0129 72 :QTLSDVEGF 1h97A 76 :HMLKEISND Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=754 # 1dxtB.72.73 read from T0129.t2k.frag # found chain 1dxtB in template set T0129 72 :QTLSDVEGF 1dxtB 74 :DGLAHLDNL Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:3.02349 Ang V7.CA and F10.CZ other bump:2.51227 Ang V7.CA and F10.CE2 Number of specific fragments= 1 total=755 # 2hsdA.72.74 read from T0129.t2k.frag # found chain 2hsdA in template set T0129 72 :QTLSDVEGF 2hsdA 76 :EEFGSVDGL Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 1.87298 Ang L4.O and S5.OG neighbor-bump: 2.63254 Ang L4.C and S5.OG Number of specific fragments= 1 total=756 # 1hdcA.72.74 read from T0129.t2k.frag # found chain 1hdcA in template set T0129 72 :QTLSDVEGF 1hdcA 76 :EEFGSVDGL Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 1.98123 Ang L4.O and S5.OG neighbor-bump: 2.64209 Ang L4.C and S5.OG neighbor-bump: 2.15959 Ang L4.O and S5.CB neighbor-bump: 2.61547 Ang L4.C and S5.CB self-bump: 1.37147 Ang Q2.CA and Q2.CB Number of specific fragments= 1 total=757 # 1f4qA.72.73 read from T0129.t2k.frag # found chain 1f4qA in template set T0129 72 :QTLSDV 1f4qA 126 :ENFMTV Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 8 residues other bump:2.62559 Ang T3.CG2 and V7.CG1 Number of specific fragments= 1 total=758 # 1ltsD.72.73 read from T0129.t2k.frag # found chain 1ltsD in template set T0129 72 :QTLSDVEGF 1ltsD 74 :ITYLTETKI Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.65277 Ang T3.CG2 and F10.CZ other bump:2.37182 Ang T3.CG2 and F10.CE1 other bump:2.09607 Ang D6.CB and E8.OE2 other bump:2.82174 Ang D6.CB and E8.CD Number of specific fragments= 1 total=759 # 1ltsD.73.74 read from T0129.t2k.frag # found chain 1ltsD in template set T0129 73 :TLSDVEGFT 1ltsD 75 :TYLTETKID Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.85419 Ang T2.CG2 and F9.CZ other bump:2.09607 Ang D5.CB and E7.OE2 other bump:2.82174 Ang D5.CB and E7.CD Number of specific fragments= 1 total=760 # 1h97A.73.76 read from T0129.t2k.frag # found chain 1h97A in training set T0129 73 :TLSDVEGFT 1h97A 77 :MLKEISNDA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=761 # 1djrD.73.74 read from T0129.t2k.frag # found chain 1djrD in template set T0129 73 :TLSDVEGFT 1djrD 75 :TYLTETKID Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues self-bump: 1.38703 Ang T10.CA and T10.CB other bump:2.72425 Ang T2.CG2 and F9.CZ other bump:1.62653 Ang D5.CB and E7.OE2 other bump:2.46262 Ang D5.CG and E7.OE2 other bump:2.42633 Ang D5.CB and E7.CD Number of specific fragments= 1 total=762 # 1dxtB.73.74 read from T0129.t2k.frag # found chain 1dxtB in template set T0129 73 :TLSDVEGFT 1dxtB 75 :GLAHLDNLK Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:3.02349 Ang V6.CA and F9.CZ other bump:2.51228 Ang V6.CA and F9.CE2 Number of specific fragments= 1 total=763 # 1f4qA.73.74 read from T0129.t2k.frag # found chain 1f4qA in template set T0129 73 :TLSDV 1f4qA 127 :NFMTV Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 7 residues other bump:2.62559 Ang T2.CG2 and V6.CG1 Number of specific fragments= 1 total=764 # 2hsdA.73.75 read from T0129.t2k.frag # found chain 2hsdA in template set T0129 73 :TLSDVEGFT 2hsdA 77 :EFGSVDGLV Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 1.87298 Ang L3.O and S4.OG neighbor-bump: 2.63254 Ang L3.C and S4.OG Number of specific fragments= 1 total=765 # 1ltsD.74.75 read from T0129.t2k.frag # found chain 1ltsD in template set T0129 74 :LSDVEGFTF 1ltsD 76 :YLTETKIDK Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.09607 Ang D4.CB and E6.OE2 other bump:2.82174 Ang D4.CB and E6.CD Number of specific fragments= 1 total=766 # 1gqvA.74.75 read from T0129.t2k.frag # found chain 1gqvA in template set T0129 74 :LSDVEGFTF 1gqvA 75 :GSQVPLIHC Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=767 # 1hi2A.74.75 read from T0129.t2k.frag # found chain 1hi2A in training set T0129 74 :LSDVEGFTF 1hi2A 75 :GSQVPLIHC Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=768 # 1djrD.74.75 read from T0129.t2k.frag # found chain 1djrD in template set T0129 74 :LSDVEGFTF 1djrD 76 :YLTETKIDK Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues self-bump: 1.38703 Ang T9.CA and T9.CB other bump:1.62653 Ang D4.CB and E6.OE2 other bump:2.46262 Ang D4.CG and E6.OE2 other bump:2.42633 Ang D4.CB and E6.CD Number of specific fragments= 1 total=769 # 1efiD.74.75 read from T0129.t2k.frag # found chain 1efiD in template set T0129 74 :LSDVEGFTF 1efiD 76 :YLTETKIDK Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.6166 Ang D4.CB and E6.OE2 other bump:2.39975 Ang D4.CG and E6.OE2 other bump:2.35133 Ang G1.O and E6.OE1 other bump:3.29225 Ang D4.CA and E6.CD other bump:2.37955 Ang D4.CB and E6.CD Number of specific fragments= 1 total=770 # 1dxtB.74.75 read from T0129.t2k.frag # found chain 1dxtB in template set T0129 74 :LSDVEGFTF 1dxtB 76 :LAHLDNLKG Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:3.02349 Ang V5.CA and F8.CZ other bump:2.51228 Ang V5.CA and F8.CE2 Number of specific fragments= 1 total=771 # 1gqvA.75.76 read from T0129.t2k.frag # found chain 1gqvA in template set T0129 75 :SDVEGFTFE 1gqvA 76 :SQVPLIHCN Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=772 # 1hi2A.75.76 read from T0129.t2k.frag # found chain 1hi2A in training set T0129 75 :SDVEGFTFE 1hi2A 76 :SQVPLIHCN Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=773 # 1ltsD.75.76 read from T0129.t2k.frag # found chain 1ltsD in template set T0129 75 :SDVEGFTFE 1ltsD 77 :LTETKIDKL Fragment has 15 clashes (null) has 15 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.57947 Ang T8.CG2 and F9.CE1 neighbor-bump: 2.53826 Ang T8.CG2 and F9.CD1 other bump:2.0942 Ang D3.CB and E5.OE2 other bump:1.03958 Ang D3.CG and E5.OE2 other bump:1.97753 Ang D3.OD1 and E5.OE2 other bump:0.793166 Ang D3.OD2 and E5.OE2 other bump:1.76834 Ang D3.CG and E5.OE1 other bump:0.941238 Ang D3.OD1 and E5.OE1 other bump:2.28462 Ang D3.OD2 and E5.OE1 other bump:2.82502 Ang D3.CB and E5.CD other bump:1.43263 Ang D3.CG and E5.CD other bump:1.38904 Ang D3.OD1 and E5.CD other bump:1.6249 Ang D3.OD2 and E5.CD other bump:2.86139 Ang D3.CG and E5.CG other bump:2.64685 Ang D3.OD1 and E5.CG Number of specific fragments= 1 total=774 # 1pysB.75.79 read from T0129.t2k.frag # found chain 1pysB in template set T0129 75 :SDVEGFTFE 1pysB 80 :NARKGIGVA Fragment has 23 clashes (null) has 23 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:0.556339 Ang F7.CE1 and F9.CZ other bump:1.04636 Ang F7.CZ and F9.CZ other bump:2.82659 Ang F7.CG and F9.CZ other bump:1.93056 Ang F7.CD1 and F9.CZ other bump:2.29076 Ang F7.CE2 and F9.CZ other bump:1.5423 Ang F7.CE1 and F9.CE2 other bump:2.24644 Ang F7.CZ and F9.CE2 other bump:2.58035 Ang F7.CD1 and F9.CE2 other bump:1.22846 Ang F7.CE1 and F9.CE1 other bump:1.96596 Ang F7.CZ and F9.CE1 other bump:1.93091 Ang F7.CD1 and F9.CE1 other bump:2.89302 Ang F7.CE2 and F9.CE1 other bump:2.37913 Ang F7.CE1 and F9.CD2 other bump:2.19246 Ang F7.CE1 and F9.CD1 other bump:2.58879 Ang F7.CD1 and F9.CD1 other bump:2.95741 Ang V4.N and F7.CZ other bump:2.64265 Ang V4.O and F7.CZ other bump:2.95866 Ang V4.CA and F7.CE2 other bump:2.43001 Ang V4.N and F7.CE2 other bump:1.48478 Ang V4.O and F7.CE2 other bump:2.45957 Ang V4.C and F7.CE2 other bump:1.96899 Ang V4.O and F7.CD2 other bump:3.05597 Ang V4.C and F7.CD2 Number of specific fragments= 1 total=775 # 1eiyB.75.79 read from T0129.t2k.frag # found chain 1eiyB in template set T0129 75 :SDVEGFTFE 1eiyB 80 :NARKGIGVA Fragment has 20 clashes (null) has 20 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.02146 Ang F7.CD1 and F9.CZ other bump:0.709533 Ang F7.CE1 and F9.CZ other bump:2.37989 Ang F7.CE2 and F9.CZ other bump:1.17034 Ang F7.CZ and F9.CZ other bump:2.93706 Ang F7.CG and F9.CZ other bump:2.56899 Ang F7.CD1 and F9.CE2 other bump:1.393 Ang F7.CE1 and F9.CE2 other bump:1.92554 Ang F7.CZ and F9.CE2 other bump:2.09199 Ang F7.CD1 and F9.CE1 other bump:1.54205 Ang F7.CE1 and F9.CE1 other bump:2.4302 Ang F7.CZ and F9.CE1 other bump:3.07072 Ang F7.CD1 and F9.CD2 other bump:2.29402 Ang F7.CE1 and F9.CD2 other bump:2.68546 Ang F7.CD1 and F9.CD1 other bump:2.38834 Ang F7.CE1 and F9.CD1 other bump:3.19713 Ang V4.CA and F7.CE2 other bump:2.09239 Ang V4.O and F7.CE2 other bump:2.47323 Ang V4.N and F7.CE2 other bump:2.93698 Ang V4.C and F7.CE2 other bump:2.5388 Ang V4.O and F7.CD2 Number of specific fragments= 1 total=776 # 1b7yB.75.79 read from T0129.t2k.frag # found chain 1b7yB in template set T0129 75 :SDVEGFTFE 1b7yB 80 :NARKGIGVA Fragment has 25 clashes (null) has 25 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:0.275845 Ang F7.CE1 and F9.CZ other bump:2.15769 Ang F7.CE2 and F9.CZ other bump:1.18029 Ang F7.CZ and F9.CZ other bump:1.4686 Ang F7.CD1 and F9.CZ other bump:2.37697 Ang F7.CG and F9.CZ other bump:2.60962 Ang F7.CD2 and F9.CZ other bump:1.4759 Ang F7.CE1 and F9.CE2 other bump:2.14444 Ang F7.CZ and F9.CE2 other bump:2.25 Ang F7.CD1 and F9.CE2 other bump:1.14482 Ang F7.CE1 and F9.CE1 other bump:3.08616 Ang F7.CE2 and F9.CE1 other bump:2.22823 Ang F7.CZ and F9.CE1 other bump:1.55512 Ang F7.CD1 and F9.CE1 other bump:2.67424 Ang F7.CG and F9.CE1 other bump:2.35046 Ang F7.CE1 and F9.CD2 other bump:2.87283 Ang F7.CD1 and F9.CD2 other bump:2.16315 Ang F7.CE1 and F9.CD1 other bump:2.37234 Ang F7.CD1 and F9.CD1 other bump:2.86588 Ang V4.N and F7.CZ other bump:2.22276 Ang V4.N and F7.CE2 other bump:2.88454 Ang V4.CA and F7.CE2 other bump:2.6698 Ang V4.C and F7.CE2 other bump:1.91603 Ang V4.O and F7.CE2 other bump:2.14505 Ang V4.O and F7.CD2 neighbor-bump: 2.90069 Ang D3.C and V4.CG1 Number of specific fragments= 1 total=777 # 1hi2A.76.77 read from T0129.t2k.frag # found chain 1hi2A in training set T0129 76 :DVEGFTFEL 1hi2A 77 :QVPLIHCNL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=778 # 1gqvA.76.77 read from T0129.t2k.frag # found chain 1gqvA in template set T0129 76 :DVEGFTFEL 1gqvA 77 :QVPLIHCNL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=779 # 1pysB.76.80 read from T0129.t2k.frag # found chain 1pysB in template set T0129 76 :DVEGFTFEL 1pysB 81 :ARKGIGVAL Fragment has 23 clashes (null) has 23 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.93056 Ang F6.CD1 and F8.CZ other bump:0.556339 Ang F6.CE1 and F8.CZ other bump:2.29076 Ang F6.CE2 and F8.CZ other bump:1.04636 Ang F6.CZ and F8.CZ other bump:2.82659 Ang F6.CG and F8.CZ other bump:2.58035 Ang F6.CD1 and F8.CE2 other bump:1.5423 Ang F6.CE1 and F8.CE2 other bump:2.24644 Ang F6.CZ and F8.CE2 other bump:1.93091 Ang F6.CD1 and F8.CE1 other bump:1.22846 Ang F6.CE1 and F8.CE1 other bump:2.89302 Ang F6.CE2 and F8.CE1 other bump:1.96596 Ang F6.CZ and F8.CE1 other bump:2.37913 Ang F6.CE1 and F8.CD2 other bump:2.58879 Ang F6.CD1 and F8.CD1 other bump:2.19246 Ang F6.CE1 and F8.CD1 other bump:2.64265 Ang V3.O and F6.CZ other bump:2.95741 Ang V3.N and F6.CZ other bump:1.48478 Ang V3.O and F6.CE2 other bump:2.43001 Ang V3.N and F6.CE2 other bump:2.95866 Ang V3.CA and F6.CE2 other bump:2.45957 Ang V3.C and F6.CE2 other bump:1.96899 Ang V3.O and F6.CD2 other bump:3.05597 Ang V3.C and F6.CD2 Number of specific fragments= 1 total=780 # 1b7yB.76.80 read from T0129.t2k.frag # found chain 1b7yB in template set T0129 76 :DVEGFTFEL 1b7yB 81 :ARKGIGVAL Fragment has 25 clashes (null) has 25 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.37697 Ang F6.CG and F8.CZ other bump:1.4686 Ang F6.CD1 and F8.CZ other bump:2.60962 Ang F6.CD2 and F8.CZ other bump:0.275845 Ang F6.CE1 and F8.CZ other bump:2.15769 Ang F6.CE2 and F8.CZ other bump:1.18029 Ang F6.CZ and F8.CZ other bump:2.25 Ang F6.CD1 and F8.CE2 other bump:1.4759 Ang F6.CE1 and F8.CE2 other bump:2.14444 Ang F6.CZ and F8.CE2 other bump:2.67424 Ang F6.CG and F8.CE1 other bump:1.55512 Ang F6.CD1 and F8.CE1 other bump:1.14482 Ang F6.CE1 and F8.CE1 other bump:3.08616 Ang F6.CE2 and F8.CE1 other bump:2.22823 Ang F6.CZ and F8.CE1 other bump:2.87283 Ang F6.CD1 and F8.CD2 other bump:2.35046 Ang F6.CE1 and F8.CD2 other bump:2.37234 Ang F6.CD1 and F8.CD1 other bump:2.16315 Ang F6.CE1 and F8.CD1 other bump:2.86588 Ang V3.N and F6.CZ other bump:2.88454 Ang V3.CA and F6.CE2 other bump:2.22276 Ang V3.N and F6.CE2 other bump:1.91603 Ang V3.O and F6.CE2 other bump:2.6698 Ang V3.C and F6.CE2 other bump:2.14505 Ang V3.O and F6.CD2 neighbor-bump: 2.90069 Ang D2.C and V3.CG1 Number of specific fragments= 1 total=781 # 1eiyB.76.80 read from T0129.t2k.frag # found chain 1eiyB in template set T0129 76 :DVEGFTFEL 1eiyB 81 :ARKGIGVAL Fragment has 20 clashes (null) has 20 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.17034 Ang F6.CZ and F8.CZ other bump:2.02146 Ang F6.CD1 and F8.CZ other bump:0.709533 Ang F6.CE1 and F8.CZ other bump:2.37989 Ang F6.CE2 and F8.CZ other bump:2.93706 Ang F6.CG and F8.CZ other bump:1.92554 Ang F6.CZ and F8.CE2 other bump:2.56899 Ang F6.CD1 and F8.CE2 other bump:1.393 Ang F6.CE1 and F8.CE2 other bump:2.4302 Ang F6.CZ and F8.CE1 other bump:2.09199 Ang F6.CD1 and F8.CE1 other bump:1.54205 Ang F6.CE1 and F8.CE1 other bump:3.07072 Ang F6.CD1 and F8.CD2 other bump:2.29402 Ang F6.CE1 and F8.CD2 other bump:2.68546 Ang F6.CD1 and F8.CD1 other bump:2.38834 Ang F6.CE1 and F8.CD1 other bump:2.47323 Ang V3.N and F6.CE2 other bump:2.09239 Ang V3.O and F6.CE2 other bump:3.19713 Ang V3.CA and F6.CE2 other bump:2.93698 Ang V3.C and F6.CE2 other bump:2.5388 Ang V3.O and F6.CD2 Number of specific fragments= 1 total=782 # 1pne.76.79 read from T0129.t2k.frag # found chain 1pne in training set T0129 76 :DVEGFTFEL 1pne 79 :QDGEFTMDL Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.34079 Ang F8.CE2 and L10.CD2 other bump:2.90048 Ang F8.CE2 and L10.CD1 other bump:2.76448 Ang F8.CD2 and L10.CD1 other bump:2.31487 Ang F8.CE2 and L10.CG other bump:2.84329 Ang F8.CD2 and L10.CG Number of specific fragments= 1 total=783 # 1pysB.77.81 read from T0129.t2k.frag # found chain 1pysB in template set T0129 77 :VEGFTFELG 1pysB 82 :RKGIGVALA Fragment has 23 clashes (null) has 23 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:0.556339 Ang F5.CE1 and F7.CZ other bump:2.29076 Ang F5.CE2 and F7.CZ other bump:1.04636 Ang F5.CZ and F7.CZ other bump:2.82659 Ang F5.CG and F7.CZ other bump:1.93056 Ang F5.CD1 and F7.CZ other bump:1.5423 Ang F5.CE1 and F7.CE2 other bump:2.24644 Ang F5.CZ and F7.CE2 other bump:2.58035 Ang F5.CD1 and F7.CE2 other bump:1.22846 Ang F5.CE1 and F7.CE1 other bump:2.89302 Ang F5.CE2 and F7.CE1 other bump:1.96596 Ang F5.CZ and F7.CE1 other bump:1.93091 Ang F5.CD1 and F7.CE1 other bump:2.37913 Ang F5.CE1 and F7.CD2 other bump:2.19246 Ang F5.CE1 and F7.CD1 other bump:2.58879 Ang F5.CD1 and F7.CD1 other bump:2.95741 Ang V2.N and F5.CZ other bump:2.64265 Ang V2.O and F5.CZ other bump:2.43001 Ang V2.N and F5.CE2 other bump:1.48478 Ang V2.O and F5.CE2 other bump:2.95866 Ang V2.CA and F5.CE2 other bump:2.45957 Ang V2.C and F5.CE2 other bump:1.96899 Ang V2.O and F5.CD2 other bump:3.05597 Ang V2.C and F5.CD2 Number of specific fragments= 1 total=784 # 1b7yB.77.81 read from T0129.t2k.frag # found chain 1b7yB in template set T0129 77 :VEGFTFELG 1b7yB 82 :RKGIGVALA Fragment has 25 clashes (null) has 25 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.4686 Ang F5.CD1 and F7.CZ other bump:2.60962 Ang F5.CD2 and F7.CZ other bump:0.275845 Ang F5.CE1 and F7.CZ other bump:2.15769 Ang F5.CE2 and F7.CZ other bump:1.18029 Ang F5.CZ and F7.CZ other bump:2.37697 Ang F5.CG and F7.CZ other bump:2.25 Ang F5.CD1 and F7.CE2 other bump:1.4759 Ang F5.CE1 and F7.CE2 other bump:2.14444 Ang F5.CZ and F7.CE2 other bump:1.55512 Ang F5.CD1 and F7.CE1 other bump:1.14482 Ang F5.CE1 and F7.CE1 other bump:3.08616 Ang F5.CE2 and F7.CE1 other bump:2.22823 Ang F5.CZ and F7.CE1 other bump:2.67424 Ang F5.CG and F7.CE1 other bump:2.87283 Ang F5.CD1 and F7.CD2 other bump:2.35046 Ang F5.CE1 and F7.CD2 other bump:2.37234 Ang F5.CD1 and F7.CD1 other bump:2.16315 Ang F5.CE1 and F7.CD1 other bump:2.86588 Ang V2.N and F5.CZ other bump:2.22276 Ang V2.N and F5.CE2 other bump:1.91603 Ang V2.O and F5.CE2 other bump:2.88454 Ang V2.CA and F5.CE2 other bump:2.6698 Ang V2.C and F5.CE2 other bump:2.14505 Ang V2.O and F5.CD2 neighbor-bump: 2.90069 Ang G1.C and V2.CG1 Number of specific fragments= 1 total=785 # 1eiyB.77.81 read from T0129.t2k.frag # found chain 1eiyB in template set T0129 77 :VEGFTFELG 1eiyB 82 :RKGIGVALA Fragment has 20 clashes (null) has 20 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.02146 Ang F5.CD1 and F7.CZ other bump:0.709533 Ang F5.CE1 and F7.CZ other bump:2.37989 Ang F5.CE2 and F7.CZ other bump:1.17034 Ang F5.CZ and F7.CZ other bump:2.93706 Ang F5.CG and F7.CZ other bump:2.56899 Ang F5.CD1 and F7.CE2 other bump:1.393 Ang F5.CE1 and F7.CE2 other bump:1.92554 Ang F5.CZ and F7.CE2 other bump:2.09199 Ang F5.CD1 and F7.CE1 other bump:1.54205 Ang F5.CE1 and F7.CE1 other bump:2.4302 Ang F5.CZ and F7.CE1 other bump:3.07072 Ang F5.CD1 and F7.CD2 other bump:2.29402 Ang F5.CE1 and F7.CD2 other bump:2.68546 Ang F5.CD1 and F7.CD1 other bump:2.38834 Ang F5.CE1 and F7.CD1 other bump:2.47323 Ang V2.N and F5.CE2 other bump:2.09239 Ang V2.O and F5.CE2 other bump:3.19713 Ang V2.CA and F5.CE2 other bump:2.93698 Ang V2.C and F5.CE2 other bump:2.5388 Ang V2.O and F5.CD2 Number of specific fragments= 1 total=786 # 1hi2A.77.78 read from T0129.t2k.frag # found chain 1hi2A in training set T0129 77 :VEGFTFELG 1hi2A 78 :VPLIHCNLT Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=787 # 1gqvA.77.78 read from T0129.t2k.frag # found chain 1gqvA in template set T0129 77 :VEGFTFELG 1gqvA 78 :VPLIHCNLT Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=788 # 1ltsD.77.78 read from T0129.t2k.frag # found chain 1ltsD in template set T0129 77 :VEGFTFELG 1ltsD 79 :ETKIDKLCV Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.57947 Ang T6.CG2 and F7.CE1 neighbor-bump: 2.53826 Ang T6.CG2 and F7.CD1 Number of specific fragments= 1 total=789 # 1b7yB.78.82 read from T0129.t2k.frag # found chain 1b7yB in template set T0129 78 :EGFTFELGL 1b7yB 83 :KGIGVALAL Fragment has 21 clashes (null) has 21 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.37697 Ang F4.CG and F6.CZ other bump:1.4686 Ang F4.CD1 and F6.CZ other bump:2.60962 Ang F4.CD2 and F6.CZ other bump:0.275845 Ang F4.CE1 and F6.CZ other bump:2.15769 Ang F4.CE2 and F6.CZ other bump:1.18029 Ang F4.CZ and F6.CZ other bump:2.25 Ang F4.CD1 and F6.CE2 other bump:1.4759 Ang F4.CE1 and F6.CE2 other bump:2.14444 Ang F4.CZ and F6.CE2 other bump:2.67424 Ang F4.CG and F6.CE1 other bump:1.55512 Ang F4.CD1 and F6.CE1 other bump:1.14482 Ang F4.CE1 and F6.CE1 other bump:3.08616 Ang F4.CE2 and F6.CE1 other bump:2.22823 Ang F4.CZ and F6.CE1 other bump:2.87283 Ang F4.CD1 and F6.CD2 other bump:2.35046 Ang F4.CE1 and F6.CD2 other bump:2.37234 Ang F4.CD1 and F6.CD1 other bump:2.16315 Ang F4.CE1 and F6.CD1 other bump:1.91603 Ang G1.O and F4.CE2 other bump:2.6698 Ang G1.C and F4.CE2 other bump:2.14505 Ang G1.O and F4.CD2 Number of specific fragments= 1 total=790 # 1pysB.78.82 read from T0129.t2k.frag # found chain 1pysB in template set T0129 78 :EGFTFELGL 1pysB 83 :KGIGVALAL Fragment has 20 clashes (null) has 20 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.93056 Ang F4.CD1 and F6.CZ other bump:0.556339 Ang F4.CE1 and F6.CZ other bump:2.29076 Ang F4.CE2 and F6.CZ other bump:1.04636 Ang F4.CZ and F6.CZ other bump:2.82659 Ang F4.CG and F6.CZ other bump:2.58035 Ang F4.CD1 and F6.CE2 other bump:1.5423 Ang F4.CE1 and F6.CE2 other bump:2.24644 Ang F4.CZ and F6.CE2 other bump:1.93091 Ang F4.CD1 and F6.CE1 other bump:1.22846 Ang F4.CE1 and F6.CE1 other bump:2.89302 Ang F4.CE2 and F6.CE1 other bump:1.96596 Ang F4.CZ and F6.CE1 other bump:2.37913 Ang F4.CE1 and F6.CD2 other bump:2.58879 Ang F4.CD1 and F6.CD1 other bump:2.19246 Ang F4.CE1 and F6.CD1 other bump:2.64265 Ang G1.O and F4.CZ other bump:1.48478 Ang G1.O and F4.CE2 other bump:2.45957 Ang G1.C and F4.CE2 other bump:1.96899 Ang G1.O and F4.CD2 other bump:3.05597 Ang G1.C and F4.CD2 Number of specific fragments= 1 total=791 # 1hi2A.78.79 read from T0129.t2k.frag # found chain 1hi2A in training set T0129 78 :EGFTFELGL 1hi2A 79 :PLIHCNLTT Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=792 # 1gqvA.78.79 read from T0129.t2k.frag # found chain 1gqvA in template set T0129 78 :EGFTFELGL 1gqvA 79 :PLIHCNLTT Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=793 # 1eiyB.78.82 read from T0129.t2k.frag # found chain 1eiyB in template set T0129 78 :EGFTFELGL 1eiyB 83 :KGIGVALAL Fragment has 18 clashes (null) has 18 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.17034 Ang F4.CZ and F6.CZ other bump:2.02146 Ang F4.CD1 and F6.CZ other bump:0.709533 Ang F4.CE1 and F6.CZ other bump:2.37989 Ang F4.CE2 and F6.CZ other bump:2.93706 Ang F4.CG and F6.CZ other bump:1.92554 Ang F4.CZ and F6.CE2 other bump:2.56899 Ang F4.CD1 and F6.CE2 other bump:1.393 Ang F4.CE1 and F6.CE2 other bump:2.4302 Ang F4.CZ and F6.CE1 other bump:2.09199 Ang F4.CD1 and F6.CE1 other bump:1.54205 Ang F4.CE1 and F6.CE1 other bump:3.07072 Ang F4.CD1 and F6.CD2 other bump:2.29402 Ang F4.CE1 and F6.CD2 other bump:2.68546 Ang F4.CD1 and F6.CD1 other bump:2.38834 Ang F4.CE1 and F6.CD1 other bump:2.09239 Ang G1.O and F4.CE2 other bump:2.93698 Ang G1.C and F4.CE2 other bump:2.5388 Ang G1.O and F4.CD2 Number of specific fragments= 1 total=794 # 7ahlA.78.81 read from T0129.t2k.frag # found chain 7ahlA in template set T0129 78 :EGFTFELGL 7ahlA 82 :SAFKVQLQL Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.89503 Ang F6.CE2 and L8.CD1 Number of specific fragments= 1 total=795 # 1gqvA.79.80 read from T0129.t2k.frag # found chain 1gqvA in template set T0129 79 :GFTFELGLT 1gqvA 80 :LIHCNLTTP Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=796 # 1hi2A.79.80 read from T0129.t2k.frag # found chain 1hi2A in training set T0129 79 :GFTFELGLT 1hi2A 80 :LIHCNLTTP Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.76862 Ang L7.CD2 and T10.CG2 Number of specific fragments= 1 total=797 # 1pysB.79.83 read from T0129.t2k.frag # found chain 1pysB in template set T0129 79 :GFTFELGLT 1pysB 84 :GIGVALALP Fragment has 15 clashes (null) has 15 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:0.556339 Ang F3.CE1 and F5.CZ other bump:2.29076 Ang F3.CE2 and F5.CZ other bump:1.04636 Ang F3.CZ and F5.CZ other bump:1.93056 Ang F3.CD1 and F5.CZ other bump:2.82659 Ang F3.CG and F5.CZ other bump:1.5423 Ang F3.CE1 and F5.CE2 other bump:2.24644 Ang F3.CZ and F5.CE2 other bump:2.58035 Ang F3.CD1 and F5.CE2 other bump:1.22846 Ang F3.CE1 and F5.CE1 other bump:2.89302 Ang F3.CE2 and F5.CE1 other bump:1.96596 Ang F3.CZ and F5.CE1 other bump:1.93091 Ang F3.CD1 and F5.CE1 other bump:2.37913 Ang F3.CE1 and F5.CD2 other bump:2.19246 Ang F3.CE1 and F5.CD1 other bump:2.58879 Ang F3.CD1 and F5.CD1 Number of specific fragments= 1 total=798 # 7ahlA.79.82 read from T0129.t2k.frag # found chain 7ahlA in template set T0129 79 :GFTFELGLT 7ahlA 83 :AFKVQLQLP Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.89503 Ang F5.CE2 and L7.CD1 Number of specific fragments= 1 total=799 # 1b7yB.79.83 read from T0129.t2k.frag # found chain 1b7yB in template set T0129 79 :GFTFELGLT 1b7yB 84 :GIGVALALP Fragment has 18 clashes (null) has 18 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.4686 Ang F3.CD1 and F5.CZ other bump:0.275845 Ang F3.CE1 and F5.CZ other bump:2.60962 Ang F3.CD2 and F5.CZ other bump:2.15769 Ang F3.CE2 and F5.CZ other bump:1.18029 Ang F3.CZ and F5.CZ other bump:2.37697 Ang F3.CG and F5.CZ other bump:2.25 Ang F3.CD1 and F5.CE2 other bump:1.4759 Ang F3.CE1 and F5.CE2 other bump:2.14444 Ang F3.CZ and F5.CE2 other bump:1.55512 Ang F3.CD1 and F5.CE1 other bump:1.14482 Ang F3.CE1 and F5.CE1 other bump:3.08616 Ang F3.CE2 and F5.CE1 other bump:2.22823 Ang F3.CZ and F5.CE1 other bump:2.67424 Ang F3.CG and F5.CE1 other bump:2.87283 Ang F3.CD1 and F5.CD2 other bump:2.35046 Ang F3.CE1 and F5.CD2 other bump:2.37234 Ang F3.CD1 and F5.CD1 other bump:2.16315 Ang F3.CE1 and F5.CD1 Number of specific fragments= 1 total=800 # 1eiyB.79.83 read from T0129.t2k.frag # found chain 1eiyB in template set T0129 79 :GFTFELGLT 1eiyB 84 :GIGVALALP Fragment has 15 clashes (null) has 15 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:0.709533 Ang F3.CE1 and F5.CZ other bump:2.37989 Ang F3.CE2 and F5.CZ other bump:1.17034 Ang F3.CZ and F5.CZ other bump:2.02146 Ang F3.CD1 and F5.CZ other bump:2.93706 Ang F3.CG and F5.CZ other bump:1.393 Ang F3.CE1 and F5.CE2 other bump:1.92554 Ang F3.CZ and F5.CE2 other bump:2.56899 Ang F3.CD1 and F5.CE2 other bump:1.54205 Ang F3.CE1 and F5.CE1 other bump:2.4302 Ang F3.CZ and F5.CE1 other bump:2.09199 Ang F3.CD1 and F5.CE1 other bump:2.29402 Ang F3.CE1 and F5.CD2 other bump:3.07072 Ang F3.CD1 and F5.CD2 other bump:2.38834 Ang F3.CE1 and F5.CD1 other bump:2.68546 Ang F3.CD1 and F5.CD1 Number of specific fragments= 1 total=801 # 7ahlA.80.83 read from T0129.t2k.frag # found chain 7ahlA in template set T0129 80 :FTFELGLTE 7ahlA 84 :FKVQLQLPD Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.89503 Ang F4.CE2 and L6.CD1 Number of specific fragments= 1 total=802 # 1gqvA.80.81 read from T0129.t2k.frag # found chain 1gqvA in template set T0129 80 :FTFELGLTE 1gqvA 81 :IHCNLTTPS Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.11097 Ang T9.O and E10.CG neighbor-bump: 2.80549 Ang T9.C and E10.CG Number of specific fragments= 1 total=803 # 1hi2A.80.81 read from T0129.t2k.frag # found chain 1hi2A in training set T0129 80 :FTFELGLTE 1hi2A 81 :IHCNLTTPS Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=804 # 1pysB.80.84 read from T0129.t2k.frag # found chain 1pysB in template set T0129 80 :FTFELGLTE 1pysB 85 :IGVALALPG Fragment has 15 clashes (null) has 15 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:0.556349 Ang F2.CE1 and F4.CZ other bump:2.29075 Ang F2.CE2 and F4.CZ other bump:1.04635 Ang F2.CZ and F4.CZ other bump:2.82659 Ang F2.CG and F4.CZ other bump:1.93056 Ang F2.CD1 and F4.CZ other bump:1.54231 Ang F2.CE1 and F4.CE2 other bump:2.24644 Ang F2.CZ and F4.CE2 other bump:2.58035 Ang F2.CD1 and F4.CE2 other bump:1.22844 Ang F2.CE1 and F4.CE1 other bump:2.89301 Ang F2.CE2 and F4.CE1 other bump:1.96596 Ang F2.CZ and F4.CE1 other bump:1.9309 Ang F2.CD1 and F4.CE1 other bump:2.37913 Ang F2.CE1 and F4.CD2 other bump:2.19245 Ang F2.CE1 and F4.CD1 other bump:2.58878 Ang F2.CD1 and F4.CD1 Number of specific fragments= 1 total=805 # 1b7yB.80.84 read from T0129.t2k.frag # found chain 1b7yB in template set T0129 80 :FTFELGLTE 1b7yB 85 :IGVALALPG Fragment has 18 clashes (null) has 18 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.49263 Ang F2.CD2 and F4.CZ other bump:0.483591 Ang F2.CE1 and F4.CZ other bump:1.96413 Ang F2.CE2 and F4.CZ other bump:0.940685 Ang F2.CZ and F4.CZ other bump:2.38219 Ang F2.CG and F4.CZ other bump:1.6123 Ang F2.CD1 and F4.CZ other bump:1.13176 Ang F2.CE1 and F4.CE2 other bump:1.87674 Ang F2.CZ and F4.CE2 other bump:2.15026 Ang F2.CD1 and F4.CE2 other bump:1.3841 Ang F2.CE1 and F4.CE1 other bump:2.83586 Ang F2.CE2 and F4.CE1 other bump:2.07515 Ang F2.CZ and F4.CE1 other bump:2.67599 Ang F2.CG and F4.CE1 other bump:1.82437 Ang F2.CD1 and F4.CE1 other bump:2.00413 Ang F2.CE1 and F4.CD2 other bump:2.71982 Ang F2.CD1 and F4.CD2 other bump:2.15749 Ang F2.CE1 and F4.CD1 other bump:2.47082 Ang F2.CD1 and F4.CD1 Number of specific fragments= 1 total=806 # 1eiyB.80.84 read from T0129.t2k.frag # found chain 1eiyB in template set T0129 80 :FTFELGLTE 1eiyB 85 :IGVALALPG Fragment has 19 clashes (null) has 19 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.12911 Ang T9.O and E10.CB neighbor-bump: 2.47037 Ang T9.C and E10.CB other bump:1.05843 Ang F2.CE1 and F4.CZ other bump:2.15702 Ang F2.CE2 and F4.CZ other bump:0.990603 Ang F2.CZ and F4.CZ other bump:2.96183 Ang F2.CG and F4.CZ other bump:2.23275 Ang F2.CD1 and F4.CZ other bump:1.24221 Ang F2.CE1 and F4.CE2 other bump:1.66605 Ang F2.CZ and F4.CE2 other bump:2.58002 Ang F2.CD1 and F4.CE2 other bump:1.82224 Ang F2.CE1 and F4.CE1 other bump:3.0905 Ang F2.CE2 and F4.CE1 other bump:2.30728 Ang F2.CZ and F4.CE1 other bump:2.37085 Ang F2.CD1 and F4.CE1 other bump:2.04314 Ang F2.CE1 and F4.CD2 other bump:2.98587 Ang F2.CZ and F4.CD2 other bump:2.99797 Ang F2.CD1 and F4.CD2 other bump:2.43672 Ang F2.CE1 and F4.CD1 other bump:2.81819 Ang F2.CD1 and F4.CD1 Number of specific fragments= 1 total=807 # 7ahlA.81.84 read from T0129.t2k.frag # found chain 7ahlA in template set T0129 81 :TFELGLTED 7ahlA 85 :KVQLQLPDN Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.89502 Ang F3.CE2 and L5.CD1 Number of specific fragments= 1 total=808 # 1gqvA.81.82 read from T0129.t2k.frag # found chain 1gqvA in template set T0129 81 :TFELGLTED 1gqvA 82 :HCNLTTPSP Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=809 # 1hi2A.81.82 read from T0129.t2k.frag # found chain 1hi2A in training set T0129 81 :TFELGLTED 1hi2A 82 :HCNLTTPSP Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=810 # 1pysB.81.85 read from T0129.t2k.frag # found chain 1pysB in template set T0129 81 :TFELGLTED 1pysB 86 :GVALALPGT Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=811 # 1b7yB.81.85 read from T0129.t2k.frag # found chain 1b7yB in template set T0129 81 :TFELGLTED 1b7yB 86 :GVALALPGT Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.31422 Ang T8.O and E9.CG neighbor-bump: 2.84517 Ang T8.C and E9.CG Number of specific fragments= 1 total=812 # 1eiyB.81.85 read from T0129.t2k.frag # found chain 1eiyB in template set T0129 81 :TFELGLTED 1eiyB 86 :GVALALPGT Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=813 # 7ahlA.82.85 read from T0129.t2k.frag # found chain 7ahlA in template set T0129 82 :FELGLTEDE 7ahlA 86 :VQLQLPDNE Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.89503 Ang F2.CE2 and L4.CD1 Number of specific fragments= 1 total=814 # 1gqvA.82.83 read from T0129.t2k.frag # found chain 1gqvA in template set T0129 82 :FELGLTEDE 1gqvA 83 :CNLTTPSPQ Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=815 # 1hi2A.82.83 read from T0129.t2k.frag # found chain 1hi2A in training set T0129 82 :FELGLTEDE 1hi2A 83 :CNLTTPSPQ Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=816 # 1pysB.82.86 read from T0129.t2k.frag # found chain 1pysB in template set T0129 82 :FELGLTEDE 1pysB 87 :VALALPGTE Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=817 # 1b7yB.82.86 read from T0129.t2k.frag # found chain 1b7yB in template set T0129 82 :FELGLTEDE 1b7yB 87 :VALALPGTE Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.31422 Ang T7.O and E8.CG neighbor-bump: 2.84517 Ang T7.C and E8.CG Number of specific fragments= 1 total=818 # 1fohA.82.82 read from T0129.t2k.frag # found chain 1fohA in template set T0129 82 :FELGLTEDE 1fohA 83 :IALYNPDEN Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.25393 Ang T7.CG2 and G11.CA Number of specific fragments= 1 total=819 # 7ahlA.83.86 read from T0129.t2k.frag # found chain 7ahlA in template set T0129 83 :ELGLTEDEN 7ahlA 87 :QLQLPDNEV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=820 # 1gqvA.83.84 read from T0129.t2k.frag # found chain 1gqvA in template set T0129 83 :ELGLTEDEN 1gqvA 84 :NLTTPSPQN Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=821 # 1hi2A.83.84 read from T0129.t2k.frag # found chain 1hi2A in training set T0129 83 :ELGLTEDEN 1hi2A 84 :NLTTPSPQN Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=822 # 1pysB.83.87 read from T0129.t2k.frag # found chain 1pysB in template set T0129 83 :ELGLTEDEN 1pysB 88 :ALALPGTEL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=823 # 1fohA.83.83 read from T0129.t2k.frag # found chain 1fohA in template set T0129 83 :ELGLTEDEN 1fohA 84 :ALYNPDENG Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:3.19444 Ang E7.CB and G11.N other bump:2.55513 Ang T6.CG2 and N10.C other bump:3.06084 Ang T6.CG2 and N10.CG other bump:2.25393 Ang T6.CG2 and N10.CA Number of specific fragments= 1 total=824 # 1b7yB.83.87 read from T0129.t2k.frag # found chain 1b7yB in template set T0129 83 :ELGLTEDEN 1b7yB 88 :ALALPGTEL Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.31422 Ang T6.O and E7.CG neighbor-bump: 2.84517 Ang T6.C and E7.CG Number of specific fragments= 1 total=825 # 1gqvA.84.85 read from T0129.t2k.frag # found chain 1gqvA in template set T0129 84 :LGLTEDENV 1gqvA 85 :LTTPSPQNI Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=826 # 1hi2A.84.85 read from T0129.t2k.frag # found chain 1hi2A in training set T0129 84 :LGLTEDENV 1hi2A 85 :LTTPSPQNI Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=827 # 7ahlA.84.87 read from T0129.t2k.frag # found chain 7ahlA in template set T0129 84 :LGLTEDENV 7ahlA 88 :LQLPDNEVA Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.93156 Ang L4.CD1 and V10.CG1 Number of specific fragments= 1 total=828 # 1jj2L.84.88 read from T0129.t2k.frag # found chain 1jj2L in template set T0129 84 :LGLTEDENV 1jj2L 89 :NRITRKKNI Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=829 # 1f8xA.84.84 read from T0129.t2k.frag # found chain 1f8xA in template set T0129 84 :LGLTEDENV 1f8xA 85 :VYIPDEEDV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=830 # 1tgoA.84.84 read from T0129.t2k.frag # found chain 1tgoA in template set T0129 84 :LGLTEDENV 1tgoA 85 :LYFTHPQDV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=831 # 1gqvA.85.86 read from T0129.t2k.frag # found chain 1gqvA in template set T0129 85 :GLTEDENVF 1gqvA 86 :TTPSPQNIS Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=832 # 1hi2A.85.86 read from T0129.t2k.frag # found chain 1hi2A in training set T0129 85 :GLTEDENVF 1hi2A 86 :TTPSPQNIS Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=833 # 1jj2L.85.89 read from T0129.t2k.frag # found chain 1jj2L in template set T0129 85 :GLTEDENVF 1jj2L 90 :RITRKKNIQ Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=834 # 1tgoA.85.85 read from T0129.t2k.frag # found chain 1tgoA in template set T0129 85 :GLTEDENVF 1tgoA 86 :YFTHPQDVP Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=835 # 1f8xA.85.85 read from T0129.t2k.frag # found chain 1f8xA in template set T0129 85 :GLTEDENVF 1f8xA 86 :YIPDEEDVG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=836 # 1qrjB.85.86 read from T0129.t2k.frag # found chain 1qrjB in template set T0129 85 :GLTEDENVF 1qrjB 102 :NNPQQQGLR Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.55275 Ang G1.O and F10.CD1 other bump:2.63431 Ang L3.CD1 and D6.OD2 Number of specific fragments= 1 total=837 # 1gqvA.86.87 read from T0129.t2k.frag # found chain 1gqvA in template set T0129 86 :LTEDENVFT 1gqvA 87 :TPSPQNISN Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.47952 Ang E4.CD and T10.OG1 other bump:1.40151 Ang E4.OE1 and T10.OG1 other bump:2.6555 Ang E4.OE1 and T10.CB Number of specific fragments= 1 total=838 # 1hi2A.86.87 read from T0129.t2k.frag # found chain 1hi2A in training set T0129 86 :LTEDENVFT 1hi2A 87 :TPSPQNISN Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.6703 Ang E4.CD and T10.OG1 other bump:1.63105 Ang E4.OE1 and T10.OG1 other bump:2.70444 Ang E4.OE1 and T10.CB Number of specific fragments= 1 total=839 # 1jj2L.86.90 read from T0129.t2k.frag # found chain 1jj2L in template set T0129 86 :LTEDENVFT 1jj2L 91 :ITRKKNIQR Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=840 # 1qrjB.86.87 read from T0129.t2k.frag # found chain 1qrjB in template set T0129 86 :LTEDENVFT 1qrjB 103 :NPQQQGLRR Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.6343 Ang L2.CD1 and D5.OD2 Number of specific fragments= 1 total=841 # 1yveI.86.89 read from T0129.t2k.frag # found chain 1yveI in template set T0129 86 :LTEDENVFT 1yveI 161 :LRKGSNSFA Fragment has 8 clashes (null) has 8 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.37063 Ang E6.CD and V8.CG2 other bump:1.61034 Ang E6.OE1 and V8.CG2 other bump:2.89487 Ang E6.CG and V8.CB other bump:2.39083 Ang E6.CD and V8.CB other bump:2.14632 Ang E6.OE1 and V8.CB other bump:2.92047 Ang E6.CG and V8.N other bump:3.02008 Ang E6.CD and V8.N other bump:2.38706 Ang E6.OE1 and V8.N Number of specific fragments= 1 total=842 # 1tgoA.86.86 read from T0129.t2k.frag # found chain 1tgoA in template set T0129 86 :LTEDENVFT 1tgoA 87 :FTHPQDVPA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=843 # 1jj2L.87.91 read from T0129.t2k.frag # found chain 1jj2L in template set T0129 87 :TEDENVFTQ 1jj2L 92 :TRKKNIQRI Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=844 # 1gqvA.87.88 read from T0129.t2k.frag # found chain 1gqvA in template set T0129 87 :TEDENVFTQ 1gqvA 88 :PSPQNISNC Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.68715 Ang E3.OE1 and T9.CG2 other bump:2.55033 Ang E3.OE1 and T9.CB Number of specific fragments= 1 total=845 # 1hi2A.87.88 read from T0129.t2k.frag # found chain 1hi2A in training set T0129 87 :TEDENVFTQ 1hi2A 88 :PSPQNISNC Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:3.03767 Ang E3.CD and T9.CG2 other bump:2.28556 Ang E3.OE1 and T9.CG2 other bump:2.45678 Ang E3.OE1 and T9.CB Number of specific fragments= 1 total=846 # 1qrjB.87.88 read from T0129.t2k.frag # found chain 1qrjB in template set T0129 87 :TEDENVFTQ 1qrjB 104 :PQQQGLRRE Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=847 # 1j8wB.87.90 read from T0129.t2k.frag # found chain 1j8wB in template set T0129 87 :TEDENVFTQ 1j8wB 220 :QAGESMFNR Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.68 Ang F8.CE2 and Q10.CG other bump:1.9808 Ang D4.OD2 and N6.OD1 other bump:1.70488 Ang D4.CB and N6.OD1 other bump:2.14272 Ang D4.CG and N6.OD1 other bump:2.449 Ang D4.OD2 and N6.CG other bump:2.87124 Ang D4.CB and N6.CG other bump:3.04576 Ang D4.CG and N6.CG other bump:1.47537 Ang T2.CG2 and D4.OD1 other bump:2.61115 Ang T2.CB and D4.OD1 other bump:2.43971 Ang T2.CG2 and D4.CG Number of specific fragments= 1 total=848 # 1tgoA.87.87 read from T0129.t2k.frag # found chain 1tgoA in template set T0129 87 :TEDENVFTQ 1tgoA 88 :THPQDVPAI Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=849 # 1jj2L.88.92 read from T0129.t2k.frag # found chain 1jj2L in template set T0129 88 :EDENVFTQA 1jj2L 93 :RKKNIQRIA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=850 # 1qrjB.88.89 read from T0129.t2k.frag # found chain 1qrjB in template set T0129 88 :EDENVFTQA 1qrjB 105 :QQQGLRREY Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=851 # 1j8wB.88.91 read from T0129.t2k.frag # found chain 1j8wB in template set T0129 88 :EDENVFTQA 1j8wB 221 :AGESMFNRA Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.14272 Ang D3.CG and N5.OD1 other bump:1.9808 Ang D3.OD2 and N5.OD1 other bump:1.70488 Ang D3.CB and N5.OD1 other bump:3.04576 Ang D3.CG and N5.CG other bump:2.449 Ang D3.OD2 and N5.CG other bump:2.87124 Ang D3.CB and N5.CG Number of specific fragments= 1 total=852 # 1gqvA.88.89 read from T0129.t2k.frag # found chain 1gqvA in template set T0129 88 :EDENVFTQA 1gqvA 89 :SPQNISNCR Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.68715 Ang E2.OE1 and T8.CG2 other bump:2.55033 Ang E2.OE1 and T8.CB Number of specific fragments= 1 total=853 # 1hi2A.88.89 read from T0129.t2k.frag # found chain 1hi2A in training set T0129 88 :EDENVFTQA 1hi2A 89 :SPQNISNCR Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.55429 Ang E2.CD and E4.OE2 other bump:1.91444 Ang E2.OE1 and E4.OE2 other bump:1.60659 Ang E2.OE1 and E4.OE1 other bump:2.82928 Ang E2.CD and E4.CD other bump:1.7929 Ang E2.OE1 and E4.CD Number of specific fragments= 1 total=854 # 1tys.88.89 read from T0129.t2k.frag # found chain 1tys in template set T0129 88 :EDENVFTQA 1tys 89 :DLGPVYGKQ Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.08627 Ang D3.O and E4.CB neighbor-bump: 2.53487 Ang D3.C and E4.CB Number of specific fragments= 1 total=855 # 1j8wB.89.92 read from T0129.t2k.frag # found chain 1j8wB in template set T0129 89 :DENVFTQAD 1j8wB 222 :GESMFNRAK Fragment has 14 clashes (null) has 14 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.55543 Ang D2.OD2 and N4.OD1 other bump:1.15473 Ang D2.OD1 and N4.OD1 other bump:0.678308 Ang D2.CG and N4.OD1 other bump:1.74706 Ang D2.CB and N4.OD1 other bump:2.20297 Ang D2.OD2 and N4.ND2 other bump:1.76737 Ang D2.OD2 and N4.CG other bump:1.79326 Ang D2.OD1 and N4.CG other bump:1.70771 Ang D2.CG and N4.CG other bump:2.9091 Ang D2.CB and N4.CG other bump:2.15862 Ang D2.OD1 and N4.CB other bump:2.79041 Ang D2.CG and N4.CB other bump:2.49837 Ang D2.OD1 and N4.CA other bump:1.84874 Ang D2.OD1 and N4.N other bump:3.00503 Ang D2.CG and N4.N Number of specific fragments= 1 total=856 # 1qrjB.89.90 read from T0129.t2k.frag # found chain 1qrjB in template set T0129 89 :DENVFTQAD 1qrjB 106 :QQGLRREYQ Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=857 # 1jj2L.89.93 read from T0129.t2k.frag # found chain 1jj2L in template set T0129 89 :DENVFTQAD 1jj2L 94 :KKNIQRIAE Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=858 # 1gqvA.89.90 read from T0129.t2k.frag # found chain 1gqvA in template set T0129 89 :DENVFTQAD 1gqvA 90 :PQNISNCRY Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.51173 Ang D2.CG and E3.OE2 neighbor-bump: 2.08774 Ang D2.OD2 and E3.OE2 neighbor-bump: 2.56444 Ang D2.OD1 and E3.CD Number of specific fragments= 1 total=859 # 1hi2A.89.90 read from T0129.t2k.frag # found chain 1hi2A in training set T0129 89 :DENVFTQAD 1hi2A 90 :PQNISNCRY Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=860 # 1tys.89.90 read from T0129.t2k.frag # found chain 1tys in template set T0129 89 :DENVFTQAD 1tys 90 :LGPVYGKQW Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.08627 Ang D2.O and E3.CB neighbor-bump: 2.53487 Ang D2.C and E3.CB Number of specific fragments= 1 total=861 # 1j8wB.90.93 read from T0129.t2k.frag # found chain 1j8wB in template set T0129 90 :ENVFTQADS 1j8wB 223 :ESMFNRAKL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=862 # 1qrjB.90.91 read from T0129.t2k.frag # found chain 1qrjB in template set T0129 90 :ENVFTQADS 1qrjB 107 :QGLRREYQQ Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=863 # 1jj2L.90.94 read from T0129.t2k.frag # found chain 1jj2L in template set T0129 90 :ENVFTQADS 1jj2L 95 :KNIQRIAEE Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:3.10149 Ang E2.CD and T6.CG2 other bump:2.6208 Ang E2.OE2 and T6.CG2 Number of specific fragments= 1 total=864 # 2occA.90.90 read from T0129.t2k.frag # found chain 2occA in template set T0129 90 :ENVFTQADS 2occA 91 :DMAFPRMNN Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 3.00552 Ang V4.CG2 and F5.CE2 Number of specific fragments= 1 total=865 # 1gqvA.90.91 read from T0129.t2k.frag # found chain 1gqvA in template set T0129 90 :ENVFTQADS 1gqvA 91 :QNISNCRYA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=866 # 1hi2A.90.91 read from T0129.t2k.frag # found chain 1hi2A in training set T0129 90 :ENVFTQADS 1hi2A 91 :QNISNCRYA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=867 # 1j8wB.91.94 read from T0129.t2k.frag # found chain 1j8wB in template set T0129 91 :NVFTQADSL 1j8wB 224 :SMFNRAKLL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=868 # 1qrjB.91.92 read from T0129.t2k.frag # found chain 1qrjB in template set T0129 91 :NVFTQADSL 1qrjB 108 :GLRREYQQL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=869 # 1jj2L.91.95 read from T0129.t2k.frag # found chain 1jj2L in template set T0129 91 :NVFTQADSL 1jj2L 96 :NIQRIAEER Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=870 # 2occA.91.91 read from T0129.t2k.frag # found chain 2occA in template set T0129 91 :NVFTQADSL 2occA 92 :MAFPRMNNM Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.74111 Ang N2.ND2 and D8.OD2 other bump:2.58911 Ang N2.ND2 and D8.CG other bump:2.93178 Ang N2.OD1 and T5.CG2 neighbor-bump: 3.06797 Ang V3.CG1 and F4.CZ Number of specific fragments= 1 total=871 # 1l3lA.91.92 read from T0129.t2k.frag # found chain 1l3lA in template set T0129 91 :NVFTQADSL 1l3lA 93 :TLSKDERAF Fragment has 11 clashes (null) has 11 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.36596 Ang V3.CB and D8.OD1 other bump:2.35372 Ang V3.CG2 and D8.OD1 other bump:1.61711 Ang V3.CG1 and D8.OD1 other bump:2.55229 Ang V3.CG1 and D8.CG other bump:2.82165 Ang V3.CG2 and D8.N other bump:3.11108 Ang V3.CG2 and A7.C other bump:2.61336 Ang V3.CG2 and A7.CB other bump:3.13791 Ang F4.CE2 and Q6.N other bump:2.47071 Ang F4.CD2 and Q6.N neighbor-bump: 2.76277 Ang F4.CE2 and T5.OG1 neighbor-bump: 2.82676 Ang F4.CD2 and T5.N Number of specific fragments= 1 total=872 # 1tys.91.92 read from T0129.t2k.frag # found chain 1tys in template set T0129 91 :NVFTQADSL 1tys 92 :PVYGKQWRA Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.89565 Ang F4.C and D8.OD2 Number of specific fragments= 1 total=873 # 2occA.92.92 read from T0129.t2k.frag # found chain 2occA in template set T0129 92 :VFTQADSLS 2occA 93 :AFPRMNNMS Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 3.06799 Ang V2.CG1 and F3.CZ Number of specific fragments= 1 total=874 # 1qrjB.92.93 read from T0129.t2k.frag # found chain 1qrjB in template set T0129 92 :VFTQADSLS 1qrjB 109 :LRREYQQLW Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=875 # 1j8wB.92.95 read from T0129.t2k.frag # found chain 1j8wB in template set T0129 92 :VFTQADSLS 1j8wB 225 :MFNRAKLLN Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=876 # 1jj2L.92.96 read from T0129.t2k.frag # found chain 1jj2L in template set T0129 92 :VFTQADSLS 1jj2L 97 :IQRIAEERA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=877 # 1l3lA.92.93 read from T0129.t2k.frag # found chain 1l3lA in template set T0129 92 :VFTQADSLS 1l3lA 94 :LSKDERAFY Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.5783 Ang V2.CB and D7.OD1 other bump:1.46655 Ang V2.CG2 and D7.OD1 other bump:2.55685 Ang V2.CG2 and D7.CG other bump:3.13792 Ang F3.CE2 and Q5.N other bump:2.47071 Ang F3.CD2 and Q5.N neighbor-bump: 2.76275 Ang F3.CE2 and T4.OG1 neighbor-bump: 2.82676 Ang F3.CD2 and T4.N Number of specific fragments= 1 total=878 # 1cnv.92.93 read from T0129.t2k.frag # found chain 1cnv in training set T0129 92 :VFTQADSLS 1cnv 94 :SADYAKDLA Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.56531 Ang Q5.NE2 and S8.OG Number of specific fragments= 1 total=879 # 2occA.93.93 read from T0129.t2k.frag # found chain 2occA in template set T0129 93 :FTQADSLSD 2occA 94 :FPRMNNMSF Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=880 # 1cnv.93.94 read from T0129.t2k.frag # found chain 1cnv in training set T0129 93 :FTQADSLSD 1cnv 95 :ADYAKDLAE Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.5653 Ang Q4.NE2 and S7.OG Number of specific fragments= 1 total=881 # 1qrjB.93.94 read from T0129.t2k.frag # found chain 1qrjB in template set T0129 93 :FTQADSLSD 1qrjB 110 :RREYQQLWL Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.82393 Ang F2.CD1 and T3.OG1 neighbor-bump: 2.19635 Ang F2.CE1 and T3.OG1 neighbor-bump: 2.6395 Ang F2.CZ and T3.OG1 neighbor-bump: 2.73647 Ang F2.CD1 and T3.N Number of specific fragments= 1 total=882 # 1l3lA.93.94 read from T0129.t2k.frag # found chain 1l3lA in template set T0129 93 :FTQADSLSD 1l3lA 95 :SKDERAFYD Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.47072 Ang F2.CD2 and Q4.N other bump:3.13792 Ang F2.CE2 and Q4.N neighbor-bump: 2.76275 Ang F2.CE2 and T3.OG1 neighbor-bump: 2.82677 Ang F2.CD2 and T3.N Number of specific fragments= 1 total=883 # 1jj2L.93.97 read from T0129.t2k.frag # found chain 1jj2L in template set T0129 93 :FTQADSLSD 1jj2L 98 :QRIAEERAN Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=884 # 1j8wB.93.96 read from T0129.t2k.frag # found chain 1j8wB in template set T0129 93 :FTQADSLSD 1j8wB 226 :FNRAKLLNV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=885 # 1cnv.94.95 read from T0129.t2k.frag # found chain 1cnv in training set T0129 94 :TQADSLSDW 1cnv 96 :DYAKDLAEY Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.5653 Ang Q3.NE2 and S6.OG Number of specific fragments= 1 total=886 # 2occA.94.94 read from T0129.t2k.frag # found chain 2occA in template set T0129 94 :TQADSLSDW 2occA 95 :PRMNNMSFW Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=887 # 1qrjB.94.95 read from T0129.t2k.frag # found chain 1qrjB in template set T0129 94 :TQADSLSDW 1qrjB 111 :REYQQLWLA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=888 # 1l3lA.94.95 read from T0129.t2k.frag # found chain 1l3lA in template set T0129 94 :TQADSLSDW 1l3lA 96 :KDERAFYDH Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=889 # 1fh6A.94.94 read from T0129.t2k.frag # found chain 1fh6A in template set T0129 94 :TQADSLSDW 1fh6A 198 :DDAPMLQSY Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.6352 Ang D5.C and S6.CB other bump:2.46249 Ang G1.O and A4.O Number of specific fragments= 1 total=890 # 1jj2L.94.98 read from T0129.t2k.frag # found chain 1jj2L in template set T0129 94 :TQADSLSDW 1jj2L 99 :RIAEERANR Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=891 # 1cnv.95.96 read from T0129.t2k.frag # found chain 1cnv in training set T0129 95 :QADSLSDWA 1cnv 97 :YAKDLAEYL Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.56529 Ang Q2.NE2 and S5.OG Number of specific fragments= 1 total=892 # 1fh6A.95.95 read from T0129.t2k.frag # found chain 1fh6A in template set T0129 95 :QADSLSDWA 1fh6A 199 :DAPMLQSYI Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.6352 Ang D4.C and S5.CB Number of specific fragments= 1 total=893 # 1l3lA.95.96 read from T0129.t2k.frag # found chain 1l3lA in template set T0129 95 :QADSLSDWA 1l3lA 97 :DERAFYDHA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=894 # 2occA.95.95 read from T0129.t2k.frag # found chain 2occA in template set T0129 95 :QADSLSDWA 2occA 96 :RMNNMSFWL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=895 # 1qrjB.95.96 read from T0129.t2k.frag # found chain 1qrjB in template set T0129 95 :QADSLSDWA 1qrjB 112 :EYQQLWLAA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=896 # 1jj2L.95.99 read from T0129.t2k.frag # found chain 1jj2L in template set T0129 95 :QADSLSDWA 1jj2L 100 :IAEERANRK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=897 # 1cnv.96.97 read from T0129.t2k.frag # found chain 1cnv in training set T0129 96 :ADSLSDWAN 1cnv 98 :AKDLAEYLH Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=898 # 1fh6A.96.96 read from T0129.t2k.frag # found chain 1fh6A in template set T0129 96 :ADSLSDWAN 1fh6A 200 :APMLQSYIN Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.28857 Ang S6.C and N10.ND2 other bump:2.80165 Ang S6.CA and N10.ND2 other bump:1.79595 Ang S6.O and N10.ND2 other bump:2.42122 Ang S6.O and N10.CG neighbor-bump: 2.6352 Ang D3.C and S4.CB Number of specific fragments= 1 total=899 # 1l3lA.96.97 read from T0129.t2k.frag # found chain 1l3lA in template set T0129 96 :ADSLSDWAN 1l3lA 98 :ERAFYDHAS Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.57442 Ang D7.CA and N10.OD1 other bump:1.12701 Ang D7.O and N10.OD1 other bump:2.01393 Ang D7.C and N10.OD1 other bump:2.31799 Ang D7.O and N10.CG other bump:3.2489 Ang D7.C and N10.CG Number of specific fragments= 1 total=900 # 1qrjB.96.97 read from T0129.t2k.frag # found chain 1qrjB in template set T0129 96 :ADSLSDWAN 1qrjB 113 :YQQLWLAAF Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=901 # 2occA.96.96 read from T0129.t2k.frag # found chain 2occA in template set T0129 96 :ADSLSDWAN 2occA 97 :MNNMSFWLL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=902 # 1qqeA.96.96 read from T0129.t2k.frag # found chain 1qqeA in template set T0129 96 :ADSLSDWAN 1qqeA 97 :VDSLENAIQ Fragment has 8 clashes (null) has 8 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.48235 Ang L5.CB and W8.NE1 other bump:2.95985 Ang L5.C and W8.NE1 other bump:2.74971 Ang L5.CG and W8.NE1 other bump:2.05661 Ang L5.CD2 and W8.NE1 other bump:2.41862 Ang L5.CA and W8.NE1 other bump:2.94044 Ang L5.CD2 and W8.CE2 other bump:2.43603 Ang L5.CA and W8.CD1 other bump:2.55377 Ang L5.O and W8.CD1 Number of specific fragments= 1 total=903 # 1cnv.97.98 read from T0129.t2k.frag # found chain 1cnv in training set T0129 97 :DSLSDWANQ 1cnv 99 :KDLAEYLHT Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=904 # 1fh6A.97.97 read from T0129.t2k.frag # found chain 1fh6A in template set T0129 97 :DSLSDWANQ 1fh6A 201 :PMLQSYINN Fragment has 8 clashes (null) has 8 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.28857 Ang S5.C and N9.ND2 other bump:2.80165 Ang S5.CA and N9.ND2 other bump:1.79595 Ang S5.O and N9.ND2 other bump:2.42122 Ang S5.O and N9.CG neighbor-bump: 2.63519 Ang D2.C and S3.CB neighbor-bump: 2.35783 Ang D2.CB and S3.N self-bump: 2.19065 Ang D2.CB and D2.C self-bump: 1.30981 Ang D2.CA and D2.CB Number of specific fragments= 1 total=905 # 1l3lA.97.98 read from T0129.t2k.frag # found chain 1l3lA in template set T0129 97 :DSLSDWANQ 1l3lA 99 :RAFYDHASD Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=906 # 1ky3A.97.97 read from T0129.t2k.frag # found chain 1ky3A in template set T0129 97 :DSLSDWANQ 1ky3A 98 :ENIKSWRDE Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=907 # 1qrjB.97.98 read from T0129.t2k.frag # found chain 1qrjB in template set T0129 97 :DSLSDWANQ 1qrjB 114 :QQLWLAAFA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=908 # 2occA.97.97 read from T0129.t2k.frag # found chain 2occA in template set T0129 97 :DSLSDWANQ 2occA 98 :NNMSFWLLP Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.77695 Ang W7.CE3 and Q10.OE1 other bump:3.10212 Ang W7.CZ3 and Q10.OE1 Number of specific fragments= 1 total=909 # 1cnv.98.99 read from T0129.t2k.frag # found chain 1cnv in training set T0129 98 :SLSDWANQF 1cnv 100 :DLAEYLHTY Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=910 # 1l3lA.98.99 read from T0129.t2k.frag # found chain 1l3lA in template set T0129 98 :SLSDWANQF 1l3lA 100 :AFYDHASDF Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=911 # 1fh6A.98.98 read from T0129.t2k.frag # found chain 1fh6A in template set T0129 98 :SLSDWANQF 1fh6A 202 :MLQSYINNR Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.48659 Ang D5.O and Q9.CG other bump:2.28857 Ang S4.C and N8.ND2 other bump:1.79595 Ang S4.O and N8.ND2 other bump:2.80165 Ang S4.CA and N8.ND2 other bump:2.42122 Ang S4.O and N8.CG Number of specific fragments= 1 total=912 # 1ky3A.98.98 read from T0129.t2k.frag # found chain 1ky3A in template set T0129 98 :SLSDWANQF 1ky3A 99 :NIKSWRDEF Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=913 # 1qrjB.98.99 read from T0129.t2k.frag # found chain 1qrjB in template set T0129 98 :SLSDWANQF 1qrjB 115 :QLWLAAFAA Fragment has 32 clashes (null) has 32 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.61538 Ang W6.CZ2 and F10.CZ other bump:2.51619 Ang W6.CH2 and F10.CZ other bump:2.0693 Ang W6.CG and F10.CZ other bump:1.2418 Ang W6.CD2 and F10.CZ other bump:0.267236 Ang W6.CE2 and F10.CZ other bump:2.34182 Ang W6.CE3 and F10.CZ other bump:2.78875 Ang W6.CZ3 and F10.CZ other bump:2.05914 Ang W6.CD1 and F10.CZ other bump:1.32493 Ang W6.NE1 and F10.CZ other bump:2.5599 Ang W6.CZ2 and F10.CE2 other bump:2.38083 Ang W6.CG and F10.CE2 other bump:2.31717 Ang W6.CD2 and F10.CE2 other bump:1.53437 Ang W6.CE2 and F10.CE2 other bump:1.66967 Ang W6.CD1 and F10.CE2 other bump:0.902867 Ang W6.NE1 and F10.CE2 other bump:1.71911 Ang W6.CZ2 and F10.CE1 other bump:1.80911 Ang W6.CH2 and F10.CE1 other bump:2.6755 Ang W6.CG and F10.CE1 other bump:1.39061 Ang W6.CD2 and F10.CE1 other bump:1.45324 Ang W6.CE2 and F10.CE1 other bump:1.54932 Ang W6.CE3 and F10.CE1 other bump:1.73217 Ang W6.CZ3 and F10.CE1 other bump:2.67051 Ang W6.NE1 and F10.CE1 other bump:2.68808 Ang W6.CD1 and F10.CD2 other bump:2.32276 Ang W6.NE1 and F10.CD2 other bump:2.68054 Ang W6.CZ2 and F10.CD1 other bump:2.71821 Ang W6.CH2 and F10.CD1 other bump:2.45981 Ang W6.CD2 and F10.CD1 other bump:2.51785 Ang W6.CE2 and F10.CD1 other bump:2.53147 Ang W6.CE3 and F10.CD1 other bump:2.6472 Ang W6.CZ3 and F10.CD1 other bump:2.98083 Ang W6.CE2 and F10.CG Number of specific fragments= 1 total=914 # 1jj2L.98.99 read from T0129.t2k.frag # found chain 1jj2L in template set T0129 98 :SLSDWANQF 1jj2L 100 :IAEERANRK Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:3.27304 Ang W6.CE3 and F10.CZ other bump:2.08275 Ang W6.O and F10.CE2 other bump:2.67372 Ang W6.C and F10.CE2 other bump:3.25548 Ang A7.CA and F10.CD2 other bump:1.87483 Ang W6.O and F10.CD2 other bump:2.81245 Ang W6.C and F10.CD2 Number of specific fragments= 1 total=915 # 1l3lA.99.100 read from T0129.t2k.frag # found chain 1l3lA in template set T0129 99 :LSDWANQFL 1l3lA 101 :FYDHASDFG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=916 # 1ky3A.99.99 read from T0129.t2k.frag # found chain 1ky3A in template set T0129 99 :LSDWANQFL 1ky3A 100 :IKSWRDEFL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=917 # 1cnv.99.100 read from T0129.t2k.frag # found chain 1cnv in training set T0129 99 :LSDWANQFL 1cnv 101 :LAEYLHTYF Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=918 # 1fh6A.99.99 read from T0129.t2k.frag # found chain 1fh6A in template set T0129 99 :LSDWANQFL 1fh6A 203 :LQSYINNRL Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.48659 Ang D4.O and Q8.CG other bump:2.28857 Ang S3.C and N7.ND2 other bump:1.79595 Ang S3.O and N7.ND2 other bump:2.80165 Ang S3.CA and N7.ND2 other bump:2.42122 Ang S3.O and N7.CG Number of specific fragments= 1 total=919 # 1cpcL.99.101 read from T0129.t2k.frag # found chain 1cpcL in template set T0129 99 :LSDWANQFL 1cpcL 104 :ASVLDDRCL Fragment has 16 clashes (null) has 16 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.41379 Ang W5.CZ2 and L10.CD2 other bump:3.21013 Ang W5.CH2 and L10.CD2 other bump:2.69415 Ang W5.CD2 and L10.CD1 other bump:2.54638 Ang W5.CE2 and L10.CD1 other bump:2.33245 Ang W5.CE3 and L10.CD1 other bump:2.04696 Ang W5.CZ2 and L10.CD1 other bump:1.70687 Ang W5.CZ3 and L10.CD1 other bump:1.52156 Ang W5.CH2 and L10.CD1 other bump:2.59018 Ang W5.CE2 and L10.CG other bump:3.15067 Ang W5.CE3 and L10.CG other bump:2.55978 Ang W5.CZ2 and L10.CG other bump:3.0867 Ang W5.CZ3 and L10.CG other bump:2.80222 Ang W5.CH2 and L10.CG self-bump: 1.38669 Ang F9.CA and F9.CB other bump:2.51815 Ang D4.CB and Q8.OE1 other bump:2.65644 Ang D4.O and Q8.CB Number of specific fragments= 1 total=920 # 1ktpB.99.101 read from T0129.t2k.frag # found chain 1ktpB in template set T0129 99 :LSDWANQFL 1ktpB 104 :SSVLDDRCL Fragment has 13 clashes (null) has 13 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.43927 Ang W5.CZ2 and L10.CD2 other bump:3.21473 Ang W5.CH2 and L10.CD2 other bump:2.53762 Ang W5.CD2 and L10.CD1 other bump:2.345 Ang W5.CE2 and L10.CD1 other bump:2.27073 Ang W5.CE3 and L10.CD1 other bump:1.88556 Ang W5.CZ2 and L10.CD1 other bump:1.72567 Ang W5.CZ3 and L10.CD1 other bump:1.48397 Ang W5.CH2 and L10.CD1 other bump:2.58084 Ang W5.CE2 and L10.CG other bump:2.50468 Ang W5.CZ2 and L10.CG other bump:3.17408 Ang W5.CZ3 and L10.CG other bump:2.80648 Ang W5.CH2 and L10.CG self-bump: 1.39978 Ang F9.CA and F9.CB Number of specific fragments= 1 total=921 # 1l3lA.100.101 read from T0129.t2k.frag # found chain 1l3lA in template set T0129 100 :SDWANQFLL 1l3lA 102 :YDHASDFGI Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.81068 Ang N6.OD1 and G11.CA Number of specific fragments= 1 total=922 # 1ky3A.100.100 read from T0129.t2k.frag # found chain 1ky3A in template set T0129 100 :SDWANQFLL 1ky3A 101 :KSWRDEFLV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=923 # 1cnv.100.101 read from T0129.t2k.frag # found chain 1cnv in training set T0129 100 :SDWANQFLL 1cnv 102 :AEYLHTYFL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=924 # 1ktpB.100.102 read from T0129.t2k.frag # found chain 1ktpB in template set T0129 100 :SDWANQFLL 1ktpB 105 :SVLDDRCLN Fragment has 14 clashes (null) has 14 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.48586 Ang A5.O and L10.CG other bump:3.21473 Ang W4.CH2 and L9.CD2 other bump:2.43927 Ang W4.CZ2 and L9.CD2 other bump:2.53762 Ang W4.CD2 and L9.CD1 other bump:2.345 Ang W4.CE2 and L9.CD1 other bump:2.27073 Ang W4.CE3 and L9.CD1 other bump:1.72567 Ang W4.CZ3 and L9.CD1 other bump:1.48397 Ang W4.CH2 and L9.CD1 other bump:1.88556 Ang W4.CZ2 and L9.CD1 other bump:2.58084 Ang W4.CE2 and L9.CG other bump:3.17408 Ang W4.CZ3 and L9.CG other bump:2.80648 Ang W4.CH2 and L9.CG other bump:2.50468 Ang W4.CZ2 and L9.CG self-bump: 1.39978 Ang F8.CA and F8.CB Number of specific fragments= 1 total=925 # 1cpcL.100.102 read from T0129.t2k.frag # found chain 1cpcL in template set T0129 100 :SDWANQFLL 1cpcL 105 :SVLDDRCLN Fragment has 16 clashes (null) has 16 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.41379 Ang W4.CZ2 and L9.CD2 other bump:3.21013 Ang W4.CH2 and L9.CD2 other bump:2.69415 Ang W4.CD2 and L9.CD1 other bump:2.54638 Ang W4.CE2 and L9.CD1 other bump:2.33245 Ang W4.CE3 and L9.CD1 other bump:2.04696 Ang W4.CZ2 and L9.CD1 other bump:1.70687 Ang W4.CZ3 and L9.CD1 other bump:1.52156 Ang W4.CH2 and L9.CD1 other bump:2.59018 Ang W4.CE2 and L9.CG other bump:3.15067 Ang W4.CE3 and L9.CG other bump:2.55978 Ang W4.CZ2 and L9.CG other bump:3.0867 Ang W4.CZ3 and L9.CG other bump:2.80222 Ang W4.CH2 and L9.CG self-bump: 1.38669 Ang F8.CA and F8.CB other bump:2.51815 Ang D3.CB and Q7.OE1 other bump:2.65644 Ang D3.O and Q7.CB Number of specific fragments= 1 total=926 # 1cpcB.100.102 read from T0129.t2k.frag # found chain 1cpcB in template set T0129 100 :SDWANQFLL 1cpcB 105 :SVLDDRCLN Fragment has 14 clashes (null) has 14 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:3.26701 Ang A5.C and L10.CG other bump:2.19866 Ang A5.O and L10.CG other bump:2.62072 Ang W4.CZ2 and L9.CD2 other bump:2.18958 Ang W4.CD2 and L9.CD1 other bump:2.13377 Ang W4.CE3 and L9.CD1 other bump:1.88606 Ang W4.CZ3 and L9.CD1 other bump:2.01074 Ang W4.CE2 and L9.CD1 other bump:1.81302 Ang W4.CZ2 and L9.CD1 other bump:1.71387 Ang W4.CH2 and L9.CD1 other bump:2.5518 Ang W4.CE2 and L9.CG other bump:3.12797 Ang W4.NE1 and L9.CG other bump:2.60025 Ang W4.CZ2 and L9.CG other bump:3.04589 Ang W4.CH2 and L9.CG self-bump: 1.38427 Ang F8.CA and F8.CB Number of specific fragments= 1 total=927 # 1ktpB.101.103 read from T0129.t2k.frag # found chain 1ktpB in template set T0129 101 :DWANQFLLG 1ktpB 106 :VLDDRCLNG Fragment has 14 clashes (null) has 14 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.48585 Ang A4.O and L9.CG other bump:2.43928 Ang W3.CZ2 and L8.CD2 other bump:3.21473 Ang W3.CH2 and L8.CD2 other bump:2.27073 Ang W3.CE3 and L8.CD1 other bump:2.53762 Ang W3.CD2 and L8.CD1 other bump:2.34501 Ang W3.CE2 and L8.CD1 other bump:1.88557 Ang W3.CZ2 and L8.CD1 other bump:1.72568 Ang W3.CZ3 and L8.CD1 other bump:1.48398 Ang W3.CH2 and L8.CD1 other bump:2.58085 Ang W3.CE2 and L8.CG other bump:2.5047 Ang W3.CZ2 and L8.CG other bump:3.1741 Ang W3.CZ3 and L8.CG other bump:2.80648 Ang W3.CH2 and L8.CG self-bump: 1.39978 Ang F7.CA and F7.CB Number of specific fragments= 1 total=928 # 1cpcL.101.103 read from T0129.t2k.frag # found chain 1cpcL in template set T0129 101 :DWANQFLLG 1cpcL 106 :VLDDRCLNG Fragment has 16 clashes (null) has 16 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.41379 Ang W3.CZ2 and L8.CD2 other bump:3.21013 Ang W3.CH2 and L8.CD2 other bump:2.33245 Ang W3.CE3 and L8.CD1 other bump:2.69416 Ang W3.CD2 and L8.CD1 other bump:2.54638 Ang W3.CE2 and L8.CD1 other bump:2.04697 Ang W3.CZ2 and L8.CD1 other bump:1.70687 Ang W3.CZ3 and L8.CD1 other bump:1.52156 Ang W3.CH2 and L8.CD1 other bump:3.15067 Ang W3.CE3 and L8.CG other bump:2.59018 Ang W3.CE2 and L8.CG other bump:2.55978 Ang W3.CZ2 and L8.CG other bump:3.0867 Ang W3.CZ3 and L8.CG other bump:2.80222 Ang W3.CH2 and L8.CG self-bump: 1.38669 Ang F7.CA and F7.CB other bump:2.51815 Ang D2.CB and Q6.OE1 other bump:2.65644 Ang D2.O and Q6.CB Number of specific fragments= 1 total=929 # 1cpcB.101.103 read from T0129.t2k.frag # found chain 1cpcB in template set T0129 101 :DWANQFLLG 1cpcB 106 :VLDDRCLNG Fragment has 13 clashes (null) has 13 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues self-bump: 1.26953 Ang L9.CA and L9.CB other bump:2.62072 Ang W3.CZ2 and L8.CD2 other bump:2.18957 Ang W3.CD2 and L8.CD1 other bump:2.01074 Ang W3.CE2 and L8.CD1 other bump:2.13377 Ang W3.CE3 and L8.CD1 other bump:1.81302 Ang W3.CZ2 and L8.CD1 other bump:1.88607 Ang W3.CZ3 and L8.CD1 other bump:1.71388 Ang W3.CH2 and L8.CD1 other bump:3.12796 Ang W3.NE1 and L8.CG other bump:2.5518 Ang W3.CE2 and L8.CG other bump:2.60025 Ang W3.CZ2 and L8.CG other bump:3.04589 Ang W3.CH2 and L8.CG self-bump: 1.38427 Ang F7.CA and F7.CB Number of specific fragments= 1 total=930 # 1ky3A.101.101 read from T0129.t2k.frag # found chain 1ky3A in template set T0129 101 :DWANQFLLG 1ky3A 102 :SWRDEFLVH Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=931 # 1l3lA.101.102 read from T0129.t2k.frag # found chain 1l3lA in template set T0129 101 :DWANQFLLG 1l3lA 103 :DHASDFGIR Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.81068 Ang N5.OD1 and G10.CA Number of specific fragments= 1 total=932 # 1phnB.101.103 read from T0129.t2k.frag # found chain 1phnB in template set T0129 101 :DWANQFLLG 1phnB 106 :ILDDRCLNG Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.66271 Ang Q6.O and L9.CB other bump:2.01263 Ang D2.O and Q6.OE1 Number of specific fragments= 1 total=933 # 1ktpB.102.104 read from T0129.t2k.frag # found chain 1ktpB in template set T0129 102 :WANQFLLGI 1ktpB 107 :LDDRCLNGL Fragment has 19 clashes (null) has 19 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.81505 Ang F6.O and I10.CD1 other bump:2.49474 Ang F6.C and I10.CD1 other bump:2.82548 Ang L7.N and I10.CD1 other bump:2.5711 Ang L7.CA and I10.CD1 other bump:2.22432 Ang F6.O and I10.CG1 other bump:2.48585 Ang A3.O and L8.CG other bump:2.43925 Ang W2.CZ2 and L7.CD2 other bump:3.2147 Ang W2.CH2 and L7.CD2 other bump:2.53762 Ang W2.CD2 and L7.CD1 other bump:2.34502 Ang W2.CE2 and L7.CD1 other bump:2.27072 Ang W2.CE3 and L7.CD1 other bump:1.88558 Ang W2.CZ2 and L7.CD1 other bump:1.72567 Ang W2.CZ3 and L7.CD1 other bump:1.48398 Ang W2.CH2 and L7.CD1 other bump:2.58084 Ang W2.CE2 and L7.CG other bump:2.50469 Ang W2.CZ2 and L7.CG other bump:3.17409 Ang W2.CZ3 and L7.CG other bump:2.80647 Ang W2.CH2 and L7.CG self-bump: 1.39978 Ang F6.CA and F6.CB Number of specific fragments= 1 total=934 # 1cpcB.102.104 read from T0129.t2k.frag # found chain 1cpcB in template set T0129 102 :WANQFLLGI 1cpcB 107 :LDDRCLNGL Fragment has 15 clashes (null) has 15 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.45068 Ang F6.O and I10.CD1 other bump:2.50838 Ang L7.CA and I10.CD1 self-bump: 1.26953 Ang L8.CA and L8.CB other bump:2.62072 Ang W2.CZ2 and L7.CD2 other bump:2.18958 Ang W2.CD2 and L7.CD1 other bump:2.01074 Ang W2.CE2 and L7.CD1 other bump:1.81302 Ang W2.CZ2 and L7.CD1 other bump:1.88607 Ang W2.CZ3 and L7.CD1 other bump:1.71387 Ang W2.CH2 and L7.CD1 other bump:2.13377 Ang W2.CE3 and L7.CD1 other bump:2.5518 Ang W2.CE2 and L7.CG other bump:3.12797 Ang W2.NE1 and L7.CG other bump:2.60025 Ang W2.CZ2 and L7.CG other bump:3.04589 Ang W2.CH2 and L7.CG self-bump: 1.38427 Ang F6.CA and F6.CB Number of specific fragments= 1 total=935 # 1cpcL.102.104 read from T0129.t2k.frag # found chain 1cpcL in template set T0129 102 :WANQFLLGI 1cpcL 107 :LDDRCLNGL Fragment has 16 clashes (null) has 16 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.33165 Ang F6.O and I10.CD1 other bump:3.21013 Ang W2.CH2 and L7.CD2 other bump:2.41379 Ang W2.CZ2 and L7.CD2 other bump:1.70688 Ang W2.CZ3 and L7.CD1 other bump:2.69416 Ang W2.CD2 and L7.CD1 other bump:2.33246 Ang W2.CE3 and L7.CD1 other bump:1.52156 Ang W2.CH2 and L7.CD1 other bump:2.54638 Ang W2.CE2 and L7.CD1 other bump:2.04697 Ang W2.CZ2 and L7.CD1 other bump:3.0867 Ang W2.CZ3 and L7.CG other bump:3.15067 Ang W2.CE3 and L7.CG other bump:2.80222 Ang W2.CH2 and L7.CG other bump:2.59018 Ang W2.CE2 and L7.CG other bump:2.55978 Ang W2.CZ2 and L7.CG self-bump: 1.38669 Ang F6.CA and F6.CB other bump:2.65644 Ang G1.O and Q5.CB Number of specific fragments= 1 total=936 # 1phnB.102.104 read from T0129.t2k.frag # found chain 1phnB in template set T0129 102 :WANQFLLGI 1phnB 107 :LDDRCLNGL Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.66271 Ang Q5.O and L8.CB other bump:2.01263 Ang G1.O and Q5.OE1 Number of specific fragments= 1 total=937 # 1ky3A.102.102 read from T0129.t2k.frag # found chain 1ky3A in template set T0129 102 :WANQFLLGI 1ky3A 103 :WRDEFLVHA Fragment has 8 clashes (null) has 8 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.43607 Ang F6.CD2 and I10.CD1 other bump:1.81729 Ang F6.CE2 and I10.CD1 other bump:2.58837 Ang F6.CZ and I10.CD1 other bump:2.81352 Ang F6.CD1 and I10.CG2 other bump:2.98991 Ang F6.CE1 and I10.CG2 other bump:2.23901 Ang F6.O and I10.CG2 other bump:3.00421 Ang F6.C and I10.CG2 other bump:2.97548 Ang F6.CG and I10.CG2 Number of specific fragments= 1 total=938 # 1l3lA.102.103 read from T0129.t2k.frag # found chain 1l3lA in template set T0129 102 :WANQFLLGI 1l3lA 104 :HASDFGIRS Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.81068 Ang N4.OD1 and G9.CA Number of specific fragments= 1 total=939 # 1ktpB.103.105 read from T0129.t2k.frag # found chain 1ktpB in template set T0129 103 :ANQFLLGIG 1ktpB 108 :DDRCLNGLR Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.49475 Ang F5.C and I9.CD1 other bump:2.82549 Ang L6.N and I9.CD1 other bump:2.5711 Ang L6.CA and I9.CD1 other bump:1.81505 Ang F5.O and I9.CD1 other bump:2.22433 Ang F5.O and I9.CG1 other bump:2.48585 Ang A2.O and L7.CG self-bump: 1.39978 Ang F5.CA and F5.CB Number of specific fragments= 1 total=940 # 1phnB.103.105 read from T0129.t2k.frag # found chain 1phnB in template set T0129 103 :ANQFLLGIG 1phnB 108 :DDRCLNGLR Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.66271 Ang Q4.O and L7.CB Number of specific fragments= 1 total=941 # 1cpcB.103.105 read from T0129.t2k.frag # found chain 1cpcB in template set T0129 103 :ANQFLLGIG 1cpcB 108 :DDRCLNGLK Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.50838 Ang L6.CA and I9.CD1 other bump:2.45067 Ang F5.O and I9.CD1 self-bump: 1.26953 Ang L7.CA and L7.CB self-bump: 1.38427 Ang F5.CA and F5.CB Number of specific fragments= 1 total=942 # 1cpcL.103.105 read from T0129.t2k.frag # found chain 1cpcL in template set T0129 103 :ANQFLLGIG 1cpcL 108 :DDRCLNGLK Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.33164 Ang F5.O and I9.CD1 self-bump: 1.38669 Ang F5.CA and F5.CB Number of specific fragments= 1 total=943 # 1ky3A.103.103 read from T0129.t2k.frag # found chain 1ky3A in template set T0129 103 :ANQFLLGIG 1ky3A 104 :RDEFLVHAN Fragment has 17 clashes (null) has 17 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.48191 Ang F5.O and I9.CD1 other bump:2.59905 Ang F5.CA and I9.CD1 other bump:1.43951 Ang F5.CG and I9.CD1 other bump:1.64364 Ang F5.CD1 and I9.CD1 other bump:2.27852 Ang F5.CE1 and I9.CD1 other bump:2.62509 Ang F5.CZ and I9.CD1 other bump:2.57864 Ang F5.C and I9.CD1 other bump:2.4512 Ang F5.CB and I9.CD1 other bump:1.94775 Ang F5.CD2 and I9.CD1 other bump:2.4981 Ang F5.CE2 and I9.CD1 other bump:2.79378 Ang F5.CZ and I9.CG2 other bump:2.98973 Ang F5.CE2 and I9.CG2 other bump:2.95301 Ang F5.CG and I9.CG1 other bump:2.72291 Ang F5.CD1 and I9.CG1 other bump:2.90171 Ang F5.CE1 and I9.CG1 other bump:3.07711 Ang F5.C and I9.CG1 other bump:2.68683 Ang F5.O and I9.CB Number of specific fragments= 1 total=944 # 1l3lA.103.104 read from T0129.t2k.frag # found chain 1l3lA in template set T0129 103 :ANQFLLGIG 1l3lA 105 :ASDFGIRSG Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.81068 Ang N3.OD1 and G8.CA Number of specific fragments= 1 total=945 # 1ktpB.104.106 read from T0129.t2k.frag # found chain 1ktpB in template set T0129 104 :NQFLLGIGL 1ktpB 109 :DRCLNGLRE Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.81505 Ang F4.O and I8.CD1 other bump:2.49475 Ang F4.C and I8.CD1 other bump:2.82549 Ang L5.N and I8.CD1 other bump:2.5711 Ang L5.CA and I8.CD1 other bump:2.22433 Ang F4.O and I8.CG1 other bump:2.48585 Ang G1.O and L6.CG self-bump: 1.39978 Ang F4.CA and F4.CB Number of specific fragments= 1 total=946 # 1phnB.104.106 read from T0129.t2k.frag # found chain 1phnB in template set T0129 104 :NQFLLGIGL 1phnB 109 :DRCLNGLRE Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.66271 Ang Q3.O and L6.CB neighbor-bump: 2.57943 Ang N2.ND2 and Q3.NE2 Number of specific fragments= 1 total=947 # 1cpcB.104.106 read from T0129.t2k.frag # found chain 1cpcB in template set T0129 104 :NQFLLGIGL 1cpcB 109 :DRCLNGLKE Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.45067 Ang F4.O and I8.CD1 other bump:2.50838 Ang L5.CA and I8.CD1 self-bump: 1.26953 Ang L6.CA and L6.CB self-bump: 1.38427 Ang F4.CA and F4.CB Number of specific fragments= 1 total=948 # 1cpcL.104.106 read from T0129.t2k.frag # found chain 1cpcL in template set T0129 104 :NQFLLGIGL 1cpcL 109 :DRCLNGLKE Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.33164 Ang F4.O and I8.CD1 self-bump: 1.38669 Ang F4.CA and F4.CB Number of specific fragments= 1 total=949 # 1ky3A.104.104 read from T0129.t2k.frag # found chain 1ky3A in template set T0129 104 :NQFLLGIGL 1ky3A 105 :DEFLVHANV Fragment has 17 clashes (null) has 17 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.48191 Ang F4.O and I8.CD1 other bump:2.59905 Ang F4.CA and I8.CD1 other bump:1.43951 Ang F4.CG and I8.CD1 other bump:1.64364 Ang F4.CD1 and I8.CD1 other bump:2.27852 Ang F4.CE1 and I8.CD1 other bump:2.62509 Ang F4.CZ and I8.CD1 other bump:2.57864 Ang F4.C and I8.CD1 other bump:2.4512 Ang F4.CB and I8.CD1 other bump:1.94775 Ang F4.CD2 and I8.CD1 other bump:2.4981 Ang F4.CE2 and I8.CD1 other bump:2.79378 Ang F4.CZ and I8.CG2 other bump:2.98973 Ang F4.CE2 and I8.CG2 other bump:2.95301 Ang F4.CG and I8.CG1 other bump:2.72291 Ang F4.CD1 and I8.CG1 other bump:2.90171 Ang F4.CE1 and I8.CG1 other bump:3.07711 Ang F4.C and I8.CG1 other bump:2.68683 Ang F4.O and I8.CB Number of specific fragments= 1 total=950 # 1cjaA.104.108 read from T0129.t2k.frag # found chain 1cjaA in template set T0129 104 :NQFLLGIGL 1cjaA 110 :SLLCMRLGL Fragment has 9 clashes (null) has 9 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.26409 Ang L5.CD2 and L10.C other bump:1.66289 Ang L5.CD2 and L10.O other bump:2.47681 Ang L5.CG and L10.CB other bump:2.45731 Ang L5.CD2 and L10.CB other bump:2.81729 Ang L5.CD2 and L10.CA other bump:2.79287 Ang F4.CD2 and I8.CD1 other bump:2.48512 Ang F4.CE2 and I8.CD1 other bump:2.89388 Ang F4.CE1 and I8.CD1 other bump:2.52577 Ang F4.CZ and I8.CD1 Number of specific fragments= 1 total=951 # 1phnB.105.107 read from T0129.t2k.frag # found chain 1phnB in template set T0129 105 :QFLLGIGLA 1phnB 110 :RCLNGLRET Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.66271 Ang Q2.O and L5.CB Number of specific fragments= 1 total=952 # 1cjaA.105.109 read from T0129.t2k.frag # found chain 1cjaA in template set T0129 105 :QFLLGIGLA 1cjaA 111 :LLCMRLGLH Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.95618 Ang L4.CD2 and G11.N other bump:2.2641 Ang L4.CD2 and L9.C other bump:1.66291 Ang L4.CD2 and L9.O other bump:2.47681 Ang L4.CG and L9.CB other bump:2.4573 Ang L4.CD2 and L9.CB other bump:2.81729 Ang L4.CD2 and L9.CA other bump:2.79287 Ang F3.CD2 and I7.CD1 other bump:2.48512 Ang F3.CE2 and I7.CD1 other bump:2.89388 Ang F3.CE1 and I7.CD1 other bump:2.52577 Ang F3.CZ and I7.CD1 Number of specific fragments= 1 total=953 # 1cpcB.105.107 read from T0129.t2k.frag # found chain 1cpcB in template set T0129 105 :QFLLGIGLA 1cpcB 110 :RCLNGLKET Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.45067 Ang F3.O and I7.CD1 other bump:2.50838 Ang L4.CA and I7.CD1 self-bump: 1.26953 Ang L5.CA and L5.CB self-bump: 1.38427 Ang F3.CA and F3.CB Number of specific fragments= 1 total=954 # 1ktpB.105.107 read from T0129.t2k.frag # found chain 1ktpB in template set T0129 105 :QFLLGIGLA 1ktpB 110 :RCLNGLRET Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.81505 Ang F3.O and I7.CD1 other bump:2.49475 Ang F3.C and I7.CD1 other bump:2.82549 Ang L4.N and I7.CD1 other bump:2.5711 Ang L4.CA and I7.CD1 other bump:2.22433 Ang F3.O and I7.CG1 self-bump: 1.39978 Ang F3.CA and F3.CB Number of specific fragments= 1 total=955 # 1cpcL.105.107 read from T0129.t2k.frag # found chain 1cpcL in template set T0129 105 :QFLLGIGLA 1cpcL 110 :RCLNGLKET Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.33164 Ang F3.O and I7.CD1 self-bump: 1.38668 Ang F3.CA and F3.CB Number of specific fragments= 1 total=956 # 1qq8A.105.106 read from T0129.t2k.frag # found chain 1qq8A in template set T0129 105 :QFLLGIGLA 1qq8A 116 :KRLHEVGRT Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=957 # 1cjaA.106.110 read from T0129.t2k.frag # found chain 1cjaA in template set T0129 106 :FLLGIGLAQ 1cjaA 112 :LCMRLGLHA Fragment has 11 clashes (null) has 11 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.72098 Ang L3.CB and Q10.OE1 other bump:2.91426 Ang L3.CB and Q10.CD other bump:2.83077 Ang L3.CB and Q10.CG other bump:2.96422 Ang L3.CG and Q10.CG other bump:2.74872 Ang L3.CD2 and Q10.CG other bump:2.95618 Ang L3.CD2 and Q10.N other bump:2.2641 Ang L3.CD2 and L8.C other bump:1.66289 Ang L3.CD2 and L8.O other bump:2.47681 Ang L3.CG and L8.CB other bump:2.45732 Ang L3.CD2 and L8.CB other bump:2.8173 Ang L3.CD2 and L8.CA Number of specific fragments= 1 total=958 # 1phnB.106.108 read from T0129.t2k.frag # found chain 1phnB in template set T0129 106 :FLLGIGLAQ 1phnB 111 :CLNGLRETY Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.66271 Ang G1.O and L4.CB Number of specific fragments= 1 total=959 # 1cpcB.106.108 read from T0129.t2k.frag # found chain 1cpcB in template set T0129 106 :FLLGIGLAQ 1cpcB 111 :CLNGLKETY Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.45067 Ang F2.O and I6.CD1 other bump:2.50838 Ang L3.CA and I6.CD1 self-bump: 1.26953 Ang L4.CA and L4.CB Number of specific fragments= 1 total=960 # 1cpcL.106.108 read from T0129.t2k.frag # found chain 1cpcL in template set T0129 106 :FLLGIGLAQ 1cpcL 111 :CLNGLKETY Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.33164 Ang F2.O and I6.CD1 Number of specific fragments= 1 total=961 # 1ktpB.106.108 read from T0129.t2k.frag # found chain 1ktpB in template set T0129 106 :FLLGIGLAQ 1ktpB 111 :CLNGLRETY Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.49475 Ang F2.C and I6.CD1 other bump:2.82549 Ang L3.N and I6.CD1 other bump:2.5711 Ang L3.CA and I6.CD1 other bump:1.81505 Ang F2.O and I6.CD1 other bump:2.22433 Ang F2.O and I6.CG1 Number of specific fragments= 1 total=962 # 1qq8A.106.107 read from T0129.t2k.frag # found chain 1qq8A in template set T0129 106 :FLLGIGLAQ 1qq8A 117 :RLHEVGRTE Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.72737 Ang I6.O and Q10.C Number of specific fragments= 1 total=963 # 1cjaA.107.111 read from T0129.t2k.frag # found chain 1cjaA in template set T0129 107 :LLGIGLAQP 1cjaA 113 :CMRLGLHAP Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.76909 Ang L2.CD1 and Q9.NE2 other bump:2.83637 Ang L2.CD1 and Q9.OE1 other bump:2.04641 Ang L2.CD1 and Q9.CD other bump:2.80748 Ang L2.CB and Q9.CG other bump:2.65291 Ang L2.CD1 and Q9.CG Number of specific fragments= 1 total=964 # 1qq8A.107.108 read from T0129.t2k.frag # found chain 1qq8A in template set T0129 107 :LLGIGLAQP 1qq8A 118 :LHEVGRTEP Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.72737 Ang I5.O and Q9.C Number of specific fragments= 1 total=965 # 1phnB.107.109 read from T0129.t2k.frag # found chain 1phnB in template set T0129 107 :LLGIGLAQP 1phnB 112 :LNGLRETYQ Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=966 # 1ktpB.107.109 read from T0129.t2k.frag # found chain 1ktpB in template set T0129 107 :LLGIGLAQP 1ktpB 112 :LNGLRETYQ Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.49475 Ang G1.C and I5.CD1 other bump:2.82549 Ang L2.N and I5.CD1 other bump:2.5711 Ang L2.CA and I5.CD1 other bump:1.81505 Ang G1.O and I5.CD1 other bump:2.22433 Ang G1.O and I5.CG1 Number of specific fragments= 1 total=967 # 1cpcL.107.109 read from T0129.t2k.frag # found chain 1cpcL in template set T0129 107 :LLGIGLAQP 1cpcL 112 :LNGLKETYL Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.61712 Ang G6.O and P10.CD other bump:2.70374 Ang G6.C and P10.CD other bump:2.94615 Ang L7.C and P10.CD neighbor-bump: 2.4667 Ang Q9.N and P10.CD other bump:1.86888 Ang G6.O and P10.CG other bump:2.93166 Ang G6.C and P10.CG other bump:2.33164 Ang G1.O and I5.CD1 Number of specific fragments= 1 total=968 # 1cpcB.107.109 read from T0129.t2k.frag # found chain 1cpcB in template set T0129 107 :LLGIGLAQP 1cpcB 112 :LNGLKETYL Fragment has 9 clashes (null) has 9 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.50864 Ang G6.O and P10.CD other bump:2.64263 Ang G6.C and P10.CD other bump:2.94025 Ang L7.C and P10.CD other bump:3.23416 Ang L7.CA and P10.CD other bump:1.88048 Ang G6.O and P10.CG other bump:2.97291 Ang G6.C and P10.CG other bump:2.50838 Ang L2.CA and I5.CD1 other bump:2.45067 Ang G1.O and I5.CD1 self-bump: 1.26953 Ang L3.CA and L3.CB Number of specific fragments= 1 total=969 # 1cjaA.108.112 read from T0129.t2k.frag # found chain 1cjaA in template set T0129 108 :LGIGLAQPE 1cjaA 114 :MRLGLHAPK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=970 # 1qq8A.108.109 read from T0129.t2k.frag # found chain 1qq8A in template set T0129 108 :LGIGLAQPE 1qq8A 119 :HEVGRTEPE Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.72737 Ang I4.O and Q8.C Number of specific fragments= 1 total=971 # 1cpcL.108.110 read from T0129.t2k.frag # found chain 1cpcL in template set T0129 108 :LGIGLAQPE 1cpcL 113 :NGLKETYLA Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.61712 Ang G5.O and P9.CD other bump:2.70374 Ang G5.C and P9.CD other bump:2.94614 Ang L6.C and P9.CD neighbor-bump: 2.46669 Ang Q8.N and P9.CD other bump:1.86888 Ang G5.O and P9.CG other bump:2.93166 Ang G5.C and P9.CG Number of specific fragments= 1 total=972 # 1cpcB.108.110 read from T0129.t2k.frag # found chain 1cpcB in template set T0129 108 :LGIGLAQPE 1cpcB 113 :NGLKETYLA Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.50864 Ang G5.O and P9.CD other bump:2.64262 Ang G5.C and P9.CD other bump:3.23416 Ang L6.CA and P9.CD other bump:2.94025 Ang L6.C and P9.CD other bump:1.88048 Ang G5.O and P9.CG other bump:2.97291 Ang G5.C and P9.CG Number of specific fragments= 1 total=973 # 1ktpB.108.110 read from T0129.t2k.frag # found chain 1ktpB in template set T0129 108 :LGIGLAQPE 1ktpB 113 :NGLRETYQA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=974 # 1phnB.108.110 read from T0129.t2k.frag # found chain 1phnB in template set T0129 108 :LGIGLAQPE 1phnB 113 :NGLRETYQA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=975 # 1cjaA.109.113 read from T0129.t2k.frag # found chain 1cjaA in template set T0129 109 :GIGLAQPEL 1cjaA 115 :RLGLHAPKV Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.21455 Ang P8.O and L10.CD1 Number of specific fragments= 1 total=976 # 1qq8A.109.110 read from T0129.t2k.frag # found chain 1qq8A in template set T0129 109 :GIGLAQPEL 1qq8A 120 :EVGRTEPEL Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.72737 Ang I3.O and Q7.C Number of specific fragments= 1 total=977 # 1ktpB.109.111 read from T0129.t2k.frag # found chain 1ktpB in template set T0129 109 :GIGLAQPEL 1ktpB 114 :GLRETYQAL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=978 # 1cpcL.109.111 read from T0129.t2k.frag # found chain 1cpcL in template set T0129 109 :GIGLAQPEL 1cpcL 114 :GLKETYLAL Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.61712 Ang G4.O and P8.CD other bump:2.70374 Ang G4.C and P8.CD other bump:2.94614 Ang L5.C and P8.CD neighbor-bump: 2.46669 Ang Q7.N and P8.CD other bump:1.86888 Ang G4.O and P8.CG other bump:2.93166 Ang G4.C and P8.CG Number of specific fragments= 1 total=979 # 1cpcB.109.111 read from T0129.t2k.frag # found chain 1cpcB in template set T0129 109 :GIGLAQPEL 1cpcB 114 :GLKETYLAL Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.50864 Ang G4.O and P8.CD other bump:2.64262 Ang G4.C and P8.CD other bump:2.94025 Ang L5.C and P8.CD other bump:3.23416 Ang L5.CA and P8.CD other bump:1.88048 Ang G4.O and P8.CG other bump:2.97291 Ang G4.C and P8.CG Number of specific fragments= 1 total=980 # 1phnB.109.111 read from T0129.t2k.frag # found chain 1phnB in template set T0129 109 :GIGLAQPEL 1phnB 114 :GLRETYQAL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=981 # 1cjaA.110.114 read from T0129.t2k.frag # found chain 1cjaA in template set T0129 110 :IGLAQPELA 1cjaA 116 :LGLHAPKVR Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.21455 Ang P7.O and L9.CD1 Number of specific fragments= 1 total=982 # 1ktpB.110.112 read from T0129.t2k.frag # found chain 1ktpB in template set T0129 110 :IGLAQPELA 1ktpB 115 :LRETYQALG Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.00619 Ang L9.O and A10.CB neighbor-bump: 2.39803 Ang L9.C and A10.CB Number of specific fragments= 1 total=983 # 1phnB.110.112 read from T0129.t2k.frag # found chain 1phnB in template set T0129 110 :IGLAQPELA 1phnB 115 :LRETYQALG Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.09969 Ang L9.O and A10.CB neighbor-bump: 2.42851 Ang L9.C and A10.CB Number of specific fragments= 1 total=984 # 1cpcL.110.112 read from T0129.t2k.frag # found chain 1cpcL in template set T0129 110 :IGLAQPELA 1cpcL 115 :LKETYLALG Fragment has 8 clashes (null) has 8 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.43665 Ang L9.C and A10.CB neighbor-bump: 2.11377 Ang L9.O and A10.CB other bump:1.61712 Ang G3.O and P7.CD other bump:2.70374 Ang G3.C and P7.CD other bump:2.94614 Ang L4.C and P7.CD neighbor-bump: 2.46669 Ang Q6.N and P7.CD other bump:1.86888 Ang G3.O and P7.CG other bump:2.93166 Ang G3.C and P7.CG Number of specific fragments= 1 total=985 # 1cpcB.110.112 read from T0129.t2k.frag # found chain 1cpcB in template set T0129 110 :IGLAQPELA 1cpcB 115 :LKETYLALG Fragment has 8 clashes (null) has 8 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 1.89469 Ang L9.O and A10.CB neighbor-bump: 2.35416 Ang L9.C and A10.CB other bump:1.50864 Ang G3.O and P7.CD other bump:2.64262 Ang G3.C and P7.CD other bump:3.23416 Ang L4.CA and P7.CD other bump:2.94025 Ang L4.C and P7.CD other bump:1.88048 Ang G3.O and P7.CG other bump:2.97291 Ang G3.C and P7.CG Number of specific fragments= 1 total=986 # 1qq8A.110.111 read from T0129.t2k.frag # found chain 1qq8A in template set T0129 110 :IGLAQPELA 1qq8A 121 :VGRTEPELL Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.72737 Ang I2.O and Q6.C Number of specific fragments= 1 total=987 # 1ktpB.111.113 read from T0129.t2k.frag # found chain 1ktpB in template set T0129 111 :GLAQPELAK 1ktpB 116 :RETYQALGT Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.00618 Ang L8.O and A9.CB neighbor-bump: 2.39802 Ang L8.C and A9.CB Number of specific fragments= 1 total=988 # 1cjaA.111.115 read from T0129.t2k.frag # found chain 1cjaA in template set T0129 111 :GLAQPELAK 1cjaA 117 :GLHAPKVRV Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.21455 Ang P6.O and L8.CD1 Number of specific fragments= 1 total=989 # 1phnB.111.113 read from T0129.t2k.frag # found chain 1phnB in template set T0129 111 :GLAQPELAK 1phnB 116 :RETYQALGV Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.09969 Ang L8.O and A9.CB neighbor-bump: 2.42851 Ang L8.C and A9.CB Number of specific fragments= 1 total=990 # 1cpcL.111.113 read from T0129.t2k.frag # found chain 1cpcL in template set T0129 111 :GLAQPELAK 1cpcL 116 :KETYLALGT Fragment has 8 clashes (null) has 8 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.43665 Ang L8.C and A9.CB neighbor-bump: 2.11377 Ang L8.O and A9.CB other bump:1.61712 Ang G2.O and P6.CD other bump:2.70374 Ang G2.C and P6.CD other bump:2.94614 Ang L3.C and P6.CD neighbor-bump: 2.46669 Ang Q5.N and P6.CD other bump:1.86888 Ang G2.O and P6.CG other bump:2.93166 Ang G2.C and P6.CG Number of specific fragments= 1 total=991 # 1cpcB.111.113 read from T0129.t2k.frag # found chain 1cpcB in template set T0129 111 :GLAQPELAK 1cpcB 116 :KETYLALGT Fragment has 8 clashes (null) has 8 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 1.89468 Ang L8.O and A9.CB neighbor-bump: 2.35415 Ang L8.C and A9.CB other bump:1.50864 Ang G2.O and P6.CD other bump:2.64262 Ang G2.C and P6.CD other bump:3.23416 Ang L3.CA and P6.CD other bump:2.94025 Ang L3.C and P6.CD other bump:1.88048 Ang G2.O and P6.CG other bump:2.97291 Ang G2.C and P6.CG Number of specific fragments= 1 total=992 # 1qq8A.111.112 read from T0129.t2k.frag # found chain 1qq8A in template set T0129 111 :GLAQPELAK 1qq8A 122 :GRTEPELLV Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.72737 Ang G1.O and Q5.C Number of specific fragments= 1 total=993 # 1ktpB.112.114 read from T0129.t2k.frag # found chain 1ktpB in template set T0129 112 :LAQPELAKE 1ktpB 117 :ETYQALGTP Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.00618 Ang L7.O and A8.CB neighbor-bump: 2.39802 Ang L7.C and A8.CB Number of specific fragments= 1 total=994 # 1cpcL.112.114 read from T0129.t2k.frag # found chain 1cpcL in template set T0129 112 :LAQPELAKE 1cpcL 117 :ETYLALGTP Fragment has 8 clashes (null) has 8 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.43665 Ang L7.C and A8.CB neighbor-bump: 2.11377 Ang L7.O and A8.CB other bump:1.61712 Ang G1.O and P5.CD other bump:2.70374 Ang G1.C and P5.CD other bump:2.94614 Ang L2.C and P5.CD neighbor-bump: 2.46669 Ang Q4.N and P5.CD other bump:1.86888 Ang G1.O and P5.CG other bump:2.93166 Ang G1.C and P5.CG Number of specific fragments= 1 total=995 # 1cpcB.112.114 read from T0129.t2k.frag # found chain 1cpcB in template set T0129 112 :LAQPELAKE 1cpcB 117 :ETYLALGTP Fragment has 8 clashes (null) has 8 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 1.89468 Ang L7.O and A8.CB neighbor-bump: 2.35415 Ang L7.C and A8.CB other bump:1.50864 Ang G1.O and P5.CD other bump:2.64262 Ang G1.C and P5.CD other bump:3.23416 Ang L2.CA and P5.CD other bump:2.94025 Ang L2.C and P5.CD other bump:1.88048 Ang G1.O and P5.CG other bump:2.97291 Ang G1.C and P5.CG Number of specific fragments= 1 total=996 # 1phnB.112.114 read from T0129.t2k.frag # found chain 1phnB in template set T0129 112 :LAQPELAKE 1phnB 117 :ETYQALGVP Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.09969 Ang L7.O and A8.CB neighbor-bump: 2.42851 Ang L7.C and A8.CB Number of specific fragments= 1 total=997 # 1qq8A.112.113 read from T0129.t2k.frag # found chain 1qq8A in template set T0129 112 :LAQPELAKE 1qq8A 123 :RTEPELLVA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=998 # 1cjaA.112.116 read from T0129.t2k.frag # found chain 1cjaA in template set T0129 112 :LAQPELAKE 1cjaA 118 :LHAPKVRVV Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.21455 Ang P5.O and L7.CD1 Number of specific fragments= 1 total=999 # 1ktpB.113.115 read from T0129.t2k.frag # found chain 1ktpB in template set T0129 113 :AQPELAKEK 1ktpB 118 :TYQALGTPG Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.00618 Ang L6.O and A7.CB neighbor-bump: 2.39802 Ang L6.C and A7.CB Number of specific fragments= 1 total=1000 # 1cpcL.113.115 read from T0129.t2k.frag # found chain 1cpcL in template set T0129 113 :AQPELAKEK 1cpcL 118 :TYLALGTPG Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.65068 Ang P4.CB and K10.NZ other bump:1.45281 Ang P4.CG and K10.NZ other bump:1.68783 Ang P4.CD and K10.NZ other bump:2.76437 Ang P4.CG and K10.CE other bump:2.95275 Ang Q3.CB and K10.CD other bump:2.93261 Ang Q3.CD and K10.CG neighbor-bump: 2.11377 Ang L6.O and A7.CB neighbor-bump: 2.43665 Ang L6.C and A7.CB other bump:2.94614 Ang G1.C and P4.CD neighbor-bump: 2.46669 Ang Q3.N and P4.CD Number of specific fragments= 1 total=1001 # 1cpcB.113.115 read from T0129.t2k.frag # found chain 1cpcB in template set T0129 113 :AQPELAKEK 1cpcB 118 :TYLALGTPG Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 1.89468 Ang L6.O and A7.CB neighbor-bump: 2.35415 Ang L6.C and A7.CB other bump:2.94025 Ang G1.C and P4.CD Number of specific fragments= 1 total=1002 # 1phnB.113.115 read from T0129.t2k.frag # found chain 1phnB in template set T0129 113 :AQPELAKEK 1phnB 118 :TYQALGVPG Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues self-bump: 1.38781 Ang E9.CA and E9.CB neighbor-bump: 2.09969 Ang L6.O and A7.CB neighbor-bump: 2.42851 Ang L6.C and A7.CB Number of specific fragments= 1 total=1003 # 1qq8A.113.114 read from T0129.t2k.frag # found chain 1qq8A in template set T0129 113 :AQPELAKEK 1qq8A 124 :TEPELLVAH Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1004 # 1cjaA.113.117 read from T0129.t2k.frag # found chain 1cjaA in template set T0129 113 :AQPELAKEK 1cjaA 119 :HAPKVRVVS Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.21455 Ang P4.O and L6.CD1 Number of specific fragments= 1 total=1005 # 1ktpB.114.116 read from T0129.t2k.frag # found chain 1ktpB in template set T0129 114 :QPELAKEKG 1ktpB 119 :YQALGTPGS Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.28827 Ang Q2.OE1 and K7.CB neighbor-bump: 2.00618 Ang L5.O and A6.CB neighbor-bump: 2.39802 Ang L5.C and A6.CB Number of specific fragments= 1 total=1006 # 1cpcL.114.116 read from T0129.t2k.frag # found chain 1cpcL in template set T0129 114 :QPELAKEKG 1cpcL 119 :YLALGTPGS Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.43665 Ang L5.C and A6.CB neighbor-bump: 2.11377 Ang L5.O and A6.CB neighbor-bump: 2.46669 Ang Q2.N and P3.CD Number of specific fragments= 1 total=1007 # 1cpcB.114.116 read from T0129.t2k.frag # found chain 1cpcB in template set T0129 114 :QPELAKEKG 1cpcB 119 :YLALGTPGS Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 1.89468 Ang L5.O and A6.CB neighbor-bump: 2.35415 Ang L5.C and A6.CB Number of specific fragments= 1 total=1008 # 1phnB.114.116 read from T0129.t2k.frag # found chain 1phnB in template set T0129 114 :QPELAKEKG 1phnB 119 :YQALGVPGA Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues self-bump: 1.38781 Ang E8.CA and E8.CB neighbor-bump: 2.09969 Ang L5.O and A6.CB neighbor-bump: 2.42851 Ang L5.C and A6.CB Number of specific fragments= 1 total=1009 # 1qq8A.114.115 read from T0129.t2k.frag # found chain 1qq8A in template set T0129 114 :QPELAKEKG 1qq8A 125 :EPELLVAHA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1010 # 1cjaA.114.118 read from T0129.t2k.frag # found chain 1cjaA in template set T0129 114 :QPELAKEKG 1cjaA 120 :APKVRVVSS Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.21455 Ang P3.O and L5.CD1 Number of specific fragments= 1 total=1011 # 1ktpB.115.117 read from T0129.t2k.frag # found chain 1ktpB in template set T0129 115 :PELAKEKGE 1ktpB 120 :QALGTPGSS Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.00618 Ang L4.O and A5.CB neighbor-bump: 2.39802 Ang L4.C and A5.CB Number of specific fragments= 1 total=1012 # 1cpcL.115.117 read from T0129.t2k.frag # found chain 1cpcL in template set T0129 115 :PELAKEKGE 1cpcL 120 :LALGTPGSS Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.43665 Ang L4.C and A5.CB neighbor-bump: 2.11377 Ang L4.O and A5.CB Number of specific fragments= 1 total=1013 # 1cpcB.115.117 read from T0129.t2k.frag # found chain 1cpcB in template set T0129 115 :PELAKEKGE 1cpcB 120 :LALGTPGSS Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 1.89468 Ang L4.O and A5.CB neighbor-bump: 2.35415 Ang L4.C and A5.CB Number of specific fragments= 1 total=1014 # 1phnB.115.117 read from T0129.t2k.frag # found chain 1phnB in template set T0129 115 :PELAKEKGE 1phnB 120 :QALGVPGAS Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues self-bump: 1.38781 Ang E7.CA and E7.CB neighbor-bump: 2.09969 Ang L4.O and A5.CB neighbor-bump: 2.42851 Ang L4.C and A5.CB Number of specific fragments= 1 total=1015 # 1cjaA.115.119 read from T0129.t2k.frag # found chain 1cjaA in template set T0129 115 :PELAKEKGE 1cjaA 121 :PKVRVVSSN Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.21455 Ang P2.O and L4.CD1 Number of specific fragments= 1 total=1016 # 1qq8A.115.116 read from T0129.t2k.frag # found chain 1qq8A in template set T0129 115 :PELAKEKGE 1qq8A 126 :PELLVAHAY Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1017 # 1ktpB.116.118 read from T0129.t2k.frag # found chain 1ktpB in template set T0129 116 :ELAKEKGEI 1ktpB 121 :ALGTPGSSV Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.00618 Ang L3.O and A4.CB neighbor-bump: 2.39802 Ang L3.C and A4.CB Number of specific fragments= 1 total=1018 # 1cpcL.116.118 read from T0129.t2k.frag # found chain 1cpcL in template set T0129 116 :ELAKEKGEI 1cpcL 121 :ALGTPGSSV Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.43665 Ang L3.C and A4.CB neighbor-bump: 2.11377 Ang L3.O and A4.CB Number of specific fragments= 1 total=1019 # 1cpcB.116.118 read from T0129.t2k.frag # found chain 1cpcB in template set T0129 116 :ELAKEKGEI 1cpcB 121 :ALGTPGSSV Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 1.89468 Ang L3.O and A4.CB neighbor-bump: 2.35415 Ang L3.C and A4.CB Number of specific fragments= 1 total=1020 # 1phnB.116.118 read from T0129.t2k.frag # found chain 1phnB in template set T0129 116 :ELAKEKGEI 1phnB 121 :ALGVPGASV Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues self-bump: 1.38781 Ang E6.CA and E6.CB neighbor-bump: 2.09969 Ang L3.O and A4.CB neighbor-bump: 2.42851 Ang L3.C and A4.CB Number of specific fragments= 1 total=1021 # 1qrjB.116.116 read from T0129.t2k.frag # found chain 1qrjB in template set T0129 116 :ELAKEKGEI 1qrjB 132 :SWASILQGL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1022 # 1ffkJ.116.116 read from T0129.t2k.frag # found chain 1ffkJ in template set Number of specific fragments= 0 total=1022 # 1ktpB.117.119 read from T0129.t2k.frag # found chain 1ktpB in template set T0129 117 :LAKEKGEIG 1ktpB 122 :LGTPGSSVA Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.00618 Ang L2.O and A3.CB neighbor-bump: 2.39802 Ang L2.C and A3.CB Number of specific fragments= 1 total=1023 # 1cpcL.117.119 read from T0129.t2k.frag # found chain 1cpcL in template set T0129 117 :LAKEKGEIG 1cpcL 122 :LGTPGSSVA Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.43665 Ang L2.C and A3.CB neighbor-bump: 2.11377 Ang L2.O and A3.CB Number of specific fragments= 1 total=1024 # 1cpcB.117.119 read from T0129.t2k.frag # found chain 1cpcB in template set T0129 117 :LAKEKGEIG 1cpcB 122 :LGTPGSSVA Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 1.89468 Ang L2.O and A3.CB neighbor-bump: 2.35415 Ang L2.C and A3.CB Number of specific fragments= 1 total=1025 # 1phnB.117.119 read from T0129.t2k.frag # found chain 1phnB in template set T0129 117 :LAKEKGEIG 1phnB 122 :LGVPGASVA Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues self-bump: 1.38781 Ang E5.CA and E5.CB neighbor-bump: 2.09969 Ang L2.O and A3.CB neighbor-bump: 2.42851 Ang L2.C and A3.CB Number of specific fragments= 1 total=1026 # 1qrjB.117.117 read from T0129.t2k.frag # found chain 1qrjB in template set T0129 117 :LAKEKGEIG 1qrjB 133 :WASILQGLE Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1027 # 1ffkJ.117.117 read from T0129.t2k.frag # found chain 1ffkJ in template set Number of specific fragments= 0 total=1027 # 1ktpB.118.120 read from T0129.t2k.frag # found chain 1ktpB in template set T0129 118 :AKEKGEIGE 1ktpB 123 :GTPGSSVAV Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.22304 Ang G6.O and E10.OE2 other bump:2.55223 Ang E7.C and E10.OE1 other bump:1.52656 Ang G6.O and E10.OE1 other bump:2.11477 Ang E7.CA and E10.OE1 other bump:2.21541 Ang G6.C and E10.OE1 other bump:2.0198 Ang G6.O and E10.CD other bump:3.25175 Ang E7.CA and E10.CD other bump:2.91816 Ang G6.C and E10.CD neighbor-bump: 2.00619 Ang G1.O and A2.CB neighbor-bump: 2.39803 Ang G1.C and A2.CB Number of specific fragments= 1 total=1028 # 1cpcL.118.120 read from T0129.t2k.frag # found chain 1cpcL in template set T0129 118 :AKEKGEIGE 1cpcL 123 :GTPGSSVAV Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.43665 Ang G1.C and A2.CB neighbor-bump: 2.11377 Ang G1.O and A2.CB Number of specific fragments= 1 total=1029 # 1cpcB.118.120 read from T0129.t2k.frag # found chain 1cpcB in template set T0129 118 :AKEKGEIGE 1cpcB 123 :GTPGSSVAV Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 1.89469 Ang G1.O and A2.CB neighbor-bump: 2.35415 Ang G1.C and A2.CB Number of specific fragments= 1 total=1030 # 1phnB.118.120 read from T0129.t2k.frag # found chain 1phnB in template set T0129 118 :AKEKGEIGE 1phnB 123 :GVPGASVAV Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues self-bump: 1.38781 Ang E4.CA and E4.CB neighbor-bump: 2.09969 Ang G1.O and A2.CB neighbor-bump: 2.42851 Ang G1.C and A2.CB Number of specific fragments= 1 total=1031 # 1qrjB.118.118 read from T0129.t2k.frag # found chain 1qrjB in template set T0129 118 :AKEKGEIGE 1qrjB 134 :ASILQGLEE Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.51805 Ang E7.CB and E10.OE2 other bump:2.88867 Ang E7.CG and E10.OE2 other bump:2.97495 Ang E7.CB and E10.CD other bump:2.86222 Ang E7.CG and E10.CD Number of specific fragments= 1 total=1032 # 1qtfA.118.118 read from T0129.t2k.frag # found chain 1qtfA in template set T0129 118 :AKEKGEIGE 1qtfA 119 :KLKPNEKGE Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:3.11984 Ang K5.CD and G9.C other bump:2.50785 Ang K5.CD and G9.O Number of specific fragments= 1 total=1033 # 1ktpB.119.121 read from T0129.t2k.frag # found chain 1ktpB in template set T0129 119 :KEKGEIGEA 1ktpB 124 :TPGSSVAVA Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.21526 Ang E6.OE1 and E9.OE1 Number of specific fragments= 1 total=1034 # 1cpcL.119.121 read from T0129.t2k.frag # found chain 1cpcL in template set T0129 119 :KEKGEIGEA 1cpcL 124 :TPGSSVAVG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1035 # 1cpcB.119.121 read from T0129.t2k.frag # found chain 1cpcB in template set T0129 119 :KEKGEIGEA 1cpcB 124 :TPGSSVAVG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1036 # 1phnB.119.121 read from T0129.t2k.frag # found chain 1phnB in template set T0129 119 :KEKGEIGEA 1phnB 124 :VPGASVAVG Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues self-bump: 1.3878 Ang E3.CA and E3.CB Number of specific fragments= 1 total=1037 # 1qrjB.119.119 read from T0129.t2k.frag # found chain 1qrjB in template set T0129 119 :KEKGEIGEA 1qrjB 135 :SILQGLEEP Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.51805 Ang E6.CB and E9.OE2 other bump:2.88867 Ang E6.CG and E9.OE2 other bump:2.97495 Ang E6.CB and E9.CD other bump:2.86222 Ang E6.CG and E9.CD Number of specific fragments= 1 total=1038 # 1fyhA.119.123 read from T0129.t2k.frag # found chain 1fyhA in template set T0129 119 :KEKGEIGEA 1fyhA 123 :NVSGEFVKE Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.33013 Ang E3.OE1 and I7.CD1 Number of specific fragments= 1 total=1039 # 1ktpB.120.122 read from T0129.t2k.frag # found chain 1ktpB in template set T0129 120 :EKGEIGEAV 1ktpB 125 :PGSSVAVAI Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.21526 Ang E5.OE1 and E8.OE1 Number of specific fragments= 1 total=1040 # 1cpcL.120.122 read from T0129.t2k.frag # found chain 1cpcL in template set T0129 120 :EKGEIGEAV 1cpcL 125 :PGSSVAVGV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1041 # 1cpcB.120.122 read from T0129.t2k.frag # found chain 1cpcB in template set T0129 120 :EKGEIGEAV 1cpcB 125 :PGSSVAVGV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1042 # 1phnB.120.122 read from T0129.t2k.frag # found chain 1phnB in template set T0129 120 :EKGEIGEAV 1phnB 125 :PGASVAVGI Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues self-bump: 1.3878 Ang E2.CA and E2.CB Number of specific fragments= 1 total=1043 # 1qrjB.120.120 read from T0129.t2k.frag # found chain 1qrjB in template set T0129 120 :EKGEIGEAV 1qrjB 136 :ILQGLEEPY Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.51805 Ang E5.CB and E8.OE2 other bump:2.88867 Ang E5.CG and E8.OE2 other bump:2.97495 Ang E5.CB and E8.CD other bump:2.86222 Ang E5.CG and E8.CD Number of specific fragments= 1 total=1044 # 1qrjB.120.124 read from T0129.t2k.frag # found chain 1qrjB in template set T0129 120 :EKGEIGEAV 1qrjB 140 :LEEPYHAFV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1045 # 1ktpB.121.123 read from T0129.t2k.frag # found chain 1ktpB in template set T0129 121 :KGEIGEAVD 1ktpB 126 :GSSVAVAIQ Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.21526 Ang E4.OE1 and E7.OE1 Number of specific fragments= 1 total=1046 # 1cpcL.121.123 read from T0129.t2k.frag # found chain 1cpcL in template set T0129 121 :KGEIGEAVD 1cpcL 126 :GSSVAVGVQ Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1047 # 1cpcB.121.123 read from T0129.t2k.frag # found chain 1cpcB in template set T0129 121 :KGEIGEAVD 1cpcB 126 :GSSVAVGVQ Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1048 # 1phnB.121.123 read from T0129.t2k.frag # found chain 1phnB in template set T0129 121 :KGEIGEAVD 1phnB 126 :GASVAVGIE Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1049 # 1qrjB.121.121 read from T0129.t2k.frag # found chain 1qrjB in template set T0129 121 :KGEIGEAVD 1qrjB 137 :LQGLEEPYH Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.51805 Ang E4.CB and E7.OE2 other bump:2.88867 Ang E4.CG and E7.OE2 other bump:2.97495 Ang E4.CB and E7.CD other bump:2.86222 Ang E4.CG and E7.CD Number of specific fragments= 1 total=1050 # 1qrjB.121.125 read from T0129.t2k.frag # found chain 1qrjB in template set T0129 121 :KGEIGEAVD 1qrjB 141 :EEPYHAFVE Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1051 # 1ktpB.122.124 read from T0129.t2k.frag # found chain 1ktpB in template set T0129 122 :GEIGEAVDD 1ktpB 127 :SSVAVAIQK Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.21526 Ang E3.OE1 and E6.OE1 Number of specific fragments= 1 total=1052 # 1cpcL.122.124 read from T0129.t2k.frag # found chain 1cpcL in template set T0129 122 :GEIGEAVDD 1cpcL 127 :SSVAVGVQK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1053 # 1cpcB.122.124 read from T0129.t2k.frag # found chain 1cpcB in template set T0129 122 :GEIGEAVDD 1cpcB 127 :SSVAVGVQK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1054 # 1phnB.122.124 read from T0129.t2k.frag # found chain 1phnB in template set T0129 122 :GEIGEAVDD 1phnB 127 :ASVAVGIEK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1055 # 1qrjB.122.122 read from T0129.t2k.frag # found chain 1qrjB in template set T0129 122 :GEIGEAVDD 1qrjB 138 :QGLEEPYHA Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.51805 Ang E3.CB and E6.OE2 other bump:2.88867 Ang E3.CG and E6.OE2 other bump:2.97495 Ang E3.CB and E6.CD other bump:2.86222 Ang E3.CG and E6.CD Number of specific fragments= 1 total=1056 # 1qrjB.122.126 read from T0129.t2k.frag # found chain 1qrjB in template set T0129 122 :GEIGEAVDD 1qrjB 142 :EPYHAFVER Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1057 # 1ktpB.123.125 read from T0129.t2k.frag # found chain 1ktpB in template set T0129 123 :EIGEAVDDL 1ktpB 128 :SVAVAIQKM Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.21524 Ang E2.OE1 and E5.OE1 Number of specific fragments= 1 total=1058 # 1cpcL.123.125 read from T0129.t2k.frag # found chain 1cpcL in template set T0129 123 :EIGEAVDDL 1cpcL 128 :SVAVGVQKM Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1059 # 1cpcB.123.125 read from T0129.t2k.frag # found chain 1cpcB in template set T0129 123 :EIGEAVDDL 1cpcB 128 :SVAVGVQKM Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1060 # 1qrjB.123.123 read from T0129.t2k.frag # found chain 1qrjB in template set T0129 123 :EIGEAVDDL 1qrjB 139 :GLEEPYHAF Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.40327 Ang E2.CB and E5.OE2 other bump:2.63481 Ang E2.CG and E5.OE2 other bump:2.86678 Ang E2.CB and E5.CD other bump:2.58043 Ang E2.CG and E5.CD other bump:3.0564 Ang E2.CB and E5.CB Number of specific fragments= 1 total=1061 # 1phnB.123.125 read from T0129.t2k.frag # found chain 1phnB in template set T0129 123 :EIGEAVDDL 1phnB 128 :SVAVGIEKM Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1062 # 1qrjB.123.127 read from T0129.t2k.frag # found chain 1qrjB in template set T0129 123 :EIGEAVDDL 1qrjB 143 :PYHAFVERL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1063 # 1ktpB.124.126 read from T0129.t2k.frag # found chain 1ktpB in template set T0129 124 :IGEAVDDLQ 1ktpB 129 :VAVAIQKMK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1064 # 1cpcL.124.126 read from T0129.t2k.frag # found chain 1cpcL in template set T0129 124 :IGEAVDDLQ 1cpcL 129 :VAVGVQKMK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1065 # 1cpcB.124.126 read from T0129.t2k.frag # found chain 1cpcB in template set T0129 124 :IGEAVDDLQ 1cpcB 129 :VAVGVQKMK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1066 # 1phnB.124.126 read from T0129.t2k.frag # found chain 1phnB in template set T0129 124 :IGEAVDDLQ 1phnB 129 :VAVGIEKMK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1067 # 1qrjB.124.128 read from T0129.t2k.frag # found chain 1qrjB in template set T0129 124 :IGEAVDDLQ 1qrjB 144 :YHAFVERLN Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1068 # 1qrjB.124.124 read from T0129.t2k.frag # found chain 1qrjB in template set T0129 124 :IGEAVDDLQ 1qrjB 140 :LEEPYHAFV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1069 # 1ktpB.125.127 read from T0129.t2k.frag # found chain 1ktpB in template set T0129 125 :GEAVDDLQD 1ktpB 130 :AVAIQKMKD Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1070 # 1cpcL.125.127 read from T0129.t2k.frag # found chain 1cpcL in template set T0129 125 :GEAVDDLQD 1cpcL 130 :AVGVQKMKD Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1071 # 1cpcB.125.127 read from T0129.t2k.frag # found chain 1cpcB in template set T0129 125 :GEAVDDLQD 1cpcB 130 :AVGVQKMKD Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1072 # 1phnB.125.127 read from T0129.t2k.frag # found chain 1phnB in template set T0129 125 :GEAVDDLQD 1phnB 130 :AVGIEKMKD Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1073 # 1qrjB.125.129 read from T0129.t2k.frag # found chain 1qrjB in template set T0129 125 :GEAVDDLQD 1qrjB 145 :HAFVERLNI Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1074 # 1qrjB.125.125 read from T0129.t2k.frag # found chain 1qrjB in template set T0129 125 :GEAVDDLQD 1qrjB 141 :EEPYHAFVE Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1075 # 1ktpB.126.128 read from T0129.t2k.frag # found chain 1ktpB in template set T0129 126 :EAVDDLQDI 1ktpB 131 :VAIQKMKDA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1076 # 1cpcL.126.128 read from T0129.t2k.frag # found chain 1cpcL in template set T0129 126 :EAVDDLQDI 1cpcL 131 :VGVQKMKDA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1077 # 1cpcB.126.128 read from T0129.t2k.frag # found chain 1cpcB in template set T0129 126 :EAVDDLQDI 1cpcB 131 :VGVQKMKDA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1078 # 1phnB.126.128 read from T0129.t2k.frag # found chain 1phnB in template set T0129 126 :EAVDDLQDI 1phnB 131 :VGIEKMKDS Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1079 # 1qrjB.126.130 read from T0129.t2k.frag # found chain 1qrjB in template set T0129 126 :EAVDDLQDI 1qrjB 146 :AFVERLNIA Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.91257 Ang D6.OD1 and I10.CD1 Number of specific fragments= 1 total=1080 # 1cpcA.126.127 read from T0129.t2k.frag # found chain 1cpcA in template set T0129 126 :EAVDDLQDI 1cpcA 128 :WYVEALKYI Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1081 # 1ktpB.127.129 read from T0129.t2k.frag # found chain 1ktpB in template set T0129 127 :AVDDLQDIC 1ktpB 132 :AIQKMKDAA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1082 # 1cpcL.127.129 read from T0129.t2k.frag # found chain 1cpcL in template set T0129 127 :AVDDLQDIC 1cpcL 132 :GVQKMKDAA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1083 # 1cpcB.127.129 read from T0129.t2k.frag # found chain 1cpcB in template set T0129 127 :AVDDLQDIC 1cpcB 132 :GVQKMKDAA Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues self-bump: 1.37672 Ang A2.CA and A2.CB Number of specific fragments= 1 total=1084 # 1phnB.127.129 read from T0129.t2k.frag # found chain 1phnB in template set T0129 127 :AVDDLQDIC 1phnB 132 :GIEKMKDSA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1085 # 1qrjB.127.131 read from T0129.t2k.frag # found chain 1qrjB in template set T0129 127 :AVDDLQDIC 1qrjB 147 :FVERLNIAL Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.91257 Ang D5.OD1 and I9.CD1 Number of specific fragments= 1 total=1086 # 1cpcA.127.128 read from T0129.t2k.frag # found chain 1cpcA in template set T0129 127 :AVDDLQDIC 1cpcA 129 :YVEALKYIK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1087 # 1ktpB.128.130 read from T0129.t2k.frag # found chain 1ktpB in template set T0129 128 :VDDLQDICQ 1ktpB 133 :IQKMKDAAI Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1088 # 1cpcL.128.130 read from T0129.t2k.frag # found chain 1cpcL in template set T0129 128 :VDDLQDICQ 1cpcL 133 :VQKMKDAAL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1089 # 1cpcB.128.130 read from T0129.t2k.frag # found chain 1cpcB in template set T0129 128 :VDDLQDICQ 1cpcB 133 :VQKMKDAAL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1090 # 1phnB.128.130 read from T0129.t2k.frag # found chain 1phnB in template set T0129 128 :VDDLQDICQ 1phnB 133 :IEKMKDSAI Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1091 # 1qrjB.128.132 read from T0129.t2k.frag # found chain 1qrjB in template set T0129 128 :VDDLQDICQ 1qrjB 148 :VERLNIALD Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.91257 Ang D4.OD1 and I8.CD1 Number of specific fragments= 1 total=1092 # 1cpcA.128.129 read from T0129.t2k.frag # found chain 1cpcA in template set T0129 128 :VDDLQDICQ 1cpcA 130 :VEALKYIKA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1093 # 1ktpB.129.131 read from T0129.t2k.frag # found chain 1ktpB in template set T0129 129 :DDLQDICQL 1ktpB 134 :QKMKDAAIA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1094 # 1cpcL.129.131 read from T0129.t2k.frag # found chain 1cpcL in template set T0129 129 :DDLQDICQL 1cpcL 134 :QKMKDAALA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1095 # 1cpcB.129.131 read from T0129.t2k.frag # found chain 1cpcB in template set T0129 129 :DDLQDICQL 1cpcB 134 :QKMKDAALA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1096 # 1phnB.129.131 read from T0129.t2k.frag # found chain 1phnB in template set T0129 129 :DDLQDICQL 1phnB 134 :EKMKDSAIA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1097 # 1cpcA.129.130 read from T0129.t2k.frag # found chain 1cpcA in template set T0129 129 :DDLQDICQL 1cpcA 131 :EALKYIKAN Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1098 # 1qrjB.129.133 read from T0129.t2k.frag # found chain 1qrjB in template set T0129 129 :DDLQDICQL 1qrjB 149 :ERLNIALDN Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.91257 Ang D3.OD1 and I7.CD1 Number of specific fragments= 1 total=1099 # 1ktpB.130.132 read from T0129.t2k.frag # found chain 1ktpB in template set T0129 130 :DLQDICQLG 1ktpB 135 :KMKDAAIAI Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1100 # 1cpcL.130.132 read from T0129.t2k.frag # found chain 1cpcL in template set T0129 130 :DLQDICQLG 1cpcL 135 :KMKDAALAI Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1101 # 1cpcB.130.132 read from T0129.t2k.frag # found chain 1cpcB in template set T0129 130 :DLQDICQLG 1cpcB 135 :KMKDAALAI Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1102 # 1qrjB.130.134 read from T0129.t2k.frag # found chain 1qrjB in template set T0129 130 :DLQDICQLG 1qrjB 150 :RLNIALDNG Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.91257 Ang D2.OD1 and I6.CD1 Number of specific fragments= 1 total=1103 # 1cpcA.130.131 read from T0129.t2k.frag # found chain 1cpcA in template set T0129 130 :DLQDICQLG 1cpcA 132 :ALKYIKANH Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.30177 Ang D5.OD1 and L9.CD1 other bump:3.04177 Ang D5.OD2 and L9.CD1 Number of specific fragments= 1 total=1104 # 1phnB.130.132 read from T0129.t2k.frag # found chain 1phnB in template set T0129 130 :DLQDICQLG 1phnB 135 :KMKDSAIAI Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1105 # 1qrjB.131.135 read from T0129.t2k.frag # found chain 1qrjB in template set T0129 131 :LQDICQLGY 1qrjB 151 :LNIALDNGL Fragment has 16 clashes (null) has 16 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.94626 Ang C6.CB and Y10.CZ other bump:2.10279 Ang C6.SG and Y10.CZ other bump:2.06142 Ang C6.CB and Y10.CE2 other bump:1.94421 Ang C6.CA and Y10.CE2 other bump:2.56664 Ang C6.C and Y10.CE2 other bump:1.80859 Ang C6.SG and Y10.CE2 other bump:2.65708 Ang C6.O and Y10.CE2 other bump:2.47337 Ang C6.SG and Y10.CE1 other bump:2.54641 Ang C6.CB and Y10.CD2 other bump:2.3411 Ang C6.CA and Y10.CD2 other bump:2.02004 Ang C6.C and Y10.CD2 other bump:1.94301 Ang C6.SG and Y10.CD2 other bump:1.79716 Ang C6.O and Y10.CD2 other bump:2.57075 Ang C6.SG and Y10.CD1 other bump:3.25746 Ang C6.C and Y10.CG other bump:2.35371 Ang C6.SG and Y10.CG Number of specific fragments= 1 total=1106 # 1cpcL.131.133 read from T0129.t2k.frag # found chain 1cpcL in template set T0129 131 :LQDICQLGY 1cpcL 136 :MKDAALAIA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1107 # 1cpcB.131.133 read from T0129.t2k.frag # found chain 1cpcB in template set T0129 131 :LQDICQLGY 1cpcB 136 :MKDAALAIA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1108 # 1cpcA.131.132 read from T0129.t2k.frag # found chain 1cpcA in template set T0129 131 :LQDICQLGY 1cpcA 133 :LKYIKANHG Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.30177 Ang D4.OD1 and L8.CD1 other bump:3.04177 Ang D4.OD2 and L8.CD1 Number of specific fragments= 1 total=1109 # 1ktpB.131.133 read from T0129.t2k.frag # found chain 1ktpB in template set T0129 131 :LQDICQLGY 1ktpB 136 :MKDAAIAIA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1110 # 1cpcB.131.135 read from T0129.t2k.frag # found chain 1cpcB in template set T0129 131 :LQDICQLGY 1cpcB 138 :DAALAIAGD Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.56357 Ang Q3.CD and Q7.NE2 other bump:1.93226 Ang Q3.OE1 and Q7.NE2 Number of specific fragments= 1 total=1111 # 1qrjB.132.136 read from T0129.t2k.frag # found chain 1qrjB in template set T0129 132 :QDICQLGYD 1qrjB 152 :NIALDNGLP Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:3.02674 Ang C5.SG and Y9.CZ other bump:2.75419 Ang C5.CA and Y9.CE2 other bump:2.72152 Ang C5.CB and Y9.CE2 other bump:2.04682 Ang C5.SG and Y9.CE2 other bump:2.70112 Ang C5.CA and Y9.CD2 other bump:2.73175 Ang C5.CB and Y9.CD2 other bump:2.64103 Ang C5.C and Y9.CD2 other bump:1.7854 Ang C5.SG and Y9.CD2 other bump:2.38066 Ang C5.O and Y9.CD2 other bump:2.68511 Ang C5.SG and Y9.CG Number of specific fragments= 1 total=1112 # 1cpcA.132.133 read from T0129.t2k.frag # found chain 1cpcA in template set T0129 132 :QDICQLGYD 1cpcA 134 :KYIKANHGL Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.30177 Ang D3.OD1 and L7.CD1 other bump:3.04177 Ang D3.OD2 and L7.CD1 Number of specific fragments= 1 total=1113 # 1cpcB.132.136 read from T0129.t2k.frag # found chain 1cpcB in template set T0129 132 :QDICQLGYD 1cpcB 139 :AALAIAGDT Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:3.00167 Ang Y9.CE2 and G11.CA other bump:3.1648 Ang Y9.CE2 and G11.N Number of specific fragments= 1 total=1114 # 1cpcL.132.136 read from T0129.t2k.frag # found chain 1cpcL in template set T0129 132 :QDICQLGYD 1cpcL 139 :AALAIAGDT Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:3.06624 Ang Y9.CE2 and G11.CA other bump:2.86562 Ang Y9.CE2 and G11.N Number of specific fragments= 1 total=1115 # 1cpcL.132.134 read from T0129.t2k.frag # found chain 1cpcL in template set T0129 132 :QDICQLGYD 1cpcL 137 :KDAALAIAG Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.26373 Ang L7.O and D10.OD1 other bump:2.78328 Ang L7.C and D10.OD1 other bump:2.47528 Ang Q6.O and D10.CG Number of specific fragments= 1 total=1116 # 1cpcB.132.134 read from T0129.t2k.frag # found chain 1cpcB in template set T0129 132 :QDICQLGYD 1cpcB 137 :KDAALAIAG Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.73557 Ang L7.C and D10.OD1 other bump:2.77137 Ang L7.CA and D10.OD1 other bump:2.45649 Ang Q6.O and D10.CG Number of specific fragments= 1 total=1117 # 1qrjB.133.137 read from T0129.t2k.frag # found chain 1qrjB in template set T0129 133 :DICQLGYDE 1qrjB 153 :IALDNGLPE Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:3.02673 Ang C4.SG and Y8.CZ other bump:2.75419 Ang C4.CA and Y8.CE2 other bump:2.72152 Ang C4.CB and Y8.CE2 other bump:2.04682 Ang C4.SG and Y8.CE2 other bump:2.70112 Ang C4.CA and Y8.CD2 other bump:2.73175 Ang C4.CB and Y8.CD2 other bump:2.38066 Ang C4.O and Y8.CD2 other bump:2.64103 Ang C4.C and Y8.CD2 other bump:1.78539 Ang C4.SG and Y8.CD2 other bump:2.68511 Ang C4.SG and Y8.CG Number of specific fragments= 1 total=1118 # 1cpcA.133.134 read from T0129.t2k.frag # found chain 1cpcA in template set T0129 133 :DICQLGYDE 1cpcA 135 :YIKANHGLS Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.30177 Ang D2.OD1 and L6.CD1 other bump:3.04177 Ang D2.OD2 and L6.CD1 Number of specific fragments= 1 total=1119 # 1cpcB.133.137 read from T0129.t2k.frag # found chain 1cpcB in template set T0129 133 :DICQLGYDE 1cpcB 140 :ALAIAGDTN Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.9327 Ang Y8.OH and E10.CG other bump:2.90897 Ang Y8.CE2 and E10.CG other bump:2.43798 Ang Y8.OH and E10.CB other bump:2.2627 Ang Y8.CE2 and E10.CB other bump:2.50644 Ang Y8.CZ and E10.CB other bump:3.00167 Ang Y8.CE2 and E10.CA other bump:3.1648 Ang Y8.CE2 and E10.N Number of specific fragments= 1 total=1120 # 1cpcL.133.137 read from T0129.t2k.frag # found chain 1cpcL in template set T0129 133 :DICQLGYDE 1cpcL 140 :ALAIAGDTN Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.04397 Ang Y8.OH and E10.CG other bump:2.26187 Ang Y8.OH and E10.CB other bump:2.57596 Ang Y8.CZ and E10.CB other bump:2.52103 Ang Y8.CE2 and E10.CB other bump:3.06624 Ang Y8.CE2 and E10.CA other bump:2.86562 Ang Y8.CE2 and E10.N Number of specific fragments= 1 total=1121 # 1cpcL.133.135 read from T0129.t2k.frag # found chain 1cpcL in template set T0129 133 :DICQLGYDE 1cpcL 138 :DAALAIAGD Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1122 # 1cpcB.133.135 read from T0129.t2k.frag # found chain 1cpcB in template set T0129 133 :DICQLGYDE 1cpcB 138 :DAALAIAGD Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1123 # 1qrjB.134.138 read from T0129.t2k.frag # found chain 1qrjB in template set T0129 134 :ICQLGYDED 1qrjB 154 :ALDNGLPEG Fragment has 14 clashes (null) has 14 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.23978 Ang D8.OD1 and D10.OD1 other bump:2.71841 Ang D8.CB and D10.OD1 other bump:1.97804 Ang D8.CG and D10.OD1 other bump:2.22485 Ang D8.OD2 and D10.OD1 other bump:3.02674 Ang C3.SG and Y7.CZ other bump:2.75419 Ang C3.CA and Y7.CE2 other bump:2.72152 Ang C3.CB and Y7.CE2 other bump:2.04682 Ang C3.SG and Y7.CE2 other bump:2.70112 Ang C3.CA and Y7.CD2 other bump:2.73175 Ang C3.CB and Y7.CD2 other bump:1.78539 Ang C3.SG and Y7.CD2 other bump:2.38066 Ang C3.O and Y7.CD2 other bump:2.64103 Ang C3.C and Y7.CD2 other bump:2.68511 Ang C3.SG and Y7.CG Number of specific fragments= 1 total=1124 # 1cpcA.134.135 read from T0129.t2k.frag # found chain 1cpcA in template set T0129 134 :ICQLGYDED 1cpcA 136 :IKANHGLSG Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.4345 Ang D10.CB and G11.N self-bump: 2.2129 Ang D10.CB and D10.C self-bump: 1.26512 Ang D10.CA and D10.CB Number of specific fragments= 1 total=1125 # 1cpcL.134.138 read from T0129.t2k.frag # found chain 1cpcL in template set T0129 134 :ICQLGYDED 1cpcL 141 :LAIAGDTNG Fragment has 11 clashes (null) has 11 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.91371 Ang Y7.OH and E9.OE2 other bump:1.76978 Ang Y7.OH and E9.OE1 other bump:2.52996 Ang Y7.CZ and E9.CD other bump:1.17148 Ang Y7.OH and E9.CD other bump:1.59712 Ang Y7.OH and E9.CG other bump:2.93962 Ang Y7.CE2 and E9.CG other bump:2.36576 Ang Y7.CZ and E9.CB other bump:2.16952 Ang Y7.OH and E9.CB other bump:2.16208 Ang Y7.CE2 and E9.CB other bump:3.06624 Ang Y7.CE2 and E9.CA other bump:2.86562 Ang Y7.CE2 and E9.N Number of specific fragments= 1 total=1126 # 1cpcB.134.138 read from T0129.t2k.frag # found chain 1cpcB in template set T0129 134 :ICQLGYDED 1cpcB 141 :LAIAGDTNG Fragment has 16 clashes (null) has 16 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.3389 Ang Y7.OH and E9.OE2 other bump:2.51447 Ang Y7.CZ and E9.OE2 other bump:1.59868 Ang Y7.OH and E9.OE1 other bump:2.96932 Ang Y7.CE2 and E9.OE1 other bump:2.57848 Ang Y7.CZ and E9.OE1 other bump:0.670806 Ang Y7.OH and E9.CD other bump:2.81921 Ang Y7.CE2 and E9.CD other bump:2.00361 Ang Y7.CZ and E9.CD other bump:1.51417 Ang Y7.OH and E9.CG other bump:2.4986 Ang Y7.CE2 and E9.CG other bump:2.43238 Ang Y7.OH and E9.CB other bump:1.90766 Ang Y7.CE2 and E9.CB other bump:2.35261 Ang Y7.CZ and E9.CB other bump:2.97519 Ang Y7.CD2 and E9.CB other bump:3.00167 Ang Y7.CE2 and E9.CA other bump:3.1648 Ang Y7.CE2 and E9.N Number of specific fragments= 1 total=1127 # 1phnA.134.135 read from T0129.t2k.frag # found chain 1phnA in template set T0129 134 :ICQLGYDED 1phnA 136 :IKANHGLSG Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.47831 Ang D10.CB and G11.N self-bump: 2.21133 Ang D10.CB and D10.C self-bump: 1.3079 Ang D10.CA and D10.CB Number of specific fragments= 1 total=1128 # 1ktpA.134.135 read from T0129.t2k.frag # found chain 1ktpA in template set T0129 134 :ICQLGYDED 1ktpA 136 :IKANHGLTG Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.45891 Ang D10.CB and G11.N self-bump: 2.1923 Ang D10.CB and D10.C self-bump: 1.28732 Ang D10.CA and D10.CB Number of specific fragments= 1 total=1129 # 1qrjB.135.139 read from T0129.t2k.frag # found chain 1qrjB in template set T0129 135 :CQLGYDEDD 1qrjB 155 :LDNGLPEGT Fragment has 16 clashes (null) has 16 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.69717 Ang D7.CG and D10.OD2 other bump:2.44689 Ang D7.OD1 and D10.CG other bump:2.71841 Ang D7.CB and D9.OD1 other bump:1.97804 Ang D7.CG and D9.OD1 other bump:2.23977 Ang D7.OD1 and D9.OD1 other bump:2.22484 Ang D7.OD2 and D9.OD1 other bump:3.02674 Ang C2.SG and Y6.CZ other bump:2.04682 Ang C2.SG and Y6.CE2 other bump:2.75419 Ang C2.CA and Y6.CE2 other bump:2.72152 Ang C2.CB and Y6.CE2 other bump:1.78539 Ang C2.SG and Y6.CD2 other bump:2.70112 Ang C2.CA and Y6.CD2 other bump:2.73174 Ang C2.CB and Y6.CD2 other bump:2.38066 Ang C2.O and Y6.CD2 other bump:2.64103 Ang C2.C and Y6.CD2 other bump:2.68511 Ang C2.SG and Y6.CG Number of specific fragments= 1 total=1130 # 1cpcA.135.136 read from T0129.t2k.frag # found chain 1cpcA in template set T0129 135 :CQLGYDEDD 1cpcA 137 :KANHGLSGD Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.4345 Ang D9.CB and D10.N self-bump: 2.21289 Ang D9.CB and D9.C self-bump: 1.26512 Ang D9.CA and D9.CB Number of specific fragments= 1 total=1131 # 1cpcL.135.139 read from T0129.t2k.frag # found chain 1cpcL in template set T0129 135 :CQLGYDEDD 1cpcL 142 :AIAGDTNGI Fragment has 11 clashes (null) has 11 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.91371 Ang Y6.OH and E8.OE2 other bump:1.76978 Ang Y6.OH and E8.OE1 other bump:2.52996 Ang Y6.CZ and E8.CD other bump:1.17148 Ang Y6.OH and E8.CD other bump:2.93962 Ang Y6.CE2 and E8.CG other bump:1.59712 Ang Y6.OH and E8.CG other bump:2.16208 Ang Y6.CE2 and E8.CB other bump:2.36576 Ang Y6.CZ and E8.CB other bump:2.16952 Ang Y6.OH and E8.CB other bump:3.06624 Ang Y6.CE2 and E8.CA other bump:2.86562 Ang Y6.CE2 and E8.N Number of specific fragments= 1 total=1132 # 1cpcB.135.139 read from T0129.t2k.frag # found chain 1cpcB in template set T0129 135 :CQLGYDEDD 1cpcB 142 :AIAGDTNGI Fragment has 16 clashes (null) has 16 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.51447 Ang Y6.CZ and E8.OE2 other bump:1.3389 Ang Y6.OH and E8.OE2 other bump:2.96932 Ang Y6.CE2 and E8.OE1 other bump:2.57848 Ang Y6.CZ and E8.OE1 other bump:1.59868 Ang Y6.OH and E8.OE1 other bump:2.81921 Ang Y6.CE2 and E8.CD other bump:2.00361 Ang Y6.CZ and E8.CD other bump:0.670806 Ang Y6.OH and E8.CD other bump:2.4986 Ang Y6.CE2 and E8.CG other bump:1.51417 Ang Y6.OH and E8.CG other bump:1.90766 Ang Y6.CE2 and E8.CB other bump:2.35261 Ang Y6.CZ and E8.CB other bump:2.43238 Ang Y6.OH and E8.CB other bump:2.97519 Ang Y6.CD2 and E8.CB other bump:3.00167 Ang Y6.CE2 and E8.CA other bump:3.1648 Ang Y6.CE2 and E8.N Number of specific fragments= 1 total=1133 # 1phnA.135.136 read from T0129.t2k.frag # found chain 1phnA in template set T0129 135 :CQLGYDEDD 1phnA 137 :KANHGLSGQ Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.4783 Ang D9.CB and D10.N self-bump: 2.21132 Ang D9.CB and D9.C self-bump: 1.3079 Ang D9.CA and D9.CB Number of specific fragments= 1 total=1134 # 1ktpA.135.136 read from T0129.t2k.frag # found chain 1ktpA in template set T0129 135 :CQLGYDEDD 1ktpA 137 :KANHGLTGQ Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.45891 Ang D9.CB and D10.N self-bump: 2.19231 Ang D9.CB and D9.C self-bump: 1.28733 Ang D9.CA and D9.CB Number of specific fragments= 1 total=1135 # 1qrjB.136.140 read from T0129.t2k.frag # found chain 1qrjB in template set T0129 136 :QLGYDEDDN 1qrjB 156 :DNGLPEGTP Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.64555 Ang D6.OD1 and D9.CB other bump:2.23977 Ang D6.OD1 and D8.OD1 other bump:2.71841 Ang D6.CB and D8.OD1 other bump:1.97804 Ang D6.CG and D8.OD1 other bump:2.22484 Ang D6.OD2 and D8.OD1 other bump:2.38066 Ang G1.O and Y5.CD2 other bump:2.64103 Ang G1.C and Y5.CD2 Number of specific fragments= 1 total=1136 # 1cpcA.136.137 read from T0129.t2k.frag # found chain 1cpcA in template set T0129 136 :QLGYDEDDN 1cpcA 138 :ANHGLSGDP Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.4345 Ang D8.CB and D9.N self-bump: 2.21289 Ang D8.CB and D8.C self-bump: 1.26512 Ang D8.CA and D8.CB Number of specific fragments= 1 total=1137 # 1cpcL.136.140 read from T0129.t2k.frag # found chain 1cpcL in template set T0129 136 :QLGYDEDDN 1cpcL 143 :IAGDTNGIT Fragment has 11 clashes (null) has 11 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.91371 Ang Y5.OH and E7.OE2 other bump:1.76978 Ang Y5.OH and E7.OE1 other bump:2.52996 Ang Y5.CZ and E7.CD other bump:1.17148 Ang Y5.OH and E7.CD other bump:2.93962 Ang Y5.CE2 and E7.CG other bump:1.59712 Ang Y5.OH and E7.CG other bump:2.16208 Ang Y5.CE2 and E7.CB other bump:2.36576 Ang Y5.CZ and E7.CB other bump:2.16952 Ang Y5.OH and E7.CB other bump:3.06624 Ang Y5.CE2 and E7.CA other bump:2.86562 Ang Y5.CE2 and E7.N Number of specific fragments= 1 total=1138 # 1cpcB.136.140 read from T0129.t2k.frag # found chain 1cpcB in template set T0129 136 :QLGYDEDDN 1cpcB 143 :IAGDTNGIT Fragment has 16 clashes (null) has 16 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.51447 Ang Y5.CZ and E7.OE2 other bump:1.3389 Ang Y5.OH and E7.OE2 other bump:2.96932 Ang Y5.CE2 and E7.OE1 other bump:2.57848 Ang Y5.CZ and E7.OE1 other bump:1.59868 Ang Y5.OH and E7.OE1 other bump:2.81921 Ang Y5.CE2 and E7.CD other bump:2.00361 Ang Y5.CZ and E7.CD other bump:0.670806 Ang Y5.OH and E7.CD other bump:2.4986 Ang Y5.CE2 and E7.CG other bump:1.51417 Ang Y5.OH and E7.CG other bump:1.90766 Ang Y5.CE2 and E7.CB other bump:2.35261 Ang Y5.CZ and E7.CB other bump:2.43238 Ang Y5.OH and E7.CB other bump:2.97519 Ang Y5.CD2 and E7.CB other bump:3.00167 Ang Y5.CE2 and E7.CA other bump:3.1648 Ang Y5.CE2 and E7.N Number of specific fragments= 1 total=1139 # 1phnA.136.137 read from T0129.t2k.frag # found chain 1phnA in template set T0129 136 :QLGYDEDDN 1phnA 138 :ANHGLSGQA Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.4783 Ang D8.CB and D9.N self-bump: 2.21132 Ang D8.CB and D8.C self-bump: 1.3079 Ang D8.CA and D8.CB Number of specific fragments= 1 total=1140 # 1ktpA.136.137 read from T0129.t2k.frag # found chain 1ktpA in template set T0129 136 :QLGYDEDDN 1ktpA 138 :ANHGLTGQA Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.45891 Ang D8.CB and D9.N self-bump: 2.19231 Ang D8.CB and D8.C self-bump: 1.28733 Ang D8.CA and D8.CB Number of specific fragments= 1 total=1141 # 1qrjB.137.141 read from T0129.t2k.frag # found chain 1qrjB in template set T0129 137 :LGYDEDDNE 1qrjB 157 :NGLPEGTPK Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.64555 Ang D5.OD1 and D8.CB other bump:1.97804 Ang D5.CG and D7.OD1 other bump:2.23977 Ang D5.OD1 and D7.OD1 other bump:2.71841 Ang D5.CB and D7.OD1 other bump:2.22484 Ang D5.OD2 and D7.OD1 Number of specific fragments= 1 total=1142 # 1cpcA.137.138 read from T0129.t2k.frag # found chain 1cpcA in template set T0129 137 :LGYDEDDNE 1cpcA 139 :NHGLSGDPA Fragment has 21 clashes (null) has 21 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.02604 Ang D5.CB and E10.OE2 other bump:1.93949 Ang D5.C and E10.OE2 other bump:1.59626 Ang D5.N and E10.OE2 other bump:1.08463 Ang D5.CA and E10.OE2 other bump:2.33098 Ang D5.CG and E10.OE2 other bump:2.11617 Ang D5.CB and E10.OE1 other bump:1.34014 Ang D5.CB and E10.CD other bump:2.49897 Ang D5.O and E10.CD other bump:2.28045 Ang D5.C and E10.CD other bump:2.72053 Ang D5.N and E10.CD other bump:2.16434 Ang D5.CA and E10.CD other bump:2.7648 Ang D5.CG and E10.CD other bump:2.78102 Ang E6.CA and E10.CG other bump:2.32324 Ang D5.CB and E10.CG other bump:2.17859 Ang D5.O and E10.CG other bump:2.07497 Ang D5.C and E10.CG other bump:2.47358 Ang E6.N and E10.CG other bump:2.81732 Ang D5.CA and E10.CG neighbor-bump: 2.4345 Ang D7.CB and D8.N self-bump: 2.21289 Ang D7.CB and D7.C self-bump: 1.26512 Ang D7.CA and D7.CB Number of specific fragments= 1 total=1143 # 1phnA.137.138 read from T0129.t2k.frag # found chain 1phnA in template set T0129 137 :LGYDEDDNE 1phnA 139 :NHGLSGQAA Fragment has 24 clashes (null) has 24 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.46302 Ang E6.N and E10.OE2 other bump:1.70993 Ang D5.C and E10.OE2 other bump:2.15205 Ang D5.N and E10.OE2 other bump:1.08447 Ang D5.CA and E10.OE2 other bump:0.707958 Ang D5.CB and E10.OE2 other bump:2.09344 Ang D5.CG and E10.OE2 other bump:2.06635 Ang D5.CB and E10.OE1 other bump:2.82351 Ang E6.N and E10.CD other bump:2.20982 Ang D5.O and E10.CD other bump:2.01372 Ang D5.C and E10.CD other bump:2.72679 Ang D5.N and E10.CD other bump:2.11251 Ang D5.CA and E10.CD other bump:1.43195 Ang D5.CB and E10.CD other bump:2.90378 Ang D5.CG and E10.CD other bump:2.4528 Ang E6.N and E10.CG other bump:2.74309 Ang E6.CA and E10.CG other bump:3.21425 Ang E6.C and E10.CG other bump:2.14126 Ang D5.O and E10.CG other bump:2.18238 Ang D5.C and E10.CG other bump:3.09714 Ang D5.CA and E10.CG other bump:2.73413 Ang D5.CB and E10.CG neighbor-bump: 2.4783 Ang D7.CB and D8.N self-bump: 2.21132 Ang D7.CB and D7.C self-bump: 1.3079 Ang D7.CA and D7.CB Number of specific fragments= 1 total=1144 # 1cpcL.137.141 read from T0129.t2k.frag # found chain 1cpcL in template set T0129 137 :LGYDEDDNE 1cpcL 144 :AGDTNGITR Fragment has 11 clashes (null) has 11 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.91371 Ang Y4.OH and E6.OE2 other bump:1.76978 Ang Y4.OH and E6.OE1 other bump:2.52996 Ang Y4.CZ and E6.CD other bump:1.17148 Ang Y4.OH and E6.CD other bump:2.93962 Ang Y4.CE2 and E6.CG other bump:1.59712 Ang Y4.OH and E6.CG other bump:2.16208 Ang Y4.CE2 and E6.CB other bump:2.36576 Ang Y4.CZ and E6.CB other bump:2.16952 Ang Y4.OH and E6.CB other bump:3.06624 Ang Y4.CE2 and E6.CA other bump:2.86562 Ang Y4.CE2 and E6.N Number of specific fragments= 1 total=1145 # 1cpcB.137.141 read from T0129.t2k.frag # found chain 1cpcB in template set T0129 137 :LGYDEDDNE 1cpcB 144 :AGDTNGITR Fragment has 16 clashes (null) has 16 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.51447 Ang Y4.CZ and E6.OE2 other bump:1.3389 Ang Y4.OH and E6.OE2 other bump:2.96932 Ang Y4.CE2 and E6.OE1 other bump:2.57848 Ang Y4.CZ and E6.OE1 other bump:1.59868 Ang Y4.OH and E6.OE1 other bump:2.81921 Ang Y4.CE2 and E6.CD other bump:2.00361 Ang Y4.CZ and E6.CD other bump:0.670806 Ang Y4.OH and E6.CD other bump:2.4986 Ang Y4.CE2 and E6.CG other bump:1.51417 Ang Y4.OH and E6.CG other bump:1.90766 Ang Y4.CE2 and E6.CB other bump:2.35261 Ang Y4.CZ and E6.CB other bump:2.43238 Ang Y4.OH and E6.CB other bump:2.97519 Ang Y4.CD2 and E6.CB other bump:3.00167 Ang Y4.CE2 and E6.CA other bump:3.1648 Ang Y4.CE2 and E6.N Number of specific fragments= 1 total=1146 # 1ktpA.137.138 read from T0129.t2k.frag # found chain 1ktpA in template set T0129 137 :LGYDEDDNE 1ktpA 139 :NHGLTGQAA Fragment has 25 clashes (null) has 25 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.48384 Ang E6.N and E10.OE2 other bump:1.04339 Ang D5.CA and E10.OE2 other bump:0.763515 Ang D5.CB and E10.OE2 other bump:2.42066 Ang D5.O and E10.OE2 other bump:1.66746 Ang D5.C and E10.OE2 other bump:2.10621 Ang D5.N and E10.OE2 other bump:2.16298 Ang D5.CG and E10.OE2 other bump:2.20003 Ang D5.CB and E10.OE1 other bump:2.76982 Ang E6.N and E10.CD other bump:2.10013 Ang D5.CA and E10.CD other bump:1.54323 Ang D5.CB and E10.CD other bump:2.06727 Ang D5.O and E10.CD other bump:1.90619 Ang D5.C and E10.CD other bump:2.76496 Ang D5.N and E10.CD other bump:3.02871 Ang D5.CG and E10.CD other bump:2.35054 Ang E6.N and E10.CG other bump:2.65258 Ang E6.CA and E10.CG other bump:3.18397 Ang E6.C and E10.CG other bump:3.07854 Ang D5.CA and E10.CG other bump:2.7964 Ang D5.CB and E10.CG other bump:2.09731 Ang D5.O and E10.CG other bump:2.0992 Ang D5.C and E10.CG neighbor-bump: 2.45891 Ang D7.CB and D8.N self-bump: 2.19231 Ang D7.CB and D7.C self-bump: 1.28733 Ang D7.CA and D7.CB Number of specific fragments= 1 total=1147 # 1qrjB.138.142 read from T0129.t2k.frag # found chain 1qrjB in template set T0129 138 :GYDEDDNEE 1qrjB 158 :GLPEGTPKD Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.64555 Ang D4.OD1 and D7.CB other bump:2.23977 Ang D4.OD1 and D6.OD1 other bump:2.71841 Ang D4.CB and D6.OD1 other bump:1.97804 Ang D4.CG and D6.OD1 other bump:2.22484 Ang D4.OD2 and D6.OD1 Number of specific fragments= 1 total=1148 # 1cpcA.138.139 read from T0129.t2k.frag # found chain 1cpcA in template set T0129 138 :GYDEDDNEE 1cpcA 140 :HGLSGDPAV Fragment has 21 clashes (null) has 21 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.93949 Ang D4.C and E9.OE2 other bump:1.08463 Ang D4.CA and E9.OE2 other bump:1.02604 Ang D4.CB and E9.OE2 other bump:2.33098 Ang D4.CG and E9.OE2 other bump:1.59627 Ang D4.N and E9.OE2 other bump:2.11617 Ang D4.CB and E9.OE1 other bump:2.49898 Ang D4.O and E9.CD other bump:2.28046 Ang D4.C and E9.CD other bump:2.16435 Ang D4.CA and E9.CD other bump:1.34014 Ang D4.CB and E9.CD other bump:2.7648 Ang D4.CG and E9.CD other bump:2.72053 Ang D4.N and E9.CD other bump:2.17859 Ang D4.O and E9.CG other bump:2.07497 Ang D4.C and E9.CG other bump:2.47358 Ang E5.N and E9.CG other bump:2.78102 Ang E5.CA and E9.CG other bump:2.81732 Ang D4.CA and E9.CG other bump:2.32324 Ang D4.CB and E9.CG neighbor-bump: 2.4345 Ang D6.CB and D7.N self-bump: 2.21289 Ang D6.CB and D6.C self-bump: 1.26512 Ang D6.CA and D6.CB Number of specific fragments= 1 total=1149 # 1phnA.138.139 read from T0129.t2k.frag # found chain 1phnA in template set T0129 138 :GYDEDDNEE 1phnA 140 :HGLSGQAAN Fragment has 29 clashes (null) has 29 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.4083 Ang D4.C and E9.OE2 other bump:0.168223 Ang E5.N and E9.OE2 other bump:1.45657 Ang E5.CA and E9.OE2 other bump:2.45442 Ang E5.CB and E9.OE2 other bump:2.34309 Ang E5.C and E9.OE2 other bump:2.32203 Ang D4.O and E9.OE2 other bump:2.47211 Ang D4.CA and E9.OE2 other bump:2.32143 Ang E5.N and E9.OE1 other bump:1.86968 Ang E5.CA and E9.OE1 other bump:1.26535 Ang E5.O and E9.OE1 other bump:1.11403 Ang E5.C and E9.OE1 other bump:2.03448 Ang D6.N and E9.OE1 other bump:1.98332 Ang D4.C and E9.CD other bump:1.36666 Ang E5.N and E9.CD other bump:1.55919 Ang E5.CA and E9.CD other bump:2.11104 Ang E5.O and E9.CD other bump:1.91472 Ang E5.C and E9.CD other bump:2.48096 Ang D4.O and E9.CD other bump:3.09963 Ang D4.CA and E9.CD other bump:2.14578 Ang D4.C and E9.CG other bump:2.4471 Ang E5.N and E9.CG other bump:2.77708 Ang E5.CA and E9.CG other bump:3.26275 Ang E5.C and E9.CG other bump:2.11661 Ang D4.O and E9.CG other bump:3.03516 Ang D4.CA and E9.CG other bump:2.66272 Ang D4.CB and E9.CG neighbor-bump: 2.4783 Ang D6.CB and D7.N self-bump: 2.21132 Ang D6.CB and D6.C self-bump: 1.3079 Ang D6.CA and D6.CB Number of specific fragments= 1 total=1150 # 1cpcL.138.142 read from T0129.t2k.frag # found chain 1cpcL in template set T0129 138 :GYDEDDNEE 1cpcL 145 :GDTNGITRG Fragment has 11 clashes (null) has 11 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.91371 Ang Y3.OH and E5.OE2 other bump:1.76978 Ang Y3.OH and E5.OE1 other bump:2.52996 Ang Y3.CZ and E5.CD other bump:1.17148 Ang Y3.OH and E5.CD other bump:2.93962 Ang Y3.CE2 and E5.CG other bump:1.59712 Ang Y3.OH and E5.CG other bump:2.16208 Ang Y3.CE2 and E5.CB other bump:2.36576 Ang Y3.CZ and E5.CB other bump:2.16952 Ang Y3.OH and E5.CB other bump:3.06624 Ang Y3.CE2 and E5.CA other bump:2.86562 Ang Y3.CE2 and E5.N Number of specific fragments= 1 total=1151 # 1cpcB.138.142 read from T0129.t2k.frag # found chain 1cpcB in template set T0129 138 :GYDEDDNEE 1cpcB 145 :GDTNGITRG Fragment has 17 clashes (null) has 17 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.39462 Ang E10.CG and G11.N other bump:2.51447 Ang Y3.CZ and E5.OE2 other bump:1.3389 Ang Y3.OH and E5.OE2 other bump:2.96932 Ang Y3.CE2 and E5.OE1 other bump:2.57848 Ang Y3.CZ and E5.OE1 other bump:1.59868 Ang Y3.OH and E5.OE1 other bump:2.81921 Ang Y3.CE2 and E5.CD other bump:2.00361 Ang Y3.CZ and E5.CD other bump:0.670806 Ang Y3.OH and E5.CD other bump:2.4986 Ang Y3.CE2 and E5.CG other bump:1.51417 Ang Y3.OH and E5.CG other bump:1.90766 Ang Y3.CE2 and E5.CB other bump:2.35261 Ang Y3.CZ and E5.CB other bump:2.43238 Ang Y3.OH and E5.CB other bump:2.97519 Ang Y3.CD2 and E5.CB other bump:3.00167 Ang Y3.CE2 and E5.CA other bump:3.1648 Ang Y3.CE2 and E5.N Number of specific fragments= 1 total=1152 # 1ktpA.138.139 read from T0129.t2k.frag # found chain 1ktpA in template set T0129 138 :GYDEDDNEE 1ktpA 140 :HGLTGQAAV Fragment has 33 clashes (null) has 33 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.29906 Ang D7.N and E10.OE1 other bump:1.99539 Ang D7.CA and E10.OE1 other bump:1.67291 Ang D6.O and E10.OE1 other bump:2.15157 Ang D6.C and E10.OE1 other bump:2.58983 Ang D7.C and E10.OE1 other bump:3.11644 Ang D7.CA and E10.CD other bump:2.32859 Ang D6.O and E10.CD other bump:2.90262 Ang D6.C and E10.CD other bump:2.48386 Ang E5.N and E9.OE2 other bump:1.0434 Ang D4.CA and E9.OE2 other bump:0.763497 Ang D4.CB and E9.OE2 other bump:2.42068 Ang D4.O and E9.OE2 other bump:1.66748 Ang D4.C and E9.OE2 other bump:2.10622 Ang D4.N and E9.OE2 other bump:2.16296 Ang D4.CG and E9.OE2 other bump:2.20002 Ang D4.CB and E9.OE1 other bump:2.76982 Ang E5.N and E9.CD other bump:2.10012 Ang D4.CA and E9.CD other bump:1.54321 Ang D4.CB and E9.CD other bump:2.06727 Ang D4.O and E9.CD other bump:1.90619 Ang D4.C and E9.CD other bump:2.76495 Ang D4.N and E9.CD other bump:3.02869 Ang D4.CG and E9.CD other bump:2.35054 Ang E5.N and E9.CG other bump:2.65259 Ang E5.CA and E9.CG other bump:3.18398 Ang E5.C and E9.CG other bump:3.07853 Ang D4.CA and E9.CG other bump:2.79639 Ang D4.CB and E9.CG other bump:2.0973 Ang D4.O and E9.CG other bump:2.0992 Ang D4.C and E9.CG neighbor-bump: 2.45891 Ang D6.CB and D7.N self-bump: 2.19231 Ang D6.CB and D6.C self-bump: 1.28733 Ang D6.CA and D6.CB Number of specific fragments= 1 total=1153 # 1qrjB.139.143 read from T0129.t2k.frag # found chain 1qrjB in template set T0129 139 :YDEDDNEEE 1qrjB 159 :LPEGTPKDP Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.64555 Ang D3.OD1 and D6.CB other bump:1.97804 Ang D3.CG and D5.OD1 other bump:2.23977 Ang D3.OD1 and D5.OD1 other bump:2.7184 Ang D3.CB and D5.OD1 other bump:2.22484 Ang D3.OD2 and D5.OD1 Number of specific fragments= 1 total=1154 # 1cpcA.139.140 read from T0129.t2k.frag # found chain 1cpcA in template set T0129 139 :YDEDDNEEE 1cpcA 143 :GLSGDPAVE Fragment has 26 clashes (null) has 26 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.73173 Ang D6.CA and E9.OE1 other bump:1.56186 Ang D5.O and E9.OE1 other bump:2.19014 Ang D5.C and E9.OE1 other bump:2.44235 Ang D5.O and E9.CD other bump:3.13792 Ang D5.C and E9.CD other bump:1.93949 Ang D3.C and E8.OE2 other bump:1.08463 Ang D3.CA and E8.OE2 other bump:1.02604 Ang D3.CB and E8.OE2 other bump:2.33098 Ang D3.CG and E8.OE2 other bump:1.59627 Ang D3.N and E8.OE2 other bump:2.11617 Ang D3.CB and E8.OE1 other bump:2.49898 Ang D3.O and E8.CD other bump:2.28046 Ang D3.C and E8.CD other bump:2.16435 Ang D3.CA and E8.CD other bump:1.34014 Ang D3.CB and E8.CD other bump:2.7648 Ang D3.CG and E8.CD other bump:2.72053 Ang D3.N and E8.CD other bump:2.17859 Ang D3.O and E8.CG other bump:2.07497 Ang D3.C and E8.CG other bump:2.47358 Ang E4.N and E8.CG other bump:2.78102 Ang E4.CA and E8.CG other bump:2.81732 Ang D3.CA and E8.CG other bump:2.32324 Ang D3.CB and E8.CG neighbor-bump: 2.4345 Ang D5.CB and D6.N self-bump: 2.21289 Ang D5.CB and D5.C self-bump: 1.26512 Ang D5.CA and D5.CB Number of specific fragments= 1 total=1155 # 1cpcL.139.143 read from T0129.t2k.frag # found chain 1cpcL in template set T0129 139 :YDEDDNEEE 1cpcL 146 :DTNGITRGD Fragment has 11 clashes (null) has 11 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.91372 Ang Y2.OH and E4.OE2 other bump:1.76977 Ang Y2.OH and E4.OE1 other bump:2.52997 Ang Y2.CZ and E4.CD other bump:1.17148 Ang Y2.OH and E4.CD other bump:2.93963 Ang Y2.CE2 and E4.CG other bump:1.59713 Ang Y2.OH and E4.CG other bump:2.16209 Ang Y2.CE2 and E4.CB other bump:2.36577 Ang Y2.CZ and E4.CB other bump:2.16952 Ang Y2.OH and E4.CB other bump:3.06625 Ang Y2.CE2 and E4.CA other bump:2.86563 Ang Y2.CE2 and E4.N Number of specific fragments= 1 total=1156 # 1cpcB.139.143 read from T0129.t2k.frag # found chain 1cpcB in template set T0129 139 :YDEDDNEEE 1cpcB 146 :DTNGITRGD Fragment has 12 clashes (null) has 12 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.53434 Ang E8.O and E9.CG other bump:2.65626 Ang Y2.CZ and E4.OE2 other bump:1.51901 Ang Y2.OH and E4.OE2 other bump:2.88707 Ang Y2.CE2 and E4.OE1 other bump:2.06448 Ang Y2.OH and E4.OE1 other bump:2.68011 Ang Y2.CE2 and E4.CD other bump:2.40817 Ang Y2.CZ and E4.CD other bump:1.59356 Ang Y2.OH and E4.CD other bump:2.53118 Ang Y2.CE2 and E4.CG other bump:2.63119 Ang Y2.OH and E4.CG other bump:2.21419 Ang Y2.CE2 and E4.CB other bump:2.95679 Ang Y2.CD2 and E4.CB Number of specific fragments= 1 total=1157 # 1phnA.139.140 read from T0129.t2k.frag # found chain 1phnA in template set T0129 139 :YDEDDNEEE 1phnA 143 :GLSGQAANE Fragment has 29 clashes (null) has 29 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.45442 Ang E4.CB and E8.OE2 other bump:1.4083 Ang D3.C and E8.OE2 other bump:0.168223 Ang E4.N and E8.OE2 other bump:1.45657 Ang E4.CA and E8.OE2 other bump:2.34309 Ang E4.C and E8.OE2 other bump:2.32203 Ang D3.O and E8.OE2 other bump:2.47211 Ang D3.CA and E8.OE2 other bump:2.32143 Ang E4.N and E8.OE1 other bump:1.86968 Ang E4.CA and E8.OE1 other bump:1.26535 Ang E4.O and E8.OE1 other bump:1.11403 Ang E4.C and E8.OE1 other bump:2.03448 Ang D5.N and E8.OE1 other bump:1.98332 Ang D3.C and E8.CD other bump:1.36666 Ang E4.N and E8.CD other bump:1.55919 Ang E4.CA and E8.CD other bump:2.11104 Ang E4.O and E8.CD other bump:1.91472 Ang E4.C and E8.CD other bump:2.48096 Ang D3.O and E8.CD other bump:3.09963 Ang D3.CA and E8.CD other bump:2.14578 Ang D3.C and E8.CG other bump:2.4471 Ang E4.N and E8.CG other bump:2.77708 Ang E4.CA and E8.CG other bump:3.26275 Ang E4.C and E8.CG other bump:2.11661 Ang D3.O and E8.CG other bump:3.03516 Ang D3.CA and E8.CG other bump:2.66272 Ang D3.CB and E8.CG neighbor-bump: 2.4783 Ang D5.CB and D6.N self-bump: 2.21132 Ang D5.CB and D5.C self-bump: 1.3079 Ang D5.CA and D5.CB Number of specific fragments= 1 total=1158 # 1ktpA.139.140 read from T0129.t2k.frag # found chain 1ktpA in template set T0129 139 :YDEDDNEEE 1ktpA 143 :GLTGQAAVE Fragment has 33 clashes (null) has 33 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.29907 Ang D6.N and E9.OE1 other bump:1.9954 Ang D6.CA and E9.OE1 other bump:2.15158 Ang D5.C and E9.OE1 other bump:1.67291 Ang D5.O and E9.OE1 other bump:2.58984 Ang D6.C and E9.OE1 other bump:3.11644 Ang D6.CA and E9.CD other bump:2.90261 Ang D5.C and E9.CD other bump:2.32858 Ang D5.O and E9.CD other bump:2.48386 Ang E4.N and E8.OE2 other bump:1.0434 Ang D3.CA and E8.OE2 other bump:0.763497 Ang D3.CB and E8.OE2 other bump:2.42068 Ang D3.O and E8.OE2 other bump:1.66748 Ang D3.C and E8.OE2 other bump:2.10622 Ang D3.N and E8.OE2 other bump:2.16296 Ang D3.CG and E8.OE2 other bump:2.20002 Ang D3.CB and E8.OE1 other bump:2.76982 Ang E4.N and E8.CD other bump:2.10012 Ang D3.CA and E8.CD other bump:1.54321 Ang D3.CB and E8.CD other bump:2.06727 Ang D3.O and E8.CD other bump:1.90619 Ang D3.C and E8.CD other bump:2.76495 Ang D3.N and E8.CD other bump:3.02869 Ang D3.CG and E8.CD other bump:2.35054 Ang E4.N and E8.CG other bump:2.65259 Ang E4.CA and E8.CG other bump:3.18398 Ang E4.C and E8.CG other bump:3.07853 Ang D3.CA and E8.CG other bump:2.79639 Ang D3.CB and E8.CG other bump:2.0973 Ang D3.O and E8.CG other bump:2.0992 Ang D3.C and E8.CG neighbor-bump: 2.45891 Ang D5.CB and D6.N self-bump: 2.19231 Ang D5.CB and D5.C self-bump: 1.28733 Ang D5.CA and D5.CB Number of specific fragments= 1 total=1159 # 1qrjB.140.144 read from T0129.t2k.frag # found chain 1qrjB in template set T0129 140 :DEDDNEEEL 1qrjB 160 :PEGTPKDPI Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.58751 Ang D2.OD2 and D5.CB other bump:2.6574 Ang D2.CB and D4.OD1 other bump:2.19274 Ang D2.CG and D4.OD1 Number of specific fragments= 1 total=1160 # 1cpcA.140.141 read from T0129.t2k.frag # found chain 1cpcA in template set T0129 140 :DEDDNEEEL 1cpcA 144 :LSGDPAVEA Fragment has 27 clashes (null) has 27 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.8886 Ang D2.OD2 and L10.CD1 other bump:2.73173 Ang D5.CA and E8.OE1 other bump:1.56186 Ang D4.O and E8.OE1 other bump:2.19014 Ang D4.C and E8.OE1 other bump:2.44235 Ang D4.O and E8.CD other bump:3.13792 Ang D4.C and E8.CD other bump:1.93949 Ang D2.C and E7.OE2 other bump:1.59627 Ang D2.N and E7.OE2 other bump:1.08463 Ang D2.CA and E7.OE2 other bump:1.05733 Ang D2.CB and E7.OE2 other bump:2.15531 Ang D2.CG and E7.OE2 other bump:2.19697 Ang D2.CB and E7.OE1 other bump:2.49898 Ang D2.O and E7.CD other bump:2.28046 Ang D2.C and E7.CD other bump:2.72053 Ang D2.N and E7.CD other bump:2.16435 Ang D2.CA and E7.CD other bump:1.43832 Ang D2.CB and E7.CD other bump:2.68714 Ang D2.CG and E7.CD other bump:2.17859 Ang D2.O and E7.CG other bump:2.07497 Ang D2.C and E7.CG other bump:2.47358 Ang E3.N and E7.CG other bump:2.78102 Ang E3.CA and E7.CG other bump:2.81732 Ang D2.CA and E7.CG other bump:2.41241 Ang D2.CB and E7.CG neighbor-bump: 2.4345 Ang D4.CB and D5.N self-bump: 2.2129 Ang D4.CB and D4.C self-bump: 1.26512 Ang D4.CA and D4.CB Number of specific fragments= 1 total=1161 # 1cpcL.140.144 read from T0129.t2k.frag # found chain 1cpcL in template set T0129 140 :DEDDNEEEL 1cpcL 147 :TNGITRGDC Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1162 # 1cpcB.140.144 read from T0129.t2k.frag # found chain 1cpcB in template set T0129 140 :DEDDNEEEL 1cpcB 147 :TNGITRGDC Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.53434 Ang E7.O and E8.CG Number of specific fragments= 1 total=1163 # 1phnA.140.141 read from T0129.t2k.frag # found chain 1phnA in template set T0129 140 :DEDDNEEEL 1phnA 144 :LSGQAANEA Fragment has 30 clashes (null) has 30 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.85306 Ang D2.OD2 and L10.CD1 other bump:1.4083 Ang D2.C and E7.OE2 other bump:0.168223 Ang E3.N and E7.OE2 other bump:1.45657 Ang E3.CA and E7.OE2 other bump:2.45443 Ang E3.CB and E7.OE2 other bump:2.34309 Ang E3.C and E7.OE2 other bump:2.32203 Ang D2.O and E7.OE2 other bump:2.47211 Ang D2.CA and E7.OE2 other bump:2.32143 Ang E3.N and E7.OE1 other bump:1.86968 Ang E3.CA and E7.OE1 other bump:1.26535 Ang E3.O and E7.OE1 other bump:1.11403 Ang E3.C and E7.OE1 other bump:2.03448 Ang D4.N and E7.OE1 other bump:1.98332 Ang D2.C and E7.CD other bump:1.36666 Ang E3.N and E7.CD other bump:1.55919 Ang E3.CA and E7.CD other bump:2.11104 Ang E3.O and E7.CD other bump:1.91472 Ang E3.C and E7.CD other bump:2.48096 Ang D2.O and E7.CD other bump:3.09963 Ang D2.CA and E7.CD other bump:2.14578 Ang D2.C and E7.CG other bump:2.4471 Ang E3.N and E7.CG other bump:2.77708 Ang E3.CA and E7.CG other bump:3.26275 Ang E3.C and E7.CG other bump:2.11661 Ang D2.O and E7.CG other bump:3.03516 Ang D2.CA and E7.CG other bump:2.7517 Ang D2.CB and E7.CG neighbor-bump: 2.4783 Ang D4.CB and D5.N self-bump: 2.21132 Ang D4.CB and D4.C self-bump: 1.3079 Ang D4.CA and D4.CB Number of specific fragments= 1 total=1164 # 1ktpA.140.141 read from T0129.t2k.frag # found chain 1ktpA in template set T0129 140 :DEDDNEEEL 1ktpA 144 :LTGQAAVEA Fragment has 34 clashes (null) has 34 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.7202 Ang D2.OD2 and L10.CD1 other bump:2.29907 Ang D5.N and E8.OE1 other bump:1.9954 Ang D5.CA and E8.OE1 other bump:2.58984 Ang D5.C and E8.OE1 other bump:1.67291 Ang D4.O and E8.OE1 other bump:2.15158 Ang D4.C and E8.OE1 other bump:3.11644 Ang D5.CA and E8.CD other bump:2.32858 Ang D4.O and E8.CD other bump:2.90261 Ang D4.C and E8.CD other bump:1.66748 Ang D2.C and E7.OE2 other bump:2.48386 Ang E3.N and E7.OE2 other bump:2.42068 Ang D2.O and E7.OE2 other bump:2.10622 Ang D2.N and E7.OE2 other bump:1.0434 Ang D2.CA and E7.OE2 other bump:0.799743 Ang D2.CB and E7.OE2 other bump:2.2353 Ang D2.CG and E7.OE2 other bump:2.29257 Ang D2.CB and E7.OE1 other bump:1.90619 Ang D2.C and E7.CD other bump:2.76982 Ang E3.N and E7.CD other bump:2.06727 Ang D2.O and E7.CD other bump:2.76495 Ang D2.N and E7.CD other bump:2.10012 Ang D2.CA and E7.CD other bump:1.63886 Ang D2.CB and E7.CD other bump:3.03893 Ang D2.CG and E7.CD other bump:2.0992 Ang D2.C and E7.CG other bump:2.35054 Ang E3.N and E7.CG other bump:2.65259 Ang E3.CA and E7.CG other bump:3.18398 Ang E3.C and E7.CG other bump:2.0973 Ang D2.O and E7.CG other bump:3.07853 Ang D2.CA and E7.CG other bump:2.88071 Ang D2.CB and E7.CG neighbor-bump: 2.45891 Ang D4.CB and D5.N self-bump: 2.1923 Ang D4.CB and D4.C self-bump: 1.28732 Ang D4.CA and D4.CB Number of specific fragments= 1 total=1165 # 1qrjB.141.145 read from T0129.t2k.frag # found chain 1qrjB in template set T0129 141 :EDDNEEELA 1qrjB 161 :EGTPKDPIL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1166 # 1cpcA.141.142 read from T0129.t2k.frag # found chain 1cpcA in template set T0129 141 :EDDNEEELA 1cpcA 145 :SGDPAVEAN Fragment has 15 clashes (null) has 15 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.73173 Ang D4.CA and E7.OE1 other bump:1.56186 Ang D3.O and E7.OE1 other bump:2.19014 Ang D3.C and E7.OE1 other bump:2.44235 Ang D3.O and E7.CD other bump:3.13792 Ang D3.C and E7.CD other bump:1.93949 Ang G1.C and E6.OE2 other bump:2.49898 Ang G1.O and E6.CD other bump:2.28046 Ang G1.C and E6.CD other bump:2.17859 Ang G1.O and E6.CG other bump:2.07497 Ang G1.C and E6.CG other bump:2.47358 Ang E2.N and E6.CG other bump:2.78102 Ang E2.CA and E6.CG neighbor-bump: 2.4345 Ang D3.CB and D4.N self-bump: 2.2129 Ang D3.CB and D3.C self-bump: 1.26512 Ang D3.CA and D3.CB Number of specific fragments= 1 total=1167 # 1cpcL.141.145 read from T0129.t2k.frag # found chain 1cpcL in template set T0129 141 :EDDNEEELA 1cpcL 148 :NGITRGDCA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1168 # 1cpcB.141.145 read from T0129.t2k.frag # found chain 1cpcB in template set T0129 141 :EDDNEEELA 1cpcB 148 :NGITRGDCA Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.53434 Ang E6.O and E7.CG Number of specific fragments= 1 total=1169 # 1phnB.141.145 read from T0129.t2k.frag # found chain 1phnB in template set T0129 141 :EDDNEEELA 1phnB 148 :SGITTGDCS Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1170 # 1phnA.141.142 read from T0129.t2k.frag # found chain 1phnA in template set T0129 141 :EDDNEEELA 1phnA 145 :SGQAANEAN Fragment has 25 clashes (null) has 25 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.44334 Ang E2.CB and E6.OE2 other bump:1.45657 Ang E2.CA and E6.OE2 other bump:2.34309 Ang E2.C and E6.OE2 other bump:2.32203 Ang G1.O and E6.OE2 other bump:1.4083 Ang G1.C and E6.OE2 other bump:0.168223 Ang E2.N and E6.OE2 other bump:1.86968 Ang E2.CA and E6.OE1 other bump:1.26535 Ang E2.O and E6.OE1 other bump:1.11403 Ang E2.C and E6.OE1 other bump:2.03448 Ang D3.N and E6.OE1 other bump:2.32143 Ang E2.N and E6.OE1 other bump:1.55919 Ang E2.CA and E6.CD other bump:2.11104 Ang E2.O and E6.CD other bump:1.91472 Ang E2.C and E6.CD other bump:2.48096 Ang G1.O and E6.CD other bump:1.98332 Ang G1.C and E6.CD other bump:1.36666 Ang E2.N and E6.CD other bump:2.77708 Ang E2.CA and E6.CG other bump:3.26275 Ang E2.C and E6.CG other bump:2.11661 Ang G1.O and E6.CG other bump:2.14578 Ang G1.C and E6.CG other bump:2.4471 Ang E2.N and E6.CG neighbor-bump: 2.47831 Ang D3.CB and D4.N self-bump: 2.21133 Ang D3.CB and D3.C self-bump: 1.3079 Ang D3.CA and D3.CB Number of specific fragments= 1 total=1171 # 1qrjB.142.146 read from T0129.t2k.frag # found chain 1qrjB in template set T0129 142 :DDNEEELAE 1qrjB 162 :GTPKDPILR Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1172 # 1cpcL.142.146 read from T0129.t2k.frag # found chain 1cpcL in template set T0129 142 :DDNEEELAE 1cpcL 149 :GITRGDCAS Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1173 # 1cpcB.142.146 read from T0129.t2k.frag # found chain 1cpcB in template set T0129 142 :DDNEEELAE 1cpcB 149 :GITRGDCAS Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.53434 Ang E5.O and E6.CG Number of specific fragments= 1 total=1174 # 1cpcA.142.143 read from T0129.t2k.frag # found chain 1cpcA in template set T0129 142 :DDNEEELAE 1cpcA 146 :GDPAVEANS Fragment has 8 clashes (null) has 8 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.73173 Ang D3.CA and E6.OE1 other bump:2.19014 Ang D2.C and E6.OE1 other bump:1.56186 Ang D2.O and E6.OE1 other bump:3.13792 Ang D2.C and E6.CD other bump:2.44235 Ang D2.O and E6.CD neighbor-bump: 2.4345 Ang D2.CB and D3.N self-bump: 2.2129 Ang D2.CB and D2.C self-bump: 1.26512 Ang D2.CA and D2.CB Number of specific fragments= 1 total=1175 # 1phnB.142.146 read from T0129.t2k.frag # found chain 1phnB in template set T0129 142 :DDNEEELAE 1phnB 149 :GITTGDCSA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1176 # 1ktpB.142.146 read from T0129.t2k.frag # found chain 1ktpB in template set T0129 142 :DDNEEELAE 1ktpB 149 :GITPGDCSA Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.3629 Ang E5.O and E6.CG Number of specific fragments= 1 total=1177 # 1cpcL.143.147 read from T0129.t2k.frag # found chain 1cpcL in template set T0129 143 :DNEEELAEA 1cpcL 150 :ITRGDCASL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1178 # 1cpcB.143.147 read from T0129.t2k.frag # found chain 1cpcB in template set T0129 143 :DNEEELAEA 1cpcB 150 :ITRGDCASL Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.53435 Ang E4.O and E5.CG Number of specific fragments= 1 total=1179 # 1qrjB.143.147 read from T0129.t2k.frag # found chain 1qrjB in template set T0129 143 :DNEEELAEA 1qrjB 163 :TPKDPILRS Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1180 # 1phnB.143.147 read from T0129.t2k.frag # found chain 1phnB in template set T0129 143 :DNEEELAEA 1phnB 150 :ITTGDCSAL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1181 # 1ktpB.143.147 read from T0129.t2k.frag # found chain 1ktpB in template set T0129 143 :DNEEELAEA 1ktpB 150 :ITPGDCSAL Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.3629 Ang E4.O and E5.CG Number of specific fragments= 1 total=1182 # 1cpcA.143.144 read from T0129.t2k.frag # found chain 1cpcA in template set T0129 143 :DNEEELAEA 1cpcA 147 :DPAVEANSY Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.73173 Ang D2.CA and E5.OE1 other bump:1.56186 Ang G1.O and E5.OE1 other bump:2.19014 Ang G1.C and E5.OE1 other bump:2.44235 Ang G1.O and E5.CD other bump:3.13792 Ang G1.C and E5.CD Number of specific fragments= 1 total=1183 # 1cpcB.144.148 read from T0129.t2k.frag # found chain 1cpcB in template set T0129 144 :NEEELAEAL 1cpcB 151 :TRGDCASLM Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.53434 Ang E3.O and E4.CG Number of specific fragments= 1 total=1184 # 1cpcL.144.148 read from T0129.t2k.frag # found chain 1cpcL in template set T0129 144 :NEEELAEAL 1cpcL 151 :TRGDCASLM Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1185 # 1phnB.144.148 read from T0129.t2k.frag # found chain 1phnB in template set T0129 144 :NEEELAEAL 1phnB 151 :TTGDCSALM Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1186 # 1ktpB.144.148 read from T0129.t2k.frag # found chain 1ktpB in template set T0129 144 :NEEELAEAL 1ktpB 151 :TPGDCSALM Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.36289 Ang E3.O and E4.CG Number of specific fragments= 1 total=1187 # 1qrjB.144.148 read from T0129.t2k.frag # found chain 1qrjB in template set T0129 144 :NEEELAEAL 1qrjB 164 :PKDPILRSL Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.63144 Ang N2.CB and E5.OE2 other bump:3.06489 Ang N2.CB and E5.CD Number of specific fragments= 1 total=1188 # 1cpcA.144.145 read from T0129.t2k.frag # found chain 1cpcA in template set T0129 144 :NEEELAEAL 1cpcA 148 :PAVEANSYI Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1189 # 1cpcB.145.149 read from T0129.t2k.frag # found chain 1cpcB in template set T0129 145 :EEELAEALE 1cpcB 152 :RGDCASLMA Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.53435 Ang E2.O and E3.CG Number of specific fragments= 1 total=1190 # 1cpcL.145.149 read from T0129.t2k.frag # found chain 1cpcL in template set T0129 145 :EEELAEALE 1cpcL 152 :RGDCASLMA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1191 # 1ktpB.145.149 read from T0129.t2k.frag # found chain 1ktpB in template set T0129 145 :EEELAEALE 1ktpB 152 :PGDCSALMS Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.3629 Ang E2.O and E3.CG Number of specific fragments= 1 total=1192 # 1phnB.145.149 read from T0129.t2k.frag # found chain 1phnB in template set T0129 145 :EEELAEALE 1phnB 152 :TGDCSALMA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1193 # 1cpcA.145.146 read from T0129.t2k.frag # found chain 1cpcA in template set T0129 145 :EEELAEALE 1cpcA 149 :AVEANSYID Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1194 # 1qrjB.145.149 read from T0129.t2k.frag # found chain 1qrjB in template set T0129 145 :EEELAEALE 1qrjB 165 :KDPILRSLA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1195 # 1cpcB.146.150 read from T0129.t2k.frag # found chain 1cpcB in template set T0129 146 :EELAEALEE 1cpcB 153 :GDCASLMAE Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.53435 Ang G1.O and E2.CG Number of specific fragments= 1 total=1196 # 1cpcL.146.150 read from T0129.t2k.frag # found chain 1cpcL in template set T0129 146 :EELAEALEE 1cpcL 153 :GDCASLMAE Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.40272 Ang G1.O and E2.CG Number of specific fragments= 1 total=1197 # 1ktpB.146.150 read from T0129.t2k.frag # found chain 1ktpB in template set T0129 146 :EELAEALEE 1ktpB 153 :GDCSALMSE Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.42715 Ang E2.OE1 and L4.CD2 Number of specific fragments= 1 total=1198 # 1phnB.146.150 read from T0129.t2k.frag # found chain 1phnB in template set T0129 146 :EELAEALEE 1phnB 153 :GDCSALMAE Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1199 # 1cpcA.146.147 read from T0129.t2k.frag # found chain 1cpcA in template set T0129 146 :EELAEALEE 1cpcA 150 :VEANSYIDY Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1200 # 4xiaA.146.146 read from T0129.t2k.frag # found chain 4xiaA in template set T0129 146 :EELAEALEE 4xiaA 148 :KDLAAALDR Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.63501 Ang E3.OE1 and E6.CD other bump:2.94344 Ang E3.CG and E6.CG other bump:2.46993 Ang E3.CD and E6.CG other bump:2.01178 Ang E3.OE1 and E6.CG Number of specific fragments= 1 total=1201 # 1cpcB.147.151 read from T0129.t2k.frag # found chain 1cpcB in template set T0129 147 :ELAEALEEI 1cpcB 154 :DCASLMAEV Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.6088 Ang E2.OE1 and A4.CB Number of specific fragments= 1 total=1202 # 1cpcL.147.151 read from T0129.t2k.frag # found chain 1cpcL in template set T0129 147 :ELAEALEEI 1cpcL 154 :DCASLMAEV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1203 # 1ktpB.147.151 read from T0129.t2k.frag # found chain 1ktpB in template set T0129 147 :ELAEALEEI 1ktpB 154 :DCSALMSEI Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.61976 Ang E2.OE1 and A4.CB Number of specific fragments= 1 total=1204 # 1phnB.147.151 read from T0129.t2k.frag # found chain 1phnB in template set T0129 147 :ELAEALEEI 1phnB 154 :DCSALMAEV Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.67265 Ang E2.OE1 and A4.CB other bump:2.49981 Ang E2.OE1 and A4.N Number of specific fragments= 1 total=1205 # 1cpcA.147.148 read from T0129.t2k.frag # found chain 1cpcA in template set T0129 147 :ELAEALEEI 1cpcA 161 :EANSYIDYA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1206 # 4xiaA.147.147 read from T0129.t2k.frag # found chain 4xiaA in template set T0129 147 :ELAEALEEI 4xiaA 149 :DLAAALDRM Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.635 Ang E2.OE1 and E5.CD other bump:2.94343 Ang E2.CG and E5.CG other bump:2.46992 Ang E2.CD and E5.CG other bump:2.01176 Ang E2.OE1 and E5.CG Number of specific fragments= 1 total=1207 # 1cpcB.148.152 read from T0129.t2k.frag # found chain 1cpcB in template set T0129 148 :LAEALEEII 1cpcB 155 :CASLMAEVA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1208 # 1cpcL.148.152 read from T0129.t2k.frag # found chain 1cpcL in template set T0129 148 :LAEALEEII 1cpcL 155 :CASLMAEVA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1209 # 1ktpB.148.152 read from T0129.t2k.frag # found chain 1ktpB in template set T0129 148 :LAEALEEII 1ktpB 155 :CSALMSEIA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1210 # 1phnB.148.152 read from T0129.t2k.frag # found chain 1phnB in template set T0129 148 :LAEALEEII 1phnB 155 :CSALMAEVG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1211 # 1cpcA.148.149 read from T0129.t2k.frag # found chain 1cpcA in template set T0129 148 :LAEALEEII 1cpcA 162 :ANSYIDYAI Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1212 # 4xiaA.148.148 read from T0129.t2k.frag # found chain 4xiaA in template set T0129 148 :LAEALEEII 4xiaA 150 :LAAALDRMR Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1213 # 1cpcB.149.153 read from T0129.t2k.frag # found chain 1cpcB in template set T0129 149 :AEALEEIIE 1cpcB 156 :ASLMAEVAS Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1214 # 1cpcL.149.153 read from T0129.t2k.frag # found chain 1cpcL in template set T0129 149 :AEALEEIIE 1cpcL 156 :ASLMAEVAS Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1215 # 1ktpB.149.153 read from T0129.t2k.frag # found chain 1ktpB in template set T0129 149 :AEALEEIIE 1ktpB 156 :SALMSEIAG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1216 # 1phnB.149.153 read from T0129.t2k.frag # found chain 1phnB in template set T0129 149 :AEALEEIIE 1phnB 156 :SALMAEVGT Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1217 # 1cpcA.149.150 read from T0129.t2k.frag # found chain 1cpcA in template set T0129 149 :AEALEEIIE 1cpcA 163 :NSYIDYAIN Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1218 # 4xiaA.149.149 read from T0129.t2k.frag # found chain 4xiaA in template set T0129 149 :AEALEEIIE 4xiaA 151 :AAALDRMRE Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1219 # 1cpcB.150.154 read from T0129.t2k.frag # found chain 1cpcB in template set T0129 150 :EALEEIIEY 1cpcB 157 :SLMAEVASY Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1220 # 1cpcL.150.154 read from T0129.t2k.frag # found chain 1cpcL in template set T0129 150 :EALEEIIEY 1cpcL 157 :SLMAEVASY Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1221 # 1ktpB.150.154 read from T0129.t2k.frag # found chain 1ktpB in template set T0129 150 :EALEEIIEY 1ktpB 157 :ALMSEIAGY Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1222 # 1phnB.150.154 read from T0129.t2k.frag # found chain 1phnB in template set T0129 150 :EALEEIIEY 1phnB 157 :ALMAEVGTY Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1223 # 1cpcA.150.151 read from T0129.t2k.frag # found chain 1cpcA in template set T0129 150 :EALEEIIEY 1cpcA 164 :SYIDYAINA Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.63674 Ang E6.CG and Y10.CE1 other bump:2.16798 Ang E6.O and Y10.CD1 Number of specific fragments= 1 total=1224 # 4xiaA.150.150 read from T0129.t2k.frag # found chain 4xiaA in template set T0129 150 :EALEEIIEY 4xiaA 152 :AALDRMREG Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1225 # 1cpcB.151.155 read from T0129.t2k.frag # found chain 1cpcB in template set T0129 151 :ALEEIIEYV 1cpcB 158 :LMAEVASYF Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1226 # 1cpcL.151.155 read from T0129.t2k.frag # found chain 1cpcL in template set T0129 151 :ALEEIIEYV 1cpcL 158 :LMAEVASYF Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1227 # 1ktpB.151.155 read from T0129.t2k.frag # found chain 1ktpB in template set T0129 151 :ALEEIIEYV 1ktpB 158 :LMSEIAGYF Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1228 # 1phnB.151.155 read from T0129.t2k.frag # found chain 1phnB in template set T0129 151 :ALEEIIEYV 1phnB 158 :LMAEVGTYF Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1229 # 4xiaA.151.151 read from T0129.t2k.frag # found chain 4xiaA in template set T0129 151 :ALEEIIEYV 4xiaA 153 :ALDRMREGV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1230 # 1cpcA.151.152 read from T0129.t2k.frag # found chain 1cpcA in template set T0129 151 :ALEEIIEYV 1cpcA 165 :YIDYAINAL Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.63674 Ang E5.CG and Y9.CE1 other bump:2.16798 Ang E5.O and Y9.CD1 Number of specific fragments= 1 total=1231 # 1cpcB.152.156 read from T0129.t2k.frag # found chain 1cpcB in template set T0129 152 :LEEIIEYVR 1cpcB 159 :MAEVASYFD Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1232 # 1cpcL.152.156 read from T0129.t2k.frag # found chain 1cpcL in template set T0129 152 :LEEIIEYVR 1cpcL 159 :MAEVASYFD Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1233 # 1ktpB.152.156 read from T0129.t2k.frag # found chain 1ktpB in template set T0129 152 :LEEIIEYVR 1ktpB 159 :MSEIAGYFD Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1234 # 1phnB.152.156 read from T0129.t2k.frag # found chain 1phnB in template set T0129 152 :LEEIIEYVR 1phnB 159 :MAEVGTYFD Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.54307 Ang E7.OE2 and R10.NH1 other bump:2.4813 Ang E7.CD and R10.NH1 other bump:2.79145 Ang E7.OE2 and R10.CZ Number of specific fragments= 1 total=1235 # 4xiaA.152.152 read from T0129.t2k.frag # found chain 4xiaA in template set T0129 152 :LEEIIEYVR 4xiaA 154 :LDRMREGVD Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.96303 Ang I6.CG2 and R10.NH1 other bump:2.65521 Ang I6.CG2 and R10.CZ other bump:2.84839 Ang I6.CG2 and R10.NE Number of specific fragments= 1 total=1236 # 1cpcA.152.153 read from T0129.t2k.frag # found chain 1cpcA in template set T0129 152 :LEEIIEYV 1cpcA 166 :IDYAINAL Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 10 residues other bump:2.63674 Ang E4.CG and Y8.CE1 other bump:2.16798 Ang E4.O and Y8.CD1 Number of specific fragments= 1 total=1237 # 1cpcB.153.157 read from T0129.t2k.frag # found chain 1cpcB in template set T0129 153 :EEIIEYVRT 1cpcB 160 :AEVASYFDK Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.84928 Ang I5.CG2 and R9.NH2 other bump:1.8351 Ang I5.CG2 and R9.NH1 other bump:2.42079 Ang I5.CG2 and R9.CZ Number of specific fragments= 1 total=1238 # 1cpcL.153.157 read from T0129.t2k.frag # found chain 1cpcL in template set T0129 153 :EEIIEYVRT 1cpcL 160 :AEVASYFDK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1239 # 1ktpB.153.157 read from T0129.t2k.frag # found chain 1ktpB in template set T0129 153 :EEIIEYVRT 1ktpB 160 :SEIAGYFDR Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1240 # 1phnB.153.157 read from T0129.t2k.frag # found chain 1phnB in template set T0129 153 :EEIIEYVRT 1phnB 160 :AEVGTYFDR Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1241 # 4xiaA.153.153 read from T0129.t2k.frag # found chain 4xiaA in template set T0129 153 :EEIIEYVRT 4xiaA 155 :DRMREGVDT Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.77472 Ang I5.CG2 and R9.NH2 other bump:1.68727 Ang I5.CG2 and R9.NH1 other bump:1.59632 Ang I5.CG2 and R9.CZ other bump:2.64478 Ang I5.CG2 and R9.NE Number of specific fragments= 1 total=1242 # 1cbg.153.153 read from T0129.t2k.frag # found chain 1cbg in template set T0129 153 :EEIIEYVRT 1cbg 154 :RNIVDDFRD Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1243 # 1cpcB.154.158 read from T0129.t2k.frag # found chain 1cpcB in template set T0129 154 :EIIEYVRTI 1cpcB 161 :EVASYFDKA Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.84928 Ang I4.CG2 and R8.NH2 other bump:1.8351 Ang I4.CG2 and R8.NH1 other bump:2.42079 Ang I4.CG2 and R8.CZ Number of specific fragments= 1 total=1244 # 1cpcL.154.158 read from T0129.t2k.frag # found chain 1cpcL in template set T0129 154 :EIIEYVRTI 1cpcL 161 :EVASYFDKA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1245 # 1ktpB.154.158 read from T0129.t2k.frag # found chain 1ktpB in template set T0129 154 :EIIEYVRTI 1ktpB 161 :EIAGYFDRA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1246 # 1phnB.154.158 read from T0129.t2k.frag # found chain 1phnB in template set T0129 154 :EIIEYVRTI 1phnB 161 :EVGTYFDRA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1247 # 1cbg.154.154 read from T0129.t2k.frag # found chain 1cbg in template set T0129 154 :EIIEYVRTI 1cbg 155 :NIVDDFRDY Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1248 # 4xiaA.154.154 read from T0129.t2k.frag # found chain 4xiaA in template set T0129 154 :EIIEYVRTI 4xiaA 156 :RMREGVDTA Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.77473 Ang I4.CG2 and R8.NH2 other bump:1.68728 Ang I4.CG2 and R8.NH1 other bump:1.59634 Ang I4.CG2 and R8.CZ other bump:2.64479 Ang I4.CG2 and R8.NE Number of specific fragments= 1 total=1249 # 1cpcB.155.159 read from T0129.t2k.frag # found chain 1cpcB in template set T0129 155 :IIEYVRTIA 1cpcB 162 :VASYFDKAA Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.84929 Ang I3.CG2 and R7.NH2 other bump:1.83511 Ang I3.CG2 and R7.NH1 other bump:2.42079 Ang I3.CG2 and R7.CZ Number of specific fragments= 1 total=1250 # 1cpcL.155.159 read from T0129.t2k.frag # found chain 1cpcL in template set T0129 155 :IIEYVRTIA 1cpcL 162 :VASYFDKAA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1251 # 1ktpB.155.159 read from T0129.t2k.frag # found chain 1ktpB in template set T0129 155 :IIEYVRTIA 1ktpB 162 :IAGYFDRAA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1252 # 1phnB.155.159 read from T0129.t2k.frag # found chain 1phnB in template set T0129 155 :IIEYVRTIA 1phnB 162 :VGTYFDRAA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1253 # 1cbg.155.155 read from T0129.t2k.frag # found chain 1cbg in template set T0129 155 :IIEYVRTIA 1cbg 156 :IVDDFRDYA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1254 # 4xiaA.155.155 read from T0129.t2k.frag # found chain 4xiaA in template set T0129 155 :IIEYVRTIA 4xiaA 157 :MREGVDTAA Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.52366 Ang Y5.CE2 and I9.CD1 other bump:2.64496 Ang Y5.CZ and I9.CD1 other bump:1.77472 Ang I3.CG2 and R7.NH2 other bump:1.68727 Ang I3.CG2 and R7.NH1 other bump:1.59633 Ang I3.CG2 and R7.CZ other bump:2.64478 Ang I3.CG2 and R7.NE Number of specific fragments= 1 total=1255 # 1cpcB.156.160 read from T0129.t2k.frag # found chain 1cpcB in template set T0129 156 :IEYVRTIAM 1cpcB 163 :ASYFDKAAS Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.84929 Ang I2.CG2 and R6.NH2 other bump:1.8351 Ang I2.CG2 and R6.NH1 other bump:2.42079 Ang I2.CG2 and R6.CZ Number of specific fragments= 1 total=1256 # 1cpcL.156.160 read from T0129.t2k.frag # found chain 1cpcL in template set T0129 156 :IEYVRTIAM 1cpcL 163 :ASYFDKAAA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1257 # 1ktpB.156.160 read from T0129.t2k.frag # found chain 1ktpB in template set T0129 156 :IEYVRTIAM 1ktpB 163 :AGYFDRAAA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1258 # 1phnB.156.160 read from T0129.t2k.frag # found chain 1phnB in template set T0129 156 :IEYVRTIAM 1phnB 163 :GTYFDRAAT Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.94056 Ang I2.CG2 and R6.NH1 Number of specific fragments= 1 total=1259 # 1cbg.156.156 read from T0129.t2k.frag # found chain 1cbg in template set T0129 156 :IEYVRTIAM 1cbg 157 :VDDFRDYAE Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1260 # 4xiaA.156.156 read from T0129.t2k.frag # found chain 4xiaA in template set T0129 156 :IEYVRTIAM 4xiaA 158 :REGVDTAAG Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.52366 Ang Y4.CE2 and I8.CD1 other bump:2.64496 Ang Y4.CZ and I8.CD1 other bump:1.77474 Ang I2.CG2 and R6.NH2 other bump:1.68727 Ang I2.CG2 and R6.NH1 other bump:1.59634 Ang I2.CG2 and R6.CZ other bump:2.64479 Ang I2.CG2 and R6.NE Number of specific fragments= 1 total=1261 # 1cpcL.157.161 read from T0129.t2k.frag # found chain 1cpcL in template set T0129 157 :EYVRTIAML 1cpcL 164 :SYFDKAAAA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1262 # 1cpcB.157.161 read from T0129.t2k.frag # found chain 1cpcB in template set T0129 157 :EYVRTIAML 1cpcB 164 :SYFDKAASA Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.31967 Ang T6.O and L10.CG Number of specific fragments= 1 total=1263 # 1ktpB.157.161 read from T0129.t2k.frag # found chain 1ktpB in template set T0129 157 :EYVRTIAML 1ktpB 164 :GYFDRAAAA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1264 # 1phnB.157.161 read from T0129.t2k.frag # found chain 1phnB in template set T0129 157 :EYVRTIAML 1phnB 164 :TYFDRAATA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1265 # 1cbg.157.157 read from T0129.t2k.frag # found chain 1cbg in template set T0129 157 :EYVRTIAML 1cbg 158 :DDFRDYAEL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1266 # 4xiaA.157.157 read from T0129.t2k.frag # found chain 4xiaA in template set T0129 157 :EYVRTIAML 4xiaA 159 :EGVDTAAGY Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.52366 Ang Y3.CE2 and I7.CD1 other bump:2.64496 Ang Y3.CZ and I7.CD1 Number of specific fragments= 1 total=1267 # 1cpcL.158.162 read from T0129.t2k.frag # found chain 1cpcL in template set T0129 158 :YVRTIAMLF 1cpcL 165 :YFDKAAAAV Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.58313 Ang T5.O and L9.CD1 other bump:2.28396 Ang T5.O and L9.CG Number of specific fragments= 1 total=1268 # 1cpcB.158.162 read from T0129.t2k.frag # found chain 1cpcB in template set T0129 158 :YVRTIAMLF 1cpcB 165 :YFDKAASAV Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.31967 Ang T5.O and L9.CG Number of specific fragments= 1 total=1269 # 1ktpB.158.162 read from T0129.t2k.frag # found chain 1ktpB in template set T0129 158 :YVRTIAMLF 1ktpB 165 :YFDRAAAAV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1270 # 1phnB.158.162 read from T0129.t2k.frag # found chain 1phnB in template set T0129 158 :YVRTIAMLF 1phnB 165 :YFDRAATAV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1271 # 1cbg.158.158 read from T0129.t2k.frag # found chain 1cbg in template set T0129 158 :YVRTIAMLF 1cbg 159 :DFRDYAELC Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1272 # 4xiaA.158.158 read from T0129.t2k.frag # found chain 4xiaA in template set T0129 158 :YVRTIAMLF 4xiaA 160 :GVDTAAGYI Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.51316 Ang Y2.CE2 and I6.CD1 other bump:2.792 Ang Y2.CZ and I6.CD1 Number of specific fragments= 1 total=1273 # 1cbg.159.159 read from T0129.t2k.frag # found chain 1cbg in template set T0129 159 :VRTIAMLFY 1cbg 160 :FRDYAELCF Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1274 # 1cpcB.159.163 read from T0129.t2k.frag # found chain 1cpcB in template set T0129 159 :VRTIAMLF 1cpcB 166 :FDKAASAV Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 10 residues other bump:2.31967 Ang T4.O and L8.CG Number of specific fragments= 1 total=1275 # 1ktpB.159.163 read from T0129.t2k.frag # found chain 1ktpB in template set T0129 159 :VRTIAMLF 1ktpB 166 :FDRAAAAV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 10 residues Number of specific fragments= 1 total=1276 # 1phnB.159.163 read from T0129.t2k.frag # found chain 1phnB in template set T0129 159 :VRTIAMLF 1phnB 166 :FDRAATAV Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 10 residues Number of specific fragments= 1 total=1277 # 1cpcL.159.163 read from T0129.t2k.frag # found chain 1cpcL in template set T0129 159 :VRTIAMLF 1cpcL 166 :FDKAAAAV Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 10 residues other bump:2.58313 Ang T4.O and L8.CD1 other bump:2.28396 Ang T4.O and L8.CG Number of specific fragments= 1 total=1278 # 4xiaA.159.159 read from T0129.t2k.frag # found chain 4xiaA in template set T0129 159 :VRTIAMLFY 4xiaA 161 :VDTAAGYIK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1279 # 1cbg.160.160 read from T0129.t2k.frag # found chain 1cbg in template set T0129 160 :RTIAMLFYS 1cbg 161 :RDYAELCFK Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1280 # 1atiA.160.161 read from T0129.t2k.frag # found chain 1atiA in template set T0129 160 :RTIAMLFYS 1atiA 162 :PRYFNMMFQ Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1281 # 4xiaA.160.160 read from T0129.t2k.frag # found chain 4xiaA in template set T0129 160 :RTIAMLFYS 4xiaA 162 :DTAAGYIKD Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1282 # 1atiB.160.161 read from T0129.t2k.frag # found chain 1atiB in template set T0129 160 :RTIAMLFYS 1atiB 162 :PRYFNMMFQ Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1283 # 1jj2L.160.163 read from T0129.t2k.frag # found chain 1jj2L in template set T0129 160 :RTIAMLFYS 1jj2L 164 :TSAGRRCRG Fragment has 31 clashes (null) has 31 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 1.32089 Ang Y9.O and S10.OG neighbor-bump: 2.22397 Ang Y9.C and S10.OG neighbor-bump: 2.29533 Ang Y9.O and S10.CB neighbor-bump: 2.56496 Ang Y9.C and S10.CB other bump:1.6317 Ang M6.CE and Y9.OH other bump:3.2276 Ang M6.SD and Y9.OH other bump:2.01125 Ang M6.CE and Y9.CZ other bump:3.15134 Ang M6.SD and Y9.CZ other bump:2.05713 Ang M6.CA and Y9.CE2 other bump:2.41528 Ang M6.CB and Y9.CE2 other bump:2.89794 Ang M6.CG and Y9.CE2 other bump:2.31421 Ang M6.CE and Y9.CE2 other bump:2.57295 Ang M6.O and Y9.CE2 other bump:2.54329 Ang M6.SD and Y9.CE2 other bump:2.69658 Ang M6.C and Y9.CE2 other bump:2.26233 Ang M6.CA and Y9.CD2 other bump:2.41736 Ang M6.O and Y9.CD2 other bump:2.64387 Ang M6.C and Y9.CD2 other bump:2.13319 Ang I4.CG2 and F8.CZ other bump:2.33531 Ang I4.O and F8.CE2 other bump:2.65058 Ang I4.C and F8.CE2 other bump:2.49484 Ang I4.CA and F8.CE2 other bump:2.35674 Ang I4.CB and F8.CE2 other bump:1.49349 Ang I4.CG2 and F8.CE2 other bump:1.42216 Ang I4.O and F8.CD2 other bump:2.29978 Ang I4.C and F8.CD2 other bump:2.92983 Ang I4.CA and F8.CD2 other bump:2.48887 Ang I4.CG2 and F8.CD2 other bump:2.49535 Ang I4.O and F8.CG self-bump: 2.20154 Ang T3.CA and T3.OG1 self-bump: 1.35679 Ang T3.CA and T3.CB Number of specific fragments= 1 total=1284 # 2sas.160.162 read from T0129.t2k.frag # found chain 2sas in template set T0129 160 :RTIAMLFYS 2sas 163 :ELYYRLLTS Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1285 # 1cbg.161.161 read from T0129.t2k.frag # found chain 1cbg in template set T0129 161 :TIAMLFYSH 1cbg 162 :DYAELCFKE Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.90481 Ang L6.CD1 and H10.NE2 other bump:2.22059 Ang L6.O and H10.CD2 other bump:3.03803 Ang L6.C and H10.CD2 other bump:2.89321 Ang L6.CG and H10.CD2 other bump:2.60068 Ang L6.CD1 and H10.CD2 Number of specific fragments= 1 total=1286 # 1atiA.161.162 read from T0129.t2k.frag # found chain 1atiA in template set T0129 161 :TIAMLFYSH 1atiA 163 :RYFNMMFQD Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1287 # 1atiB.161.162 read from T0129.t2k.frag # found chain 1atiB in template set T0129 161 :TIAMLFYSH 1atiB 163 :RYFNMMFQD Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1288 # 1jj2L.161.164 read from T0129.t2k.frag # found chain 1jj2L in template set T0129 161 :TIAMLFYSH 1jj2L 165 :SAGRRCRGL Fragment has 54 clashes (null) has 54 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.17268 Ang Y8.CE1 and H10.NE2 other bump:2.15368 Ang Y8.CD1 and H10.NE2 other bump:1.85484 Ang Y8.CE1 and H10.CE1 other bump:2.94387 Ang Y8.CZ and H10.CE1 other bump:2.03799 Ang Y8.CG and H10.CE1 other bump:1.08781 Ang Y8.CD1 and H10.CE1 other bump:2.84173 Ang Y8.CB and H10.CE1 other bump:0.947589 Ang Y8.CE1 and H10.ND1 other bump:2.58935 Ang Y8.CE2 and H10.ND1 other bump:2.03754 Ang Y8.CZ and H10.ND1 other bump:1.68083 Ang Y8.CG and H10.ND1 other bump:0.480374 Ang Y8.CD1 and H10.ND1 other bump:2.44209 Ang Y8.CD2 and H10.ND1 other bump:2.93614 Ang Y8.CB and H10.ND1 other bump:1.73901 Ang Y8.CE1 and H10.CD2 other bump:2.87219 Ang Y8.CZ and H10.CD2 other bump:2.45734 Ang Y8.CD1 and H10.CD2 other bump:0.79691 Ang Y8.CE1 and H10.CG other bump:2.65215 Ang Y8.OH and H10.CG other bump:3.02679 Ang Y8.CG and H10.CG other bump:1.81553 Ang Y8.CD1 and H10.CG other bump:1.94666 Ang Y8.CE1 and H10.CB other bump:2.26244 Ang Y8.CZ and H10.CB other bump:2.44664 Ang Y8.OH and H10.CB other bump:2.9767 Ang Y8.CD1 and H10.CB neighbor-bump: 1.32088 Ang Y8.O and S9.OG neighbor-bump: 2.22397 Ang Y8.C and S9.OG neighbor-bump: 2.29532 Ang Y8.O and S9.CB neighbor-bump: 2.56496 Ang Y8.C and S9.CB other bump:1.6317 Ang M5.CE and Y8.OH other bump:3.2276 Ang M5.SD and Y8.OH other bump:2.01125 Ang M5.CE and Y8.CZ other bump:3.15134 Ang M5.SD and Y8.CZ other bump:2.31421 Ang M5.CE and Y8.CE2 other bump:2.54329 Ang M5.SD and Y8.CE2 other bump:2.05713 Ang M5.CA and Y8.CE2 other bump:2.41528 Ang M5.CB and Y8.CE2 other bump:2.57295 Ang M5.O and Y8.CE2 other bump:2.69658 Ang M5.C and Y8.CE2 other bump:2.89794 Ang M5.CG and Y8.CE2 other bump:2.26233 Ang M5.CA and Y8.CD2 other bump:2.41736 Ang M5.O and Y8.CD2 other bump:2.64387 Ang M5.C and Y8.CD2 other bump:2.1332 Ang I3.CG2 and F7.CZ other bump:2.49484 Ang I3.CA and F7.CE2 other bump:2.33531 Ang I3.O and F7.CE2 other bump:2.65058 Ang I3.C and F7.CE2 other bump:2.35674 Ang I3.CB and F7.CE2 other bump:1.49349 Ang I3.CG2 and F7.CE2 other bump:2.92983 Ang I3.CA and F7.CD2 other bump:1.42216 Ang I3.O and F7.CD2 other bump:2.29978 Ang I3.C and F7.CD2 other bump:2.48887 Ang I3.CG2 and F7.CD2 other bump:2.49535 Ang I3.O and F7.CG Number of specific fragments= 1 total=1289 # 4xiaA.161.161 read from T0129.t2k.frag # found chain 4xiaA in template set T0129 161 :TIAMLFYSH 4xiaA 163 :TAAGYIKDK Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.74035 Ang L6.CD1 and H10.NE2 other bump:2.94302 Ang L6.CD1 and H10.CD2 Number of specific fragments= 1 total=1290 # 2sas.161.163 read from T0129.t2k.frag # found chain 2sas in template set T0129 161 :TIAMLFYSH 2sas 164 :LYYRLLTSP Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1291 # 1cbg.162.162 read from T0129.t2k.frag # found chain 1cbg in template set T0129 162 :IAMLFYSHF 1cbg 163 :YAELCFKEF Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:3.03867 Ang L5.CD1 and H9.NE2 Number of specific fragments= 1 total=1292 # 1atiA.162.163 read from T0129.t2k.frag # found chain 1atiA in template set T0129 162 :IAMLFYSHF 1atiA 164 :YFNMMFQDL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1293 # 1atiB.162.163 read from T0129.t2k.frag # found chain 1atiB in template set T0129 162 :IAMLFYSHF 1atiB 164 :YFNMMFQDL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1294 # 1jj2L.162.165 read from T0129.t2k.frag # found chain 1jj2L in template set T0129 162 :IAMLFYSHF 1jj2L 166 :AGRRCRGLR Fragment has 76 clashes (null) has 76 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.33112 Ang L5.CD2 and F10.CZ other bump:3.22556 Ang L5.CA and F10.CZ other bump:1.395 Ang L5.CG and F10.CZ other bump:1.65405 Ang L5.CD1 and F10.CZ other bump:2.12105 Ang L5.CB and F10.CZ other bump:2.12127 Ang L5.CD2 and F10.CE2 other bump:2.71531 Ang L5.CG and F10.CE2 other bump:2.80853 Ang L5.CD1 and F10.CE2 other bump:3.02653 Ang L5.CB and F10.CE2 other bump:0.387418 Ang L5.CD2 and F10.CE1 other bump:2.85019 Ang L5.CA and F10.CE1 other bump:1.19822 Ang L5.CG and F10.CE1 other bump:2.30376 Ang L5.CD1 and F10.CE1 other bump:2.27342 Ang L5.CB and F10.CE1 other bump:2.38986 Ang L5.CD2 and F10.CD2 other bump:1.1785 Ang L5.CD2 and F10.CD1 other bump:2.5822 Ang L5.CG and F10.CD1 other bump:2.06248 Ang L5.CD2 and F10.CG other bump:2.14918 Ang Y7.CE1 and H9.NE2 other bump:1.97552 Ang Y7.CD1 and H9.NE2 other bump:2.25132 Ang Y7.CE1 and H9.CE1 other bump:2.81767 Ang Y7.CD1 and H9.CE1 other bump:3.26406 Ang M4.CE and H9.ND1 other bump:1.57175 Ang Y7.CE1 and H9.ND1 other bump:2.28671 Ang Y7.CZ and H9.ND1 other bump:2.48207 Ang Y7.OH and H9.ND1 other bump:2.71583 Ang Y7.CD1 and H9.ND1 other bump:1.31357 Ang Y7.CE1 and H9.CD2 other bump:2.63321 Ang Y7.CZ and H9.CD2 other bump:2.1951 Ang Y7.CG and H9.CD2 other bump:0.820667 Ang Y7.CD1 and H9.CD2 other bump:0.609299 Ang Y7.CE1 and H9.CG other bump:2.93849 Ang Y7.CE2 and H9.CG other bump:1.81411 Ang Y7.CZ and H9.CG other bump:2.57874 Ang Y7.OH and H9.CG other bump:2.87697 Ang Y7.CG and H9.CG other bump:1.69163 Ang Y7.CD1 and H9.CG other bump:1.71614 Ang Y7.CE1 and H9.CB other bump:2.86743 Ang Y7.CE2 and H9.CB other bump:1.91501 Ang Y7.CZ and H9.CB other bump:2.37889 Ang Y7.OH and H9.CB other bump:2.6223 Ang Y7.CD1 and H9.CB neighbor-bump: 1.32088 Ang Y7.O and S8.OG neighbor-bump: 2.22397 Ang Y7.C and S8.OG neighbor-bump: 2.29532 Ang Y7.O and S8.CB neighbor-bump: 2.56496 Ang Y7.C and S8.CB other bump:1.6317 Ang M4.CE and Y7.OH other bump:3.2276 Ang M4.SD and Y7.OH other bump:2.01125 Ang M4.CE and Y7.CZ other bump:3.15134 Ang M4.SD and Y7.CZ other bump:2.31421 Ang M4.CE and Y7.CE2 other bump:2.89794 Ang M4.CG and Y7.CE2 other bump:2.54329 Ang M4.SD and Y7.CE2 other bump:2.05713 Ang M4.CA and Y7.CE2 other bump:2.41528 Ang M4.CB and Y7.CE2 other bump:2.57295 Ang M4.O and Y7.CE2 other bump:2.69658 Ang M4.C and Y7.CE2 other bump:2.26233 Ang M4.CA and Y7.CD2 other bump:2.41736 Ang M4.O and Y7.CD2 other bump:2.64387 Ang M4.C and Y7.CD2 other bump:1.75553 Ang I2.CD1 and F6.CZ other bump:1.52935 Ang I2.CG1 and F6.CZ other bump:2.00243 Ang I2.CD1 and F6.CE2 other bump:2.49484 Ang I2.CA and F6.CE2 other bump:2.14363 Ang I2.CB and F6.CE2 other bump:1.10454 Ang I2.CG1 and F6.CE2 other bump:3.0064 Ang I2.CG2 and F6.CE2 other bump:2.33531 Ang I2.O and F6.CE2 other bump:2.65058 Ang I2.C and F6.CE2 other bump:2.8753 Ang I2.CG1 and F6.CE1 other bump:2.92983 Ang I2.CA and F6.CD2 other bump:3.07928 Ang I2.CB and F6.CD2 other bump:2.45615 Ang I2.CG1 and F6.CD2 other bump:1.42216 Ang I2.O and F6.CD2 other bump:2.29978 Ang I2.C and F6.CD2 other bump:2.49535 Ang I2.O and F6.CG Number of specific fragments= 1 total=1295 # 2sas.162.164 read from T0129.t2k.frag # found chain 2sas in template set T0129 162 :IAMLFYSHF 2sas 165 :YYRLLTSPA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1296 # 1jj2L.162.164 read from T0129.t2k.frag # found chain 1jj2L in template set T0129 162 :IAMLFYSHF 1jj2L 165 :SAGRRCRGL Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.53997 Ang S8.OG and F10.CE1 other bump:2.13571 Ang S8.OG and F10.CD1 other bump:2.56627 Ang A3.O and Y7.CD1 Number of specific fragments= 1 total=1297 # 1cbg.163.163 read from T0129.t2k.frag # found chain 1cbg in template set T0129 163 :AMLFYSHFN 1cbg 164 :AELCFKEFG Fragment has 14 clashes (null) has 14 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.42172 Ang Y6.CA and N10.OD1 other bump:2.88924 Ang Y6.CD1 and N10.OD1 other bump:1.50258 Ang Y6.CA and N10.ND2 other bump:2.23201 Ang Y6.CB and N10.ND2 other bump:1.17683 Ang Y6.O and N10.ND2 other bump:1.18894 Ang Y6.C and N10.ND2 other bump:2.46525 Ang S7.N and N10.ND2 other bump:2.23199 Ang Y6.CA and N10.CG other bump:3.10521 Ang Y6.CB and N10.CG other bump:1.77546 Ang Y6.O and N10.CG other bump:2.30571 Ang Y6.C and N10.CG other bump:2.15673 Ang Y6.O and N10.CB other bump:3.23265 Ang Y6.C and N10.CB other bump:3.03867 Ang L4.CD1 and H8.NE2 Number of specific fragments= 1 total=1298 # 1atiA.163.164 read from T0129.t2k.frag # found chain 1atiA in template set T0129 163 :AMLFYSHFN 1atiA 165 :FNMMFQDLR Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1299 # 1atiB.163.164 read from T0129.t2k.frag # found chain 1atiB in template set T0129 163 :AMLFYSHFN 1atiB 165 :FNMMFQDLR Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1300 # 1jj2L.163.166 read from T0129.t2k.frag # found chain 1jj2L in template set T0129 163 :AMLFYSHFN 1jj2L 167 :GRRCRGLRG Fragment has 65 clashes (null) has 65 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.29512 Ang L4.CD2 and F9.CZ other bump:3.03216 Ang L4.CA and F9.CZ other bump:1.93296 Ang L4.CB and F9.CZ other bump:1.26237 Ang L4.CG and F9.CZ other bump:1.66973 Ang L4.CD1 and F9.CZ other bump:0.813887 Ang L4.CD2 and F9.CE2 other bump:2.98966 Ang L4.CB and F9.CE2 other bump:1.75029 Ang L4.CG and F9.CE2 other bump:2.2117 Ang L4.CD1 and F9.CE2 other bump:1.98852 Ang L4.CD2 and F9.CE1 other bump:2.79667 Ang L4.CA and F9.CE1 other bump:2.08017 Ang L4.CB and F9.CE1 other bump:2.32341 Ang L4.CG and F9.CE1 other bump:2.94384 Ang L4.CD1 and F9.CE1 other bump:1.39641 Ang L4.CD2 and F9.CD2 other bump:2.8914 Ang L4.CG and F9.CD2 other bump:2.28712 Ang L4.CD2 and F9.CD1 other bump:2.07434 Ang L4.CD2 and F9.CG other bump:2.14918 Ang Y6.CE1 and H8.NE2 other bump:1.97552 Ang Y6.CD1 and H8.NE2 other bump:2.25132 Ang Y6.CE1 and H8.CE1 other bump:2.81767 Ang Y6.CD1 and H8.CE1 other bump:1.57175 Ang Y6.CE1 and H8.ND1 other bump:2.28671 Ang Y6.CZ and H8.ND1 other bump:2.48207 Ang Y6.OH and H8.ND1 other bump:2.71583 Ang Y6.CD1 and H8.ND1 other bump:3.26406 Ang M3.CE and H8.ND1 other bump:1.31357 Ang Y6.CE1 and H8.CD2 other bump:2.63321 Ang Y6.CZ and H8.CD2 other bump:2.1951 Ang Y6.CG and H8.CD2 other bump:0.820667 Ang Y6.CD1 and H8.CD2 other bump:0.609299 Ang Y6.CE1 and H8.CG other bump:2.93849 Ang Y6.CE2 and H8.CG other bump:1.81411 Ang Y6.CZ and H8.CG other bump:2.57874 Ang Y6.OH and H8.CG other bump:2.87697 Ang Y6.CG and H8.CG other bump:1.69163 Ang Y6.CD1 and H8.CG other bump:1.71614 Ang Y6.CE1 and H8.CB other bump:2.86743 Ang Y6.CE2 and H8.CB other bump:1.91501 Ang Y6.CZ and H8.CB other bump:2.37889 Ang Y6.OH and H8.CB other bump:2.6223 Ang Y6.CD1 and H8.CB neighbor-bump: 1.32088 Ang Y6.O and S7.OG neighbor-bump: 2.22397 Ang Y6.C and S7.OG neighbor-bump: 2.29532 Ang Y6.O and S7.CB neighbor-bump: 2.56496 Ang Y6.C and S7.CB other bump:3.2276 Ang M3.SD and Y6.OH other bump:1.6317 Ang M3.CE and Y6.OH other bump:3.15134 Ang M3.SD and Y6.CZ other bump:2.01125 Ang M3.CE and Y6.CZ other bump:2.54329 Ang M3.SD and Y6.CE2 other bump:2.31421 Ang M3.CE and Y6.CE2 other bump:2.41528 Ang M3.CB and Y6.CE2 other bump:2.57295 Ang M3.O and Y6.CE2 other bump:2.69658 Ang M3.C and Y6.CE2 other bump:2.05713 Ang M3.CA and Y6.CE2 other bump:2.89794 Ang M3.CG and Y6.CE2 other bump:2.41736 Ang M3.O and Y6.CD2 other bump:2.64387 Ang M3.C and Y6.CD2 other bump:2.26233 Ang M3.CA and Y6.CD2 other bump:2.33531 Ang G1.O and F5.CE2 other bump:2.65058 Ang G1.C and F5.CE2 other bump:1.42216 Ang G1.O and F5.CD2 other bump:2.29978 Ang G1.C and F5.CD2 other bump:2.49535 Ang G1.O and F5.CG Number of specific fragments= 1 total=1301 # 2sas.163.165 read from T0129.t2k.frag # found chain 2sas in template set T0129 163 :AMLFYSHFN 2sas 166 :YRLLTSPAA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1302 # 1jj2L.163.165 read from T0129.t2k.frag # found chain 1jj2L in template set T0129 163 :AMLFYSHFN 1jj2L 166 :AGRRCRGLR Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.97579 Ang F5.CD2 and N10.OD1 other bump:2.65574 Ang F5.CE2 and N10.OD1 other bump:2.36724 Ang S7.OG and F9.CD1 other bump:2.56627 Ang A2.O and Y6.CD1 Number of specific fragments= 1 total=1303 # 1cbg.164.164 read from T0129.t2k.frag # found chain 1cbg in template set T0129 164 :MLFYSHFNE 1cbg 165 :ELCFKEFGD Fragment has 14 clashes (null) has 14 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.42173 Ang Y5.CA and N9.OD1 other bump:2.88925 Ang Y5.CD1 and N9.OD1 other bump:1.50257 Ang Y5.CA and N9.ND2 other bump:2.23201 Ang Y5.CB and N9.ND2 other bump:1.17685 Ang Y5.O and N9.ND2 other bump:1.18895 Ang Y5.C and N9.ND2 other bump:2.46527 Ang S6.N and N9.ND2 other bump:2.23199 Ang Y5.CA and N9.CG other bump:3.10521 Ang Y5.CB and N9.CG other bump:1.77548 Ang Y5.O and N9.CG other bump:2.30573 Ang Y5.C and N9.CG other bump:2.15673 Ang Y5.O and N9.CB other bump:3.23265 Ang Y5.C and N9.CB other bump:3.03867 Ang L3.CD1 and H7.NE2 Number of specific fragments= 1 total=1304 # 1atiA.164.165 read from T0129.t2k.frag # found chain 1atiA in template set T0129 164 :MLFYSHFNE 1atiA 166 :NMMFQDLRG Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues self-bump: 1.3575 Ang E10.CA and E10.CB Number of specific fragments= 1 total=1305 # 1atiB.164.165 read from T0129.t2k.frag # found chain 1atiB in template set T0129 164 :MLFYSHFNE 1atiB 166 :NMMFQDLRG Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues self-bump: 1.3422 Ang E10.CA and E10.CB Number of specific fragments= 1 total=1306 # 1jj2L.164.166 read from T0129.t2k.frag # found chain 1jj2L in template set T0129 164 :MLFYSHFNE 1jj2L 167 :GRRCRGLRG Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.97579 Ang F4.CD2 and N9.OD1 other bump:2.65574 Ang F4.CE2 and N9.OD1 other bump:2.36724 Ang S6.OG and F8.CD1 other bump:2.56627 Ang G1.O and Y5.CD1 Number of specific fragments= 1 total=1307 # 2sas.164.166 read from T0129.t2k.frag # found chain 2sas in template set T0129 164 :MLFYSHFNE 2sas 167 :RLLTSPAAD Fragment has 10 clashes (null) has 10 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.80543 Ang M2.CG and E10.OE2 other bump:2.3797 Ang M2.CE and E10.OE2 other bump:2.19071 Ang S6.OG and E10.OE2 other bump:2.53325 Ang M2.CA and E10.OE2 other bump:1.99974 Ang M2.CB and E10.OE2 other bump:1.58344 Ang M2.CE and E10.OE1 other bump:2.24817 Ang M2.CE and E10.CD other bump:2.6002 Ang S6.OG and E10.CD other bump:2.82701 Ang M2.CB and E10.CD other bump:2.68659 Ang M2.CE and S6.OG Number of specific fragments= 1 total=1308 # 1jj2L.164.167 read from T0129.t2k.frag # found chain 1jj2L in template set T0129 164 :MLFYSHFNE 1jj2L 168 :RRCRGLRGQ Fragment has 62 clashes (null) has 62 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:3.05871 Ang N9.CG and G11.N other bump:2.14133 Ang N9.OD1 and G11.N other bump:3.03216 Ang L3.CA and F8.CZ other bump:1.26237 Ang L3.CG and F8.CZ other bump:1.29513 Ang L3.CD2 and F8.CZ other bump:1.93296 Ang L3.CB and F8.CZ other bump:1.66973 Ang L3.CD1 and F8.CZ other bump:1.75029 Ang L3.CG and F8.CE2 other bump:0.813884 Ang L3.CD2 and F8.CE2 other bump:2.98966 Ang L3.CB and F8.CE2 other bump:2.2117 Ang L3.CD1 and F8.CE2 other bump:2.79667 Ang L3.CA and F8.CE1 other bump:2.32341 Ang L3.CG and F8.CE1 other bump:1.98852 Ang L3.CD2 and F8.CE1 other bump:2.08017 Ang L3.CB and F8.CE1 other bump:2.94384 Ang L3.CD1 and F8.CE1 other bump:2.8914 Ang L3.CG and F8.CD2 other bump:1.39641 Ang L3.CD2 and F8.CD2 other bump:2.28712 Ang L3.CD2 and F8.CD1 other bump:2.07433 Ang L3.CD2 and F8.CG other bump:2.14918 Ang Y5.CE1 and H7.NE2 other bump:1.97552 Ang Y5.CD1 and H7.NE2 other bump:2.25132 Ang Y5.CE1 and H7.CE1 other bump:2.81767 Ang Y5.CD1 and H7.CE1 other bump:3.26405 Ang M2.CE and H7.ND1 other bump:1.57175 Ang Y5.CE1 and H7.ND1 other bump:2.28671 Ang Y5.CZ and H7.ND1 other bump:2.48207 Ang Y5.OH and H7.ND1 other bump:2.71583 Ang Y5.CD1 and H7.ND1 other bump:1.31357 Ang Y5.CE1 and H7.CD2 other bump:2.63321 Ang Y5.CZ and H7.CD2 other bump:2.1951 Ang Y5.CG and H7.CD2 other bump:0.820667 Ang Y5.CD1 and H7.CD2 other bump:0.609299 Ang Y5.CE1 and H7.CG other bump:2.93849 Ang Y5.CE2 and H7.CG other bump:1.81411 Ang Y5.CZ and H7.CG other bump:2.57874 Ang Y5.OH and H7.CG other bump:2.87697 Ang Y5.CG and H7.CG other bump:1.69163 Ang Y5.CD1 and H7.CG other bump:1.71614 Ang Y5.CE1 and H7.CB other bump:2.86743 Ang Y5.CE2 and H7.CB other bump:1.91501 Ang Y5.CZ and H7.CB other bump:2.37889 Ang Y5.OH and H7.CB other bump:2.6223 Ang Y5.CD1 and H7.CB neighbor-bump: 1.32088 Ang Y5.O and S6.OG neighbor-bump: 2.22397 Ang Y5.C and S6.OG neighbor-bump: 2.29532 Ang Y5.O and S6.CB neighbor-bump: 2.56496 Ang Y5.C and S6.CB other bump:3.22759 Ang M2.SD and Y5.OH other bump:1.63169 Ang M2.CE and Y5.OH other bump:3.15133 Ang M2.SD and Y5.CZ other bump:2.01124 Ang M2.CE and Y5.CZ other bump:2.41527 Ang M2.CB and Y5.CE2 other bump:2.89793 Ang M2.CG and Y5.CE2 other bump:2.54328 Ang M2.SD and Y5.CE2 other bump:2.31421 Ang M2.CE and Y5.CE2 other bump:2.05713 Ang M2.CA and Y5.CE2 other bump:2.57295 Ang M2.O and Y5.CE2 other bump:2.69658 Ang M2.C and Y5.CE2 other bump:2.26233 Ang M2.CA and Y5.CD2 other bump:2.41736 Ang M2.O and Y5.CD2 other bump:2.64387 Ang M2.C and Y5.CD2 Number of specific fragments= 1 total=1309 # 1cbg.165.165 read from T0129.t2k.frag # found chain 1cbg in template set T0129 165 :LFYSHFNEG 1cbg 166 :LCFKEFGDR Fragment has 14 clashes (null) has 14 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.42173 Ang Y4.CA and N8.OD1 other bump:2.88925 Ang Y4.CD1 and N8.OD1 other bump:1.17685 Ang Y4.O and N8.ND2 other bump:1.50257 Ang Y4.CA and N8.ND2 other bump:2.23201 Ang Y4.CB and N8.ND2 other bump:1.18895 Ang Y4.C and N8.ND2 other bump:2.46527 Ang S5.N and N8.ND2 other bump:1.77548 Ang Y4.O and N8.CG other bump:2.23199 Ang Y4.CA and N8.CG other bump:3.10521 Ang Y4.CB and N8.CG other bump:2.30573 Ang Y4.C and N8.CG other bump:2.15673 Ang Y4.O and N8.CB other bump:3.23265 Ang Y4.C and N8.CB other bump:3.03867 Ang L2.CD1 and H6.NE2 Number of specific fragments= 1 total=1310 # 1atiA.165.166 read from T0129.t2k.frag # found chain 1atiA in template set T0129 165 :LFYSHFNEG 1atiA 167 :MMFQDLRGP Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.60019 Ang E9.CG and G10.N self-bump: 1.3546 Ang E9.CA and E9.CB Number of specific fragments= 1 total=1311 # 1atiB.165.166 read from T0129.t2k.frag # found chain 1atiB in template set T0129 165 :LFYSHFNEG 1atiB 167 :MMFQDLRGP Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.53961 Ang E9.CG and G10.N self-bump: 1.34081 Ang E9.CA and E9.CB Number of specific fragments= 1 total=1312 # 1jj2L.165.167 read from T0129.t2k.frag # found chain 1jj2L in template set T0129 165 :LFYSHFNEG 1jj2L 168 :RRCRGLRGQ Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.97579 Ang F3.CD2 and N8.OD1 other bump:2.65574 Ang F3.CE2 and N8.OD1 other bump:2.36724 Ang S5.OG and F7.CD1 Number of specific fragments= 1 total=1313 # 1qrjB.165.169 read from T0129.t2k.frag # found chain 1qrjB in template set T0129 165 :LFYSHFNEG 1qrjB 185 :LQARGHTNS Fragment has 5 clashes (null) has 5 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.65113 Ang E9.C and G10.O other bump:1.66413 Ang F3.CD2 and N8.ND2 other bump:2.03567 Ang F3.CE2 and N8.ND2 other bump:2.72886 Ang F3.CD2 and N8.CG other bump:2.16463 Ang L2.O and S5.OG Number of specific fragments= 1 total=1314 # 1jj2L.165.168 read from T0129.t2k.frag # found chain 1jj2L in template set T0129 165 :LFYSHFNEG 1jj2L 169 :RCRGLRGQG Fragment has 51 clashes (null) has 51 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:3.05871 Ang N8.CG and G10.N other bump:2.14133 Ang N8.OD1 and G10.N other bump:1.26237 Ang L2.CG and F7.CZ other bump:1.29513 Ang L2.CD2 and F7.CZ other bump:3.03216 Ang L2.CA and F7.CZ other bump:1.66973 Ang L2.CD1 and F7.CZ other bump:1.93295 Ang L2.CB and F7.CZ other bump:1.75028 Ang L2.CG and F7.CE2 other bump:0.813879 Ang L2.CD2 and F7.CE2 other bump:2.2117 Ang L2.CD1 and F7.CE2 other bump:2.98966 Ang L2.CB and F7.CE2 other bump:2.32341 Ang L2.CG and F7.CE1 other bump:1.98852 Ang L2.CD2 and F7.CE1 other bump:2.79667 Ang L2.CA and F7.CE1 other bump:2.94384 Ang L2.CD1 and F7.CE1 other bump:2.08017 Ang L2.CB and F7.CE1 other bump:2.8914 Ang L2.CG and F7.CD2 other bump:1.39641 Ang L2.CD2 and F7.CD2 other bump:2.28712 Ang L2.CD2 and F7.CD1 other bump:2.07433 Ang L2.CD2 and F7.CG other bump:2.14918 Ang Y4.CE1 and H6.NE2 other bump:1.97552 Ang Y4.CD1 and H6.NE2 other bump:2.25132 Ang Y4.CE1 and H6.CE1 other bump:2.81767 Ang Y4.CD1 and H6.CE1 other bump:1.57176 Ang Y4.CE1 and H6.ND1 other bump:2.28671 Ang Y4.CZ and H6.ND1 other bump:2.48206 Ang Y4.OH and H6.ND1 other bump:2.71583 Ang Y4.CD1 and H6.ND1 other bump:1.31356 Ang Y4.CE1 and H6.CD2 other bump:2.6332 Ang Y4.CZ and H6.CD2 other bump:2.1951 Ang Y4.CG and H6.CD2 other bump:0.820653 Ang Y4.CD1 and H6.CD2 other bump:0.609295 Ang Y4.CE1 and H6.CG other bump:2.93847 Ang Y4.CE2 and H6.CG other bump:1.8141 Ang Y4.CZ and H6.CG other bump:2.57873 Ang Y4.OH and H6.CG other bump:2.87697 Ang Y4.CG and H6.CG other bump:1.69162 Ang Y4.CD1 and H6.CG other bump:1.71613 Ang Y4.CE1 and H6.CB other bump:2.86742 Ang Y4.CE2 and H6.CB other bump:1.915 Ang Y4.CZ and H6.CB other bump:2.37889 Ang Y4.OH and H6.CB other bump:2.62229 Ang Y4.CD1 and H6.CB neighbor-bump: 1.32089 Ang Y4.O and S5.OG neighbor-bump: 2.22397 Ang Y4.C and S5.OG neighbor-bump: 2.29533 Ang Y4.O and S5.CB neighbor-bump: 2.56496 Ang Y4.C and S5.CB other bump:2.57295 Ang G1.O and Y4.CE2 other bump:2.69659 Ang G1.C and Y4.CE2 other bump:2.41736 Ang G1.O and Y4.CD2 other bump:2.64388 Ang G1.C and Y4.CD2 Number of specific fragments= 1 total=1315 # 1cbg.166.166 read from T0129.t2k.frag # found chain 1cbg in template set T0129 166 :FYSHFNEGE 1cbg 167 :CFKEFGDRV Fragment has 14 clashes (null) has 14 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.42173 Ang Y3.CA and N7.OD1 other bump:2.88925 Ang Y3.CD1 and N7.OD1 other bump:2.46527 Ang S4.N and N7.ND2 other bump:1.17685 Ang Y3.O and N7.ND2 other bump:1.50257 Ang Y3.CA and N7.ND2 other bump:2.23201 Ang Y3.CB and N7.ND2 other bump:1.18895 Ang Y3.C and N7.ND2 other bump:1.77548 Ang Y3.O and N7.CG other bump:2.23199 Ang Y3.CA and N7.CG other bump:3.10521 Ang Y3.CB and N7.CG other bump:2.30573 Ang Y3.C and N7.CG other bump:2.15673 Ang Y3.O and N7.CB other bump:3.23265 Ang Y3.C and N7.CB other bump:2.82265 Ang F2.CD2 and F6.CE2 Number of specific fragments= 1 total=1316 # 1atiA.166.167 read from T0129.t2k.frag # found chain 1atiA in template set T0129 166 :FYSHFNEGE 1atiA 168 :MFQDLRGPR Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.60019 Ang E8.CG and G9.N self-bump: 1.3546 Ang E8.CA and E8.CB Number of specific fragments= 1 total=1317 # 1atiB.166.167 read from T0129.t2k.frag # found chain 1atiB in template set T0129 166 :FYSHFNEGE 1atiB 168 :MFQDLRGPR Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.53961 Ang E8.CG and G9.N self-bump: 1.34082 Ang E8.CA and E8.CB Number of specific fragments= 1 total=1318 # 1jj2L.166.168 read from T0129.t2k.frag # found chain 1jj2L in template set T0129 166 :FYSHFNEGE 1jj2L 169 :RCRGLRGQG Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.2161 Ang E10.CB and G11.N other bump:1.97578 Ang F2.CD2 and N7.OD1 other bump:2.65573 Ang F2.CE2 and N7.OD1 other bump:2.36724 Ang S4.OG and F6.CD1 Number of specific fragments= 1 total=1319 # 1g6aA.166.168 read from T0129.t2k.frag # found chain 1g6aA in template set T0129 166 :FYSHFNEGE 1g6aA 191 :NKFLFGSAL Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.26893 Ang Y3.CD1 and N7.ND2 other bump:2.80704 Ang Y3.CA and N7.ND2 Number of specific fragments= 1 total=1320 # 1jmxA.166.168 read from T0129.t2k.frag # found chain 1jmxA in template set T0129 166 :FYSHFNEGE 1jmxA 169 :EWQKARPKA Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1321 # 1cbg.167.167 read from T0129.t2k.frag # found chain 1cbg in template set T0129 167 :YSHFNEGEI 1cbg 168 :FKEFGDRVK Fragment has 13 clashes (null) has 13 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.42173 Ang Y2.CA and N6.OD1 other bump:2.88924 Ang Y2.CD1 and N6.OD1 other bump:1.17685 Ang Y2.O and N6.ND2 other bump:1.50257 Ang Y2.CA and N6.ND2 other bump:2.23201 Ang Y2.CB and N6.ND2 other bump:1.18895 Ang Y2.C and N6.ND2 other bump:2.46527 Ang S3.N and N6.ND2 other bump:1.77548 Ang Y2.O and N6.CG other bump:2.23199 Ang Y2.CA and N6.CG other bump:3.10522 Ang Y2.CB and N6.CG other bump:2.30573 Ang Y2.C and N6.CG other bump:2.15673 Ang Y2.O and N6.CB other bump:3.23265 Ang Y2.C and N6.CB Number of specific fragments= 1 total=1322 # 1atiA.167.168 read from T0129.t2k.frag # found chain 1atiA in template set T0129 167 :YSHFNEGEI 1atiA 169 :FQDLRGPRG Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.64137 Ang E9.OE1 and I10.CG1 neighbor-bump: 2.60019 Ang E7.CG and G8.N self-bump: 1.3546 Ang E7.CA and E7.CB Number of specific fragments= 1 total=1323 # 1atiB.167.168 read from T0129.t2k.frag # found chain 1atiB in template set T0129 167 :YSHFNEGEI 1atiB 169 :FQDLRGPRG Fragment has 4 clashes (null) has 4 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:3.09431 Ang E9.CG and G11.N neighbor-bump: 2.44888 Ang E9.OE1 and I10.CG1 neighbor-bump: 2.53962 Ang E7.CG and G8.N self-bump: 1.34082 Ang E7.CA and E7.CB Number of specific fragments= 1 total=1324 # 1g6aA.167.169 read from T0129.t2k.frag # found chain 1g6aA in template set T0129 167 :YSHFNEGEI 1g6aA 192 :KFLFGSALS Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.26892 Ang Y2.CD1 and N6.ND2 other bump:2.80704 Ang Y2.CA and N6.ND2 Number of specific fragments= 1 total=1325 # 1jj2L.167.169 read from T0129.t2k.frag # found chain 1jj2L in template set T0129 167 :YSHFNEGEI 1jj2L 170 :CRGLRGQGK Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.85914 Ang E7.OE1 and I10.C other bump:1.65309 Ang E7.OE1 and I10.O neighbor-bump: 2.36979 Ang E9.CG and I10.N self-bump: 2.51731 Ang E9.CG and E9.C self-bump: 1.35106 Ang E9.CA and E9.CB other bump:2.36724 Ang S3.OG and F5.CD1 Number of specific fragments= 1 total=1326 # 1jmxA.167.169 read from T0129.t2k.frag # found chain 1jmxA in template set T0129 167 :YSHFNEGEI 1jmxA 170 :WQKARPKAD Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1327 # 1cbg.168.168 read from T0129.t2k.frag # found chain 1cbg in template set T0129 168 :SHFNEGEIE 1cbg 169 :KEFGDRVKH Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.17685 Ang G1.O and N5.ND2 other bump:1.18895 Ang G1.C and N5.ND2 other bump:2.46527 Ang S2.N and N5.ND2 other bump:1.77548 Ang G1.O and N5.CG other bump:2.30573 Ang G1.C and N5.CG other bump:2.15673 Ang G1.O and N5.CB other bump:3.23265 Ang G1.C and N5.CB Number of specific fragments= 1 total=1328 # 1atiA.168.169 read from T0129.t2k.frag # found chain 1atiA in template set T0129 168 :SHFNEGEIE 1atiA 170 :QDLRGPRGG Fragment has 11 clashes (null) has 11 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.94714 Ang E8.CB and E10.OE2 other bump:1.72944 Ang E8.CG and E10.OE2 other bump:2.1368 Ang E8.CB and E10.OE1 other bump:2.23998 Ang E8.CB and E10.CD other bump:1.98362 Ang E8.CG and E10.CD other bump:2.93115 Ang E8.CG and E10.CG other bump:2.66122 Ang F4.CD1 and I9.CD1 other bump:2.57343 Ang F4.CE1 and I9.CD1 neighbor-bump: 2.26924 Ang E8.OE1 and I9.CG2 neighbor-bump: 2.60019 Ang E6.CG and G7.N self-bump: 1.3546 Ang E6.CA and E6.CB Number of specific fragments= 1 total=1329 # 1atiB.168.169 read from T0129.t2k.frag # found chain 1atiB in template set T0129 168 :SHFNEGEIE 1atiB 170 :QDLRGPRGG Fragment has 13 clashes (null) has 13 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.76132 Ang E8.CB and E10.OE2 other bump:1.75727 Ang E8.CG and E10.OE2 other bump:2.78135 Ang E8.C and E10.OE1 other bump:1.84302 Ang E8.CB and E10.OE1 other bump:2.35273 Ang E8.CG and E10.OE1 other bump:1.93532 Ang E8.CB and E10.CD other bump:1.8382 Ang E8.CG and E10.CD other bump:2.69455 Ang E8.CG and E10.CG other bump:3.09431 Ang E8.CG and E10.N neighbor-bump: 2.11608 Ang E8.OE1 and I9.CG2 neighbor-bump: 3.3316 Ang E8.CD and I9.CG2 neighbor-bump: 2.53961 Ang E6.CG and G7.N self-bump: 1.34081 Ang E6.CA and E6.CB Number of specific fragments= 1 total=1330 # 1jj2L.168.170 read from T0129.t2k.frag # found chain 1jj2L in template set T0129 168 :SHFNEGEIE 1jj2L 171 :RGLRGQGKG Fragment has 12 clashes (null) has 12 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.16238 Ang E6.OE2 and E10.OE1 neighbor-bump: 2.93614 Ang I9.CG2 and E10.CA neighbor-bump: 2.45344 Ang I9.CB and E10.N neighbor-bump: 1.79061 Ang I9.CG2 and E10.N self-bump: 2.35165 Ang I9.CG2 and I9.C other bump:2.85914 Ang E6.OE1 and I9.C other bump:1.65309 Ang E6.OE1 and I9.O self-bump: 1.34917 Ang I9.CA and I9.CB neighbor-bump: 2.36979 Ang E8.CG and I9.N self-bump: 2.51731 Ang E8.CG and E8.C self-bump: 1.35106 Ang E8.CA and E8.CB other bump:2.6438 Ang S2.OG and F4.CD1 Number of specific fragments= 1 total=1331 # 1g6aA.168.170 read from T0129.t2k.frag # found chain 1g6aA in template set T0129 168 :SHFNEGEIE 1g6aA 193 :FLFGSALSE Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1332 # 1jmxA.168.170 read from T0129.t2k.frag # found chain 1jmxA in template set T0129 168 :SHFNEGEIE 1jmxA 171 :QKARPKADA Fragment has 3 clashes (null) has 3 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.77003 Ang G7.CA and E10.OE1 other bump:1.4595 Ang G7.O and E10.OE1 other bump:2.19079 Ang G7.C and E10.OE1 Number of specific fragments= 1 total=1333 # 1atiA.169.170 read from T0129.t2k.frag # found chain 1atiA in template set T0129 169 :HFNEGEIES 1atiA 171 :DLRGPRGGR Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.90489 Ang E7.CG and E9.CG other bump:2.57343 Ang F3.CE1 and I8.CD1 other bump:2.66122 Ang F3.CD1 and I8.CD1 neighbor-bump: 2.26924 Ang E7.OE1 and I8.CG2 neighbor-bump: 2.60019 Ang E5.CG and G6.N self-bump: 1.3546 Ang E5.CA and E5.CB Number of specific fragments= 1 total=1334 # 1cbg.169.169 read from T0129.t2k.frag # found chain 1cbg in template set T0129 169 :HFNEGEIES 1cbg 170 :EFGDRVKHW Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1335 # 1atiB.169.170 read from T0129.t2k.frag # found chain 1atiB in template set T0129 169 :HFNEGEIES 1atiB 171 :DLRGPRGGR Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.67081 Ang E7.CG and E9.CG other bump:3.09431 Ang E7.CG and E9.N neighbor-bump: 3.3316 Ang E7.CD and I8.CG2 neighbor-bump: 2.11608 Ang E7.OE1 and I8.CG2 neighbor-bump: 2.53961 Ang E5.CG and G6.N self-bump: 1.34081 Ang E5.CA and E5.CB Number of specific fragments= 1 total=1336 # 1qbiA.169.171 read from T0129.t2k.frag # found chain 1qbiA in template set T0129 169 :HFNEGEIES 1qbiA 172 :LFLPNQAQH Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1337 # 1cruA.169.171 read from T0129.t2k.frag # found chain 1cruA in template set T0129 169 :HFNEGEIES 1cruA 172 :LFLPNQAQH Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.8417 Ang H2.CD2 and F3.CZ neighbor-bump: 3.01207 Ang H2.CD2 and F3.CE2 Number of specific fragments= 1 total=1338 # 1c9uA.169.171 read from T0129.t2k.frag # found chain 1c9uA in template set T0129 169 :HFNEGEIES 1c9uA 172 :LFLPNQAQH Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.10986 Ang E7.OE1 and S10.OG other bump:2.64026 Ang E7.OE1 and S10.CB neighbor-bump: 2.62604 Ang H2.CD2 and F3.CZ neighbor-bump: 2.60938 Ang H2.CD2 and F3.CE2 neighbor-bump: 2.88428 Ang H2.NE2 and F3.CE2 neighbor-bump: 2.96403 Ang H2.CD2 and F3.CE1 Number of specific fragments= 1 total=1339 # 1atiA.170.171 read from T0129.t2k.frag # found chain 1atiA in template set T0129 170 :FNEGEIESK 1atiA 172 :LRGPRGGRG Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.90489 Ang E6.CG and E8.CG other bump:2.57342 Ang F2.CE1 and I7.CD1 other bump:2.66121 Ang F2.CD1 and I7.CD1 neighbor-bump: 2.26924 Ang E6.OE1 and I7.CG2 neighbor-bump: 2.60019 Ang E4.CG and G5.N self-bump: 1.3546 Ang E4.CA and E4.CB Number of specific fragments= 1 total=1340 # 1qbiA.170.172 read from T0129.t2k.frag # found chain 1qbiA in template set T0129 170 :FNEGEIESK 1qbiA 173 :FLPNQAQHT Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1341 # 1cruA.170.172 read from T0129.t2k.frag # found chain 1cruA in template set T0129 170 :FNEGEIESK 1cruA 173 :FLPNQAQHT Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1342 # 1c9uA.170.172 read from T0129.t2k.frag # found chain 1c9uA in template set T0129 170 :FNEGEIESK 1c9uA 173 :FLPNQAQHT Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.10986 Ang E6.OE1 and S9.OG other bump:2.64026 Ang E6.OE1 and S9.CB Number of specific fragments= 1 total=1343 # 1atiB.170.171 read from T0129.t2k.frag # found chain 1atiB in template set T0129 170 :FNEGEIESK 1atiB 172 :LRGPRGGRG Fragment has 6 clashes (null) has 6 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.67081 Ang E6.CG and E8.CG other bump:3.09431 Ang E6.CG and E8.N neighbor-bump: 3.3316 Ang E6.CD and I7.CG2 neighbor-bump: 2.11608 Ang E6.OE1 and I7.CG2 neighbor-bump: 2.53961 Ang E4.CG and G5.N self-bump: 1.34081 Ang E4.CA and E4.CB Number of specific fragments= 1 total=1344 # 1jj2L.170.172 read from T0129.t2k.frag # found chain 1jj2L in template set T0129 170 :FNEGEIESK 1jj2L 173 :LRGQGKGSE Fragment has 18 clashes (null) has 18 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.99369 Ang E4.CD and E8.OE1 other bump:1.19206 Ang E4.OE2 and E8.OE1 other bump:2.88293 Ang E4.CD and E8.CD other bump:2.37931 Ang E4.OE2 and E8.CD neighbor-bump: 2.15702 Ang I7.O and E8.CB neighbor-bump: 2.56693 Ang I7.C and E8.CB other bump:2.22316 Ang E4.OE1 and E8.CB other bump:3.02021 Ang E4.CD and E8.CB neighbor-bump: 2.93614 Ang I7.CG2 and E8.CA neighbor-bump: 2.45344 Ang I7.CB and E8.N neighbor-bump: 1.79061 Ang I7.CG2 and E8.N self-bump: 2.35165 Ang I7.CG2 and I7.C other bump:2.85914 Ang E4.OE1 and I7.C other bump:1.6531 Ang E4.OE1 and I7.O self-bump: 1.34917 Ang I7.CA and I7.CB neighbor-bump: 2.36979 Ang E6.CG and I7.N self-bump: 2.51731 Ang E6.CG and E6.C self-bump: 1.35106 Ang E6.CA and E6.CB Number of specific fragments= 1 total=1345 # 1qbiA.171.173 read from T0129.t2k.frag # found chain 1qbiA in template set T0129 171 :NEGEIESKP 1qbiA 174 :LPNQAQHTP Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1346 # 1cruA.171.173 read from T0129.t2k.frag # found chain 1cruA in template set T0129 171 :NEGEIESKP 1cruA 174 :LPNQAQHTP Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1347 # 1c9uA.171.173 read from T0129.t2k.frag # found chain 1c9uA in template set T0129 171 :NEGEIESKP 1c9uA 174 :LPNQAQHTP Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.10986 Ang E5.OE1 and S8.OG other bump:2.64026 Ang E5.OE1 and S8.CB Number of specific fragments= 1 total=1348 # 1atiA.171.172 read from T0129.t2k.frag # found chain 1atiA in template set T0129 171 :NEGEIESKP 1atiA 173 :RGPRGGRGL Fragment has 12 clashes (null) has 12 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.18289 Ang K9.N and P10.CD neighbor-bump: 2.14489 Ang K9.CA and P10.CD self-bump: 1.29778 Ang P10.N and P10.CD neighbor-bump: 2.64173 Ang K9.CB and P10.CD neighbor-bump: 1.71617 Ang K9.C and P10.CD other bump:2.55994 Ang E7.O and P10.CD other bump:3.10976 Ang E7.C and P10.CD self-bump: 2.157 Ang P10.N and P10.CG other bump:2.90489 Ang E5.CG and E7.CG neighbor-bump: 2.26924 Ang E5.OE1 and I6.CG2 neighbor-bump: 2.60018 Ang E3.CG and G4.N self-bump: 1.35461 Ang E3.CA and E3.CB Number of specific fragments= 1 total=1349 # 1jj2L.171.176 read from T0129.t2k.frag # found chain 1jj2L in template set T0129 171 :NEGEIESKP 1jj2L 177 :GKGSEKVRP Fragment has 7 clashes (null) has 7 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.96655 Ang N2.O and E5.OE1 other bump:2.55599 Ang N2.C and E5.OE1 neighbor-bump: 2.72093 Ang N2.OD1 and E3.C neighbor-bump: 2.06278 Ang N2.OD1 and E3.O neighbor-bump: 2.76544 Ang N2.OD1 and E3.CA neighbor-bump: 2.40169 Ang N2.CB and E3.N neighbor-bump: 2.20623 Ang N2.OD1 and E3.N Number of specific fragments= 1 total=1350 # 1atiB.171.172 read from T0129.t2k.frag # found chain 1atiB in template set T0129 171 :NEGEIESKP 1atiB 173 :RGPRGGRGL Fragment has 16 clashes (null) has 16 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.62626 Ang E7.O and P10.CD other bump:3.10591 Ang E7.C and P10.CD neighbor-bump: 2.12579 Ang K9.CA and P10.CD neighbor-bump: 2.653 Ang K9.CB and P10.CD neighbor-bump: 1.70113 Ang K9.C and P10.CD self-bump: 1.29729 Ang P10.N and P10.CD neighbor-bump: 2.1252 Ang K9.N and P10.CD other bump:3.12208 Ang E7.CB and P10.CG neighbor-bump: 2.8434 Ang K9.C and P10.CG self-bump: 2.15623 Ang P10.N and P10.CG other bump:2.67081 Ang E5.CG and E7.CG other bump:3.09431 Ang E5.CG and E7.N neighbor-bump: 3.3316 Ang E5.CD and I6.CG2 neighbor-bump: 2.11608 Ang E5.OE1 and I6.CG2 neighbor-bump: 2.53961 Ang E3.CG and G4.N self-bump: 1.34081 Ang E3.CA and E3.CB Number of specific fragments= 1 total=1351 # 1qbiA.172.174 read from T0129.t2k.frag # found chain 1qbiA in template set T0129 172 :EGEIESKPV 1qbiA 175 :PNQAQHTPT Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1352 # 1cruA.172.174 read from T0129.t2k.frag # found chain 1cruA in template set T0129 172 :EGEIESKPV 1cruA 175 :PNQAQHTPT Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1353 # 1c9uA.172.174 read from T0129.t2k.frag # found chain 1c9uA in template set T0129 172 :EGEIESKPV 1c9uA 175 :PNQAQHTPT Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.10986 Ang E4.OE1 and S7.OG other bump:2.64026 Ang E4.OE1 and S7.CB Number of specific fragments= 1 total=1354 # 1jj2L.172.177 read from T0129.t2k.frag # found chain 1jj2L in template set T0129 172 :EGEIESKPV 1jj2L 178 :KGSEKVRPS Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:1.96655 Ang G1.O and E4.OE1 other bump:2.55599 Ang G1.C and E4.OE1 Number of specific fragments= 1 total=1355 # 1atiA.172.173 read from T0129.t2k.frag # found chain 1atiA in template set T0129 172 :EGEIESKPV 1atiA 174 :GPRGGRGLL Fragment has 12 clashes (null) has 12 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues neighbor-bump: 2.18289 Ang K8.N and P9.CD neighbor-bump: 2.64173 Ang K8.CB and P9.CD neighbor-bump: 2.1449 Ang K8.CA and P9.CD neighbor-bump: 1.71617 Ang K8.C and P9.CD self-bump: 1.29778 Ang P9.N and P9.CD other bump:3.10976 Ang E6.C and P9.CD other bump:2.55994 Ang E6.O and P9.CD self-bump: 2.157 Ang P9.N and P9.CG other bump:2.90489 Ang E4.CG and E6.CG neighbor-bump: 2.26924 Ang E4.OE1 and I5.CG2 self-bump: 2.21651 Ang E2.CB and E2.C self-bump: 1.3498 Ang E2.CA and E2.CB Number of specific fragments= 1 total=1356 # 1atiB.172.173 read from T0129.t2k.frag # found chain 1atiB in template set T0129 172 :EGEIESKPV 1atiB 174 :GPRGGRGLL Fragment has 16 clashes (null) has 16 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.62626 Ang E6.O and P9.CD other bump:3.10591 Ang E6.C and P9.CD neighbor-bump: 2.12579 Ang K8.CA and P9.CD neighbor-bump: 2.653 Ang K8.CB and P9.CD neighbor-bump: 1.70113 Ang K8.C and P9.CD self-bump: 1.29729 Ang P9.N and P9.CD neighbor-bump: 2.1252 Ang K8.N and P9.CD other bump:3.12208 Ang E6.CB and P9.CG neighbor-bump: 2.84339 Ang K8.C and P9.CG self-bump: 2.15622 Ang P9.N and P9.CG other bump:2.67081 Ang E4.CG and E6.CG other bump:3.09431 Ang E4.CG and E6.N neighbor-bump: 3.3316 Ang E4.CD and I5.CG2 neighbor-bump: 2.11608 Ang E4.OE1 and I5.CG2 self-bump: 2.20073 Ang E2.CB and E2.C self-bump: 1.33693 Ang E2.CA and E2.CB Number of specific fragments= 1 total=1357 # 1jj2L.173.178 read from T0129.t2k.frag # found chain 1jj2L in template set T0129 173 :GEIESKPVL 1jj2L 179 :GSEKVRPSL Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1358 # 1qbiA.173.175 read from T0129.t2k.frag # found chain 1qbiA in template set T0129 173 :GEIESKPVL 1qbiA 176 :NQAQHTPTQ Fragment has 0 clashes (null) has 0 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues Number of specific fragments= 1 total=1359 # 1cruA.173.175 read from T0129.t2k.frag # found chain 1cruA in template set T0129 173 :GEIESKPVL 1cruA 176 :NQAQHTPTQ Fragment has 1 clashes (null) has 1 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.80763 Ang V9.CG1 and G11.N Number of specific fragments= 1 total=1360 # 1c9uA.173.175 read from T0129.t2k.frag # found chain 1c9uA in template set T0129 173 :GEIESKPVL 1c9uA 176 :NQAQHTPTQ Fragment has 2 clashes (null) has 2 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.10986 Ang E3.OE1 and S6.OG other bump:2.64026 Ang E3.OE1 and S6.CB Number of specific fragments= 1 total=1361 # 1atiA.173.173 read from T0129.t2k.frag # found chain 1atiA in template set T0129 173 :GEIESKPVL 1atiA 174 :GPRGGRGLL Fragment has 8 clashes (null) has 8 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.80825 Ang S6.OG and V9.CG2 neighbor-bump: 2.38146 Ang K7.CA and P8.CD neighbor-bump: 2.78604 Ang K7.CB and P8.CD neighbor-bump: 2.05487 Ang K7.C and P8.CD self-bump: 1.3113 Ang P8.N and P8.CD other bump:2.92973 Ang S6.C and P8.CD neighbor-bump: 2.36515 Ang K7.N and P8.CD self-bump: 2.16635 Ang P8.N and P8.CG Number of specific fragments= 1 total=1362 # 1atiB.173.173 read from T0129.t2k.frag # found chain 1atiB in template set T0129 173 :GEIESKPVL 1atiB 174 :GPRGGRGLL Fragment has 8 clashes (null) has 8 clashes, 0 disulphide bonds, and 0 hydrogen bonds in 11 residues other bump:2.59981 Ang S6.OG and V9.CG2 neighbor-bump: 2.47258 Ang K7.N and P8.CD neighbor-bump: 2.44732 Ang K7.CA and P8.CD neighbor-bump: 2.10839 Ang K7.C and P8.CD self-bump: 1.31898 Ang P8.N and P8.CD neighbor-bump: 2.80108 Ang K7.CB and P8.CD self-bump: 2.17834 Ang P8.N and P8.CG neighbor-bump: 2.75905 Ang I4.CG2 and E5.N Number of specific fragments= 1 total=1363 # command:# Prefix for output files set to # command:# Printing 100 template chains to Template.atoms # Printed template library # command:# Prefix for output files set to decoys/ # command:# Setting InsertAlignment to 0 # Setting ClashingRotamer to 0.5 # Setting InsertFragment to 7 # Setting CrossAndInsert to 1 # Setting CrossOver to 0 # Setting InsertSpecificFragment to 7 # Setting ReduceBreak to 5 # Setting CloseGap to 0.2 # Setting JiggleSubtree to 0.2 # Setting OptSubtree to 0.2 # Setting ReduceClash to 1 # Setting InsertSSBond to 0 # Initial Method pseudocounts set to # InsertAlignment 0 # InsertSpecificFragment 7 # InsertFragment 7 # TwoFragment 0.1 # CrossOver 0 # CrossAndInsert 1 # ReduceClash 1 # OneRotamer 0 # ClashingRotamer 0.5 # ReduceBreak 5 # CloseGap 0.2 # JiggleSubtree 0.2 # OptSubtree 0.2 # ReduceConstraint 0.2 # InsertSSBond 0 # ImproveSSBond 0.2 # command:# naming current conformation T0129.try42 # command:Error: no cost function defined in OptConform (use SetCost first) # command:Error: unrecognized command pool_size skipped # command:Error: unrecognized command use_all skipped # command:# naming current conformation T0129.try42-opt # command:# command:# request to SCWRL produces command: scwrl -i /projects/compbio/tmp/to_scwrl_1753135242.pdb -s /projects/compbio/tmp/to_scwrl_1753135242.seq -o /projects/compbio/tmp/from_scwrl_1753135242.pdb -a /projects/compbio/tmp/from_scwrl_1753135242_a.pdb -b /projects/compbio/tmp/from_scwrl_1753135242_b.pdb > /projects/compbio/tmp/scwrl_1753135242.log # conformation set from SCWRL output # command:# naming current conformation T0129.try42-opt-scwrl # command:# command:# CostConform Cost function not defined---use SetCost before CostConform # command:CPU_time= 61520 msec, elapsed time= 67627.6 msec) # command: