;  SAM: prettyalign v3.2 (July 31, 2000) compiled 07/31/00_16:52:38
;  (c) 1992-1999 Regents of the University of California, Santa Cruz
;
;          Sequence Alignment and Modeling Software System
;         http://www.cse.ucsc.edu/research/compbio/sam.html
;
; ----------------- Citations (SAM, SAM-T99, HMMs) --------------------
; R. Hughey, A. Krogh, Hidden Markov models for sequence analysis:
;  Extension and analysis of the basic method, CABIOS 12:95-107, 1996.
; K. Karplus, C. Barrett, R. Hughey, Hidden Markov models for detecting
;  remote protein homologies, Bioinformatics 14(10):846-856, 1999.
; A. Krogh et al., Hidden Markov models in computational biology:
;  Applications to protein modeling, JMB 235:1501-1531, Feb 1994.
; ---------------------------------------------------------------------
                                      10        20        30        40
                                       |         |         |         |
T0098 ........................DNKPKNLDASITSIIHEIGVPAHIKGYLYLREAIAMVYHD
1pog  rgshmrrrkkrtsietnirvalek----------------------------------------


              50        60        70        80        90       100    
               |         |         |         |         |         |    
T0098 IELLGSITKVLYPDIAKKYNTTASRVERAIRHAIEVAWSRGNLESISSLFGYTVSVSKAKPTNS
1pog  ------------------------------------------------------SFLENQKPTS


         110       120                   
           |         |                   
T0098 EFIAMVADKLRLEHKAS..................
1pog  EEITMIADQLNMEKEV-irvwfcnrrqkekridi.