; SAM: prettyalign v3.2 (July 31, 2000) compiled 08/11/00_16:27:51 ; (c) 1992-2000 Regents of the University of California, Santa Cruz ; ; Sequence Alignment and Modeling Software System ; http://www.cse.ucsc.edu/research/compbio/sam.html ; ; ----------------- Citations (SAM, SAM-T99, HMMs) -------------------- ; R. Hughey, A. Krogh, Hidden Markov models for sequence analysis: ; Extension and analysis of the basic method, CABIOS 12:95-107, 1996. ; K. Karplus, C. Barrett, R. Hughey, Hidden Markov models for detecting ; remote protein homologies, Bioinformatics 14(10):846-856, 1999. ; A. Krogh et al., Hidden Markov models in computational biology: ; Applications to protein modeling, JMB 235:1501-1531, Feb 1994. ; --------------------------------------------------------------------- T0091 .............................................................MFG 2snm atstkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasaf--- 10 20 30 40 50 60 | | | | | | T0091 KGGLGGLMKQAQQMQEKMQKMQEEIAQLEVTGESGAGLVKITINGAHNCRRIDIDPSLMEDDKE 2snm ----------TKKMKENAKKIEVEFDKGQRTDKYGRGLAYIYADGKM----------------- 70 80 90 100 | | | | T0091 MLEDLIAAAFNDAVRRAEELQKEKMASVTAGMPLPPGMKFPF...................... 2snm ------------------------------------------vnealvrqglakvayvykpnnt 110 | T0091 .............................. 2snm heqhlrkseaqakkeklniwsednadsgq.