CASP4 Target T0098
-
1. Protein Name
- Spo0A
-
2. Organism Name
- B. stearothermophilus
-
3. Number of amino acids (approx)
- 121
-
4. Accession number
- g2654215
-
5. Sequence Database
- Genbank
-
6. Amino acid sequence
-
DNKPKNLDASITSIIHEIGVPAHIKGYLYLREAIAMVYHDIELLGSITKV
LYPDIAKKYNTTASRVERAIRHAIEVAWSRGNLESISSLFGYTVSVSKAK
PTNSEFIAMVADKLRLEHKAS
-
7. Additional Information
-
this is the c-terminal, effector domain of Spo0A.
-
8. Homologous Sequence of known structure
- no
-
9. Current state of the experimental work
-
structure solved by x-rays, refined to 2.0A. paper submitted
end of may 2000
-
10. Interpretable map?
- yes
-
11. Estimated date of chain tracing completion
- finished
-
12. Estimated date of public release of structure
- september 2000
-
13. Name
- Unavailable until after public release of structure
-
Related Files
Template Sequence file
Template PDB file