CASP4 Target T0096
-
1. Protein Name
- FadR
-
2. Organism Name
- E.Coli
-
3. Number of amino acids (approx)
- 238
-
4. Accession number
- P09371
-
5. Sequence Database
- Swiss-prot
-
6. Amino acid sequence
-
MVIKAQSPAGFAEEYIIESIWNNRFPPGTIL
PAERELSELIGVTRTTLREVLQRLARDGWL
TIQHGKPTKVNNFWETSGLNILETLARLDH
ESVPQLIDNLLSVRTNISTIFIRTAFRQHP
DKAQEVLATANEVADHADAFAELDYNIFRG
LAFASGNPIYGLILNGMKGLYTRIGRHYFA
NPEARSLALGFYHKLSALCSEGAHDQVYET
VRRYGHESGEIWHRMQKNLPGDLAIQGR
-
7. Additional Information
-
Two domain protein: DNA binding and acyl-coenzyme A binding.
The latter domain has a novel fold (no significant DALI hits).
Site of acyl-CoA binding known from mutations, yet the
structure determination concerns the apo form, so this
could be an interesting ab-inito structure determination
target for the last domain, but also a docking target to
find the binding site (if you can predict the structure
acurately, that is :-) ).
The protein is a HOMODIMER, *both* in presence and absence
of DNA. Binding of acyl-CoA presumably causes a conformational
change, switching off DNA binding and thus transcriptional
respression.
For 8. below: weak homology to HTH DNA binding domains for
the first 72 residues of the structure. No homology for
C-terminal domain.
-
8. Homologous Sequence of known structure
- no
-
9. Current state of the experimental work
-
Structure solved last month by MAD. Refinement done.
Paper submitted.
-
10. Interpretable map?
- yes
-
11. Estimated date of chain tracing completion
- June 1 2000
-
12. Estimated date of public release of structure
- end 2000
-
13. Name
- Unavailable until after public release of structure
-
Related Files
Template Sequence file
Template PDB file