CASP4 Target T0095
-
1. Protein Name
- alpha(E)-catenin fragment
-
2. Organism Name
- mouse
-
3. Number of amino acids (approx)
- 244
-
4. Accession number
- P26231
-
5. Sequence Database
- Swiss-prot
-
6. Amino acid sequence
-
DHVSDSFLETNVPLLVLIEAAKNGNEKEVKEYAQVFREHANKLIEVANLACSISNNEEGVKLVRMSASQLEALCPQV
INAALALAAKPQSKLAQENMDLFKEQWEKQVRVLTDAVDDITSIDDFLAVSENHILEDVNKCVIALQEKDVDGLDRTAGA
IRGRAARVIHVVTSEMDNYEPGVYTEKVLEATKLLSNTVMPRFTEQVEAAVEALSSDPAQPMDENEFIDASRLVYDGIRD
IRKAVLM
-
7. Additional Information
- crystal pH 4.0, no disulfides
-
8. Homologous Sequence of known structure
- no
-
9. Current state of the experimental work
-
2.5 A resolution x-ray crystal structure has been solved,
functional studies are underway before we will prepare it
for publication.
-
10. Interpretable map?
- yes
-
11. Estimated date of chain tracing completion
- completed
-
12. Estimated date of public release of structure
- late 2000/early 2001
-
13. Name
- Unavailable until after public release of structure
-
Related Files
Template Sequence file
Template PDB file